[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49938.1

[Show Plain Result]


## Summary of Sequence Search
    1::640
    9::274     1e-29  34%  403 aa  Y270_SYNE7 RecName: Full=TPR repeat-containing protein
   56::280     5e-22  30%  422 aa  YOLJ_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized
    1::151     2e-20  42%  258 aa  WAAE_KLEPN RecName: Full=Lipopolysaccharide core biosynthesis
    4::203     2e-19  33%  254 aa  Y653_HAEIN RecName: Full=Uncharacterized glycosyltransferase
    3::114     6e-15  37%  283 aa  Y337_RICFE RecName: Full=Uncharacterized glycosyltransferase
    3::114     6e-15  36%  292 aa  Y209_RICTY RecName: Full=Uncharacterized glycosyltransferase
    7::155     4e-14  34%  257 aa  KDTX_SERMA RecName: Full=Lipopolysaccharide core biosynthesis
    8::119     5e-14  34%  282 aa  Y292_RICCN RecName: Full=Uncharacterized glycosyltransferase
    3::216     5e-14  29%  292 aa  Y218_RICPR RecName: Full=Uncharacterized glycosyltransferase RP128;
    8::119     7e-14  36%  294 aa  Y523_RICBR RecName: Full=Uncharacterized glycosyltransferase
    6::116     3e-08  31%  344 aa  YIBD_ECOLI RecName: Full=Uncharacterized glycosyltransferase yibD; 
   71::154     3e-08  40%  375 aa  CRTQ_STAHJ RecName: Full=4,4'-diaponeurosporenoate
  134::313     2e-07  28%  314 aa  Y1345_METJA RecName: Full=TPR repeat-containing protein MJ1345;
  164::495     2e-07  26%  977 aa  SEC_ARATH RecName: Full=Probable UDP-N-acetylglucosamine--peptide
    6::111     6e-07  33%  344 aa  EPSH_BACSU RecName: Full=Putative glycosyltransferase epsH;        
   34::110     4e-06  36%  299 aa  Y075_MYCPN RecName: Full=Uncharacterized glycosyltransferase MG060
   27::145     5e-06  33%  320 aa  Y263_METJA RecName: Full=TPR repeat-containing protein MJ0263;
   18::207     7e-06  23%  318 aa  Y940_METJA RecName: Full=TPR repeat-containing protein MJ0940;
   34::117     7e-06  32%  297 aa  Y060_MYCGE RecName: Full=Uncharacterized glycosyltransferase MG060;
    7::91      9e-06  32%  270 aa  LPSC_RHIME RecName: Full=Lipopolysaccharide core biosynthesis
   35::97      1e-05  45%  256 aa  GLTR1_MYCTU RecName: Full=PGL/p-HBAD biosynthesis
   35::97      1e-05  45%  256 aa  GLTR1_MYCTA RecName: Full=PGL/p-HBAD biosynthesis
   35::97      1e-05  45%  256 aa  GLTR1_MYCBP RecName: Full=PGL/p-HBAD biosynthesis
   35::97      1e-05  45%  256 aa  GLTR1_MYCBO RecName: Full=PGL/p-HBAD biosynthesis
  292::396     6e-05  30%  690 aa  Y706_RICBR RecName: Full=Uncharacterized glycosyltransferase
  324::398     6e-05  32%  602 aa  Y543_RICFE RecName: Full=Uncharacterized glycosyltransferase
  324::398     6e-05  32%  604 aa  Y461_RICCN RecName: Full=Uncharacterized glycosyltransferase
   49::136     6e-05  32%  412 aa  ICAA_STAEP RecName: Full=Biofilm PIA synthesis
  299::482     7e-05  21%  564 aa  STIP1_DICDI RecName: Full=Protein STIP1 homolog;
   49::136     7e-05  38%  412 aa  ICAA_STAEQ RecName: Full=Biofilm PIA synthesis
  315::404     1e-04  29% 1102 aa  CYC8_SCHPO RecName: Full=General transcriptional corepressor ssn6;
 1029::1125    1e-04  32% 1141 aa  TTC17_HUMAN RecName: Full=Tetratricopeptide repeat protein 17;       
  139::578     1e-04  26% 1151 aa  OGT1_CAEEL RecName: Full=UDP-N-acetylglucosamine--peptide
    4::97      2e-04  31%  278 aa  EPSE_BACSU RecName: Full=Putative glycosyltransferase epsE;      
    6::109     2e-04  30%  250 aa  Y868_HAEIN RecName: Full=Uncharacterized glycosyltransferase
  479::637     2e-04  25%  836 aa  TMTC2_HUMAN RecName: Full=Transmembrane and TPR repeat-containing
   49::136     2e-04  36%  412 aa  ICAA_STAAW RecName: Full=Biofilm PIA synthesis
   49::136     2e-04  36%  412 aa  ICAA_STAAS RecName: Full=Biofilm PIA synthesis
    9::183     2e-04  29%  322 aa  ARNC_ECOUT RecName: Full=Undecaprenyl-phosphate
    9::183     2e-04  29%  322 aa  ARNC_ECOSM RecName: Full=Undecaprenyl-phosphate
    9::183     2e-04  29%  322 aa  ARNC_ECOL6 RecName: Full=Undecaprenyl-phosphate
    9::183     2e-04  29%  322 aa  ARNC_ECOL5 RecName: Full=Undecaprenyl-phosphate
    9::183     2e-04  29%  322 aa  ARNC_ECOK1 RecName: Full=Undecaprenyl-phosphate
    9::183     2e-04  29%  322 aa  ARNC_ECO81 RecName: Full=Undecaprenyl-phosphate
    9::183     2e-04  29%  322 aa  ARNC_ECO45 RecName: Full=Undecaprenyl-phosphate
    9::183     2e-04  29%  322 aa  ARNC_ECO27 RecName: Full=Undecaprenyl-phosphate
    1::191     3e-04  23%  206 aa  YRRB_BACSU RecName: Full=TPR repeat-containing protein yrrB;
   49::136     3e-04  36%  412 aa  ICAA_STAAR RecName: Full=Biofilm PIA synthesis
   49::136     3e-04  36%  412 aa  ICAA_STAAN RecName: Full=Biofilm PIA synthesis
   49::136     3e-04  36%  412 aa  ICAA_STAAM RecName: Full=Biofilm PIA synthesis
   49::136     3e-04  36%  412 aa  ICAA_STAAC RecName: Full=Biofilm PIA synthesis
   49::136     3e-04  36%  412 aa  ICAA_STAA8 RecName: Full=Biofilm PIA synthesis
    9::183     3e-04  27%  326 aa  ARNC_SERP5 RecName: Full=Undecaprenyl-phosphate
    9::183     3e-04  29%  322 aa  ARNC_ECO7I RecName: Full=Undecaprenyl-phosphate
  326::422     4e-04  34%  422 aa  YUKF_BACSU RecName: Full=Uncharacterized protein yukF;
  278::466     4e-04  27%  802 aa  Y2245_ARATH RecName: Full=Uncharacterized TPR repeat-containing
  283::471     4e-04  27%  808 aa  Y1515_ARATH RecName: Full=Uncharacterized TPR repeat-containing
  626::700     4e-04  33%  849 aa  TMTC1_DROME RecName: Full=Transmembrane and TPR repeat-containing
  288::389     4e-04  28%  944 aa  SPY_HORVU RecName: Full=Probable UDP-N-acetylglucosamine--peptide
  281::415     4e-04  29% 1036 aa  OGT1_RAT RecName: Full=UDP-N-acetylglucosamine--peptide
  291::425     4e-04  29% 1046 aa  OGT1_PIG RecName: Full=UDP-N-acetylglucosamine--peptide
  291::425     4e-04  29% 1046 aa  OGT1_MOUSE RecName: Full=UDP-N-acetylglucosamine--peptide
  291::425     4e-04  29% 1046 aa  OGT1_HUMAN RecName: Full=UDP-N-acetylglucosamine--peptide
    5::101     4e-04  33%  241 aa  DPM1_DROME RecName: Full=Probable dolichol-phosphate
   33::194     5e-04  26%  392 aa  YFNE_BACSU RecName: Full=Uncharacterized glycosyltransferase yfnE; 
   35::164     5e-04  30%  173 aa  YCF3_MICAN RecName: Full=Photosystem I assembly protein ycf3;
   90::329     5e-04  28%  567 aa  Y1428_METJA RecName: Full=TPR repeat-containing protein MJ1428;
  124::171     5e-04  44%  639 aa  TOM71_YEAST RecName: Full=Protein TOM71;AltName: Full=71 kDa
  479::637     5e-04  24%  836 aa  TMTC2_MOUSE RecName: Full=Transmembrane and TPR repeat-containing
  423::543     5e-04  22%  569 aa  PEX5_PICAN RecName: Full=Peroxisomal targeting signal receptor;    
  202::303     5e-04  24%  474 aa  IFT1L_HUMAN RecName: Full=Interferon-induced protein with
    5::113     5e-04  28%  344 aa  EPSJ_BACSU RecName: Full=Uncharacterized glycosyltransferase epsJ; 
    9::183     5e-04  29%  322 aa  ARNC_ECO5E RecName: Full=Undecaprenyl-phosphate
    9::183     5e-04  29%  322 aa  ARNC_ECO57 RecName: Full=Undecaprenyl-phosphate
  288::389     6e-04  27%  927 aa  SPY_ORYSJ RecName: Full=Probable UDP-N-acetylglucosamine--peptide
  143::209     6e-04  24%  318 aa  SOLR_CLOAB RecName: Full=Sol locus transcriptional repressor;
  195::249     6e-04  37%  334 aa  SGT_DICDI RecName: Full=Small glutamine-rich tetratricopeptide
  442::542     6e-04  32%  972 aa  HAS_PASMU RecName: Full=Hyaluronan synthase;       
  435::535     6e-04  32%  965 aa  CHS_PASMU RecName: Full=Chondroitin synthase;       
    9::117     6e-04  32%  341 aa  ARNC_PSEFS RecName: Full=Undecaprenyl-phosphate
    8::116     6e-04  35%  327 aa  ARNC_PECCP RecName: Full=Undecaprenyl-phosphate
    9::101     6e-04  32%  326 aa  ARNC_AERHH RecName: Full=Undecaprenyl-phosphate
   35::98      6e-04  43%  301 aa  AMSB_ERWAM RecName: Full=Amylovoran biosynthesis
  471::521     8e-04  33%  576 aa  PEX5_PICPA RecName: Full=Peroxisomal targeting signal receptor;    
   90::278     8e-04  25%  796 aa  MDM20_YEAST RecName: Full=N-terminal acetyltransferase B complex
    9::119     8e-04  32%  327 aa  ARNC_YERPN RecName: Full=Undecaprenyl-phosphate
    9::119     8e-04  32%  327 aa  ARNC_YERPG RecName: Full=Undecaprenyl-phosphate
    9::119     8e-04  32%  327 aa  ARNC_YERPE RecName: Full=Undecaprenyl-phosphate
    9::119     8e-04  32%  327 aa  ARNC_YERPA RecName: Full=Undecaprenyl-phosphate
    1::640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGNRISLCMIVKNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWNNNFSDARNFS
Y270_SYNE7      ---QVSLCMIVRDEAELLPRCLASVKDQVDELIVLDTGSRDRTPAIATEAGAKLLHTDWADDFSAARNQA
YOLJ_BACSU      ----ITCGIIVYNESKRIKKCLNSVKDDFNEIIVLDSYSTDDTVDIIKFPDVEIKYEKWKNDFSYARNKI
WAAE_KLEPN      MSNRLSVVMIAKNAADLLPDCLGSVSWA-DEIIVLDSGSTDNTVELARRLGAQVYTHTDWRGYGIQRQRA
Y653_HAEIN      ----ISVAMIIKNEAQDLANCLDTVKDWVDEIIILDSGSTDNTKEIALSYGAKFYENSDWQGFGKQRQLA
Y337_RICFE      ---KISAFIITKNEAARIARAINSVKNIVDEVIVVDSESTDDTVAIAEQLGAKVIVKPW-LGYVGQKSFA
Y209_RICTY      ---KISTFIITKNEEARIARAINSVKNITDEVIVVDNESTDDTVHIAKTLGAKVIVKPW-LGYVGQKSFA
KDTX_SERMA      ----LSVVMIAKNEAGLLPDCLRSVAWA-DEIIVLDSGSEDDSVAVAESLGAKVFTHTDWQGFGKQRQLA
Y292_RICCN      ---KISAFIITKNESTRVARAINSVKNITDEVIVVDSESTDDTVAIAEKLGAKVVIKPW-LGYVGQKSFA
Y218_RICPR      ---KISTFIITKNESARIARAINSVKNITDEVIVVDNESTDDTVHIAKTLGAQVIVKPW-LGYVGQKSFA
Y523_RICBR      ---KISAFIITKNEAARIERAINSVKNIADEVIVVDSESTDKTVIIAESLGAKVVVKPW-LGYVGQKSFA
YIBD_ECOLI      --NKLSVIIPLYNAGDDFRTCMESLTWTALEIIIINDGSTDNSVEIAKYYAENYLLHQANAGASVARNRG
CRTQ_STAHJ      ------------------------------ECIVMDDDSNDRTAEIAREMGAKVYNVTYDNNKSYACYLG
Y1345_METJA     ----------------------------------------------------------------------
SEC_ARATH       ----------------------------------------------------------------------
EPSH_BACSU      ----VSLLVAVYNTETYIRTCLESLRNQTMEIIIVNDGSADASPDIAEEYAKMDNRFQENQGLGAVRNKG
Y075_MYCPN      ------------------------------EVLVIDDGSIDNTRQIIKKFQAKVYFYKKNGNWGSVINYV
Y263_METJA      ----------------------------------------------------------------------
Y940_METJA      ----------------------------------------------------------------------
Y060_MYCGE      ------------------------------EVLIIDDGSIDNTNKVIKKIQDQIYFYKSNGNWGSVRNNK
LPSC_RHIME      ----LSAFIICLNEEAYLGKCIESLERCA-EIVIVDSGSTDGTAALVQDAGWPIFMYEPWRGYAGQKQFA
GLTR1_MYCTU     ------------------------------ELVLVDGGSTDETLDIANNLGERIIHRDTDQGVYDAMNRG
GLTR1_MYCTA     ------------------------------ELVLVDGGSTDETLDIANNLGERIIHRDTDQGVYDAMNRG
GLTR1_MYCBP     ------------------------------ELVLVDGGSTDETLDIANNLGERIIHRDTDQGVYDAMNRG
GLTR1_MYCBO     ------------------------------ELVLVDGGSTDETLDIANNLGERIIHRDTDQGVYDAMNRG
Y706_RICBR      ---KVSVIIPVYNR---INWTIQSIESVLNEVIVINDGSTEDISELIKKKDKRIYFHKKNEGPASARNLG
Y543_RICFE      ------------------------------EILIIDDGSTDDISELTSKKDKRIYFHKKNEGPAAARNLG
Y461_RICCN      ------------------------------EILIIDDGSTDDISELTAKKDKRIYFHKKNEGPAAARNLG
ICAA_STAEP      ----ISFLLACYNESETVQDTLSSVLSLEKEIIIINDGSSDNTAEIIYEFDFKFVDLEVNRGKANALNEG
STIP1_DICDI     ----------------------------------------------------------------------
ICAA_STAEQ      ----ISFLLACYNESETVQDTLSSVLSLEKEIIIINDGSSDNTAEI-------IYDFKKNHDFANALNEG
CYC8_SCHPO      ----------------------------------------------------------------------
TTC17_HUMAN     ----------------------------------------------------------------------
OGT1_CAEEL      ----------------------------------------------------------------------
EPSE_BACSU      -GPKVSVIMGIYNCERTLAESIESILSQSYELILCDDASTDGTLRIAKQYAAKLIQNKTNKRLAASLNHC
Y868_HAEIN      ----ISIIMPVYNAECYLNQGILSCLNQSYELILIDDGSTXXXXXXXXXXXVKLFFTPTNQGPAAARNIG
TMTC2_HUMAN     ----------------------------------------------------------------------
ICAA_STAAW      ----ITFLLACYNESDTIEDTLSNVLALKKEIIIINDGSSDNTAEL-------IYKIKENNDFANALNQG
ICAA_STAAS      ----ITFLLACYNESDTIEDTLSNVLALKKEIIIINDGSSDNTAEL-------IYKIKENNDFANALNQG
ARNC_ECOUT      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
ARNC_ECOSM      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
ARNC_ECOL6      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
ARNC_ECOL5      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
ARNC_ECOK1      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
ARNC_ECO81      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
ARNC_ECO45      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
ARNC_ECO27      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMLVEAGSHIVSILLNRNYGSAIMAG
YRRB_BACSU      ----------------------------------------------------------------------
ICAA_STAAR      ----ITFLLACYNESETIEDTLSNVLALKKEIIIINDGSSDNTAEL-------IYKIKENNDFANALNQG
ICAA_STAAN      ----ITFLLACYNESETIEDTLSNVLALKKEIIIINDGSSDNTAEL-------IYKIKENNDFANALNQG
ICAA_STAAM      ----ITFLLACYNESETIEDTLSNVLALKKEIIIINDGSSDNTAEL-------IYKIKENNDFANALNQG
ICAA_STAAC      ----ITFLLACYNESETIEDTLSNVLALKKEIIIINDGSSDNTAEL-------IYKIKENNDFANALNQG
ICAA_STAA8      ----ITFLLACYNESETIEDTLSNVLALKKEIIIINDGSSDNTAEL-------IYKIKENNDFANALNQG
ARNC_SERP5      ---KVSVVIPVYNEQESLPALLERTTAACKEIILVDDGSSDNSADMAEQPGSCVIAVLLNRNYGSAIMAG
ARNC_ECO7I      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHMSQAEGSHIVSILLNRNYGSAIMAG
YUKF_BACSU      ----------------------------------------------------------------------
Y2245_ARATH     ----------------------------------------------------------------------
Y1515_ARATH     ----------------------------------------------------------------------
TMTC1_DROME     ----------------------------------------------------------------------
SPY_HORVU       ----------------------------------------------------------------------
OGT1_RAT        ----------------------------------------------------------------------
OGT1_PIG        ----------------------------------------------------------------------
OGT1_MOUSE      ----------------------------------------------------------------------
OGT1_HUMAN      ----------------------------------------------------------------------
DPM1_DROME      -GHKYSILMPTYNEKDNLPIIIMKASGLEYEVIVIDDGSPDGTLDVAKDL-QKIYGEDSKLGLGTAYIHG
YFNE_BACSU      ------------------------------EVIVADNGSEDGTLSMLESFQADFTRIKENRGIAYGRNQA
YCF3_MICAN      ----------------------------------------------------------------------
Y1428_METJA     ----------------------------------------------------------------------
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     ----------------------------------------------------------------------
PEX5_PICAN      ----------------------------------------------------------------------
IFT1L_HUMAN     ----------------------------------------------------------------------
EPSJ_BACSU      ----VSIIVPMYNVEPFIEECIDSLTLSDIEIILVNDGTPDRSGEIAEDYAKRDARIQANGGLSSARNTG
ARNC_ECO5E      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHILVEANSHIVSILLNRNYGSAIMAG
ARNC_ECO57      ---KVSVVIPVYNEQESLPELIRRTTGKEYEILLIDDGSSDNSAHILVEANSHIVSILLNRNYGSAIMAG
SPY_ORYSJ       ----------------------------------------------------------------------
SOLR_CLOAB      ----------------------------------------------------------------------
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       ----VSIYIPAYNCANYIQRCVDSATVVDLEVCICNDGSTDNTLEVINKLRVRIMS-KPNGGIASASNAA
CHS_PASMU       ----VSIYIPAYNCANYIQRCVDSATVVDLEVCICNDGSTDNTLEVINKLRVRIMS-KPNGGIASASNAA
ARNC_PSEFS      ----VSIVIPVYNEQESLPELLRRTTAACKEIILVDDGSRDNSAQLAAEDGSNVVAVILNRNYGQAIMAG
ARNC_PECCP      ----VSVVIPVYNEEESIERTLAACRQIGKEIILVDDGSSDRSAELLTEAASHIIAVLLNRNYGQAIMAG
ARNC_AERHH      ----VSVVIPVYNEEASLPALLSRVTAACDEVILIDDGSHDGSTELIRDAGSKLVGVLLNRNYGQAIMAG
AMSB_ERWAM      ------------------------------DVIIVDDKSADAQ-KLAEVVSSERYSSETKLNGAGARNRG
PEX5_PICPA      ----------------------------------------------------------------------
MDM20_YEAST     ----------------------------------------------------------------------
ARNC_YERPN      ---KVSIVIPVYNEQESLPALIDRTTAACKEIILVDDGSSDNSTELANDPDSHIIAILLNRNYGSAIMAG
ARNC_YERPG      ---KVSIVIPVYNEQESLPALIDRTTAACKEIILVDDGSSDNSTELANDPDSHIIAILLNRNYGSAIMAG
ARNC_YERPE      ---KVSIVIPVYNEQESLPALIDRTTAACKEIILVDDGSSDNSTELANDPDSHIIAILLNRNYGSAIMAG
ARNC_YERPA      ---KVSIVIPVYNEQESLPALIDRTTAACKEIILVDDGSSDNSTELANDPDSHIIAILLNRNYGSAIMAG


                         .         .         *         .         .         .         .:140
query           LAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYR
Y270_SYNE7      IAAATGDWILVLDADEELILEAWTELRSQL--DQPEALAFTVLREETQAG--QVPYSRLSRLFRNRPDIR
YOLJ_BACSU      IEYATSEWIYFIDADNLYSKENKGKIAKVA--RVLEFFSIDCVVSPYIEEYTGHLYSDTRRMFRLNGKVK
WAAE_KLEPN      QDYATGDWVLMIDTDERVTPELRQAILKVLAPQRGAIYSIARRNYLGRSGW---YPDRVLRLYE-RARYR
Y653_HAEIN      QQYVTSDYVLWLDADERVTPKLQQAILSAVKNDRENTVYPRVSEVFGREGW---YPDYVVRLYRNYAQYN
Y337_RICFE      ESLCVNDWILNIDADEELSKELQDEIEYIFASHNQDRYLAYQIKLL------------------------
Y209_RICTY      ESMCVNDWVLNIDADEELSQELQDEIEYIFASHNQDRYLAYQIKLL------------------------
KDTX_SERMA      QSYASHDYVLMIDADERVTPELRQSIERVLAPDDGAVYSCARRNFLGRSGW---YPDRVNRLYAN-SRYR
Y292_RICCN      ESLCVNDWVLNIDADEELSKELQDEIEYIFASHNQDRYLAYQIKLL------------------------
Y218_RICPR      ESMCVNDWVLNIDADEELSQELQDE-IEYINQDRYLAYQIKLIMYRGDQKPRMFAPLNKCTRLYNKKFAS
Y523_RICBR      ETICKNDWILNIDADEELSKELQDEIEYIFASQNQDRYLAYQIKLL------------------------
YIBD_ECOLI      IEVATGKYVAFVDADDEVYPTMYETLMTMALEDDLD----------------------------------
CRTQ_STAHJ      ASYTVSDILIFMDADVELNNEALEAIIQSYARQQYRG---------------------------------
Y1345_METJA     ----------------------------------------------------------------------
SEC_ARATH       ----------------------------------------------------------------------
EPSH_BACSU      IEAARGEFIAFIDSDDWIEPDYCEQMLRTAGDE-------------------------------------
Y075_MYCPN      KENANGDWITVLDSDDTLKPNTLNKLANLV----------------------------------------
Y263_METJA      ----------------------------------------------------------------------
Y940_METJA      ----------------------------------------------------------------------
Y060_MYCGE      LAK--GEWVTVLDSDDIFSKKTISIFQKYAQKQRYD----------------------------------
LPSC_RHIME      LEQCSQPWCFNIDADE------------------------------------------------------
GLTR1_MYCTU     VDLATGTWLLFLGADDSL----------------------------------------------------
GLTR1_MYCTA     VDLATGTWLLFLGADDSL----------------------------------------------------
GLTR1_MYCBP     VDLATGTWLLFLGADDSL----------------------------------------------------
GLTR1_MYCBO     VDLATGTWLLFLGADDSL----------------------------------------------------
Y706_RICBR      IKKSSGKYIAFLDSDDLFFHNKLELQLKFMEE--------------------------------------
Y543_RICFE      IKNAIGKYIAFLDSDDLFYKDKIEIQLKFMEE--------------------------------------
Y461_RICCN      IKNAIGKYIAFLDSDDLFYKDKIEIQLKFMEE--------------------------------------
ICAA_STAEP      IKQASYEYVMCLDAD-------------------------------------------------------
STIP1_DICDI     ----------------------------------------------------ETCKKALEKAQEIRADYR
ICAA_STAEQ      IKQASYEYVMCLDAD-------------------------------------------------------
CYC8_SCHPO      ----------------------------------------------------------------------
TTC17_HUMAN     ----------------------------------------------------------------------
OGT1_CAEEL      ----------------------------------------------------------------------
EPSE_BACSU      LSHATGDYIARQDGDD------------------------------------------------------
Y868_HAEIN      LEKAQGDYITFLDSDDFIANDKLEKQLNFM----------------------------------------
TMTC2_HUMAN     ----------------------------------------------------------------------
ICAA_STAAW      IKQASYDYVMCLDAD-------------------------------------------------------
ICAA_STAAS      IKQASYDYVMCLDAD-------------------------------------------------------
ARNC_ECOUT      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECOSM      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECOL6      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECOL5      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECOK1      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECO81      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECO45      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECO27      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
YRRB_BACSU      ----------------------------------------------------------------------
ICAA_STAAR      IKQASYDYVMCLDAD-------------------------------------------------------
ICAA_STAAN      IKQASYDYVMCLDAD-------------------------------------------------------
ICAA_STAAM      IKQASYDYVMCLDAD-------------------------------------------------------
ICAA_STAAC      IKQASYDYVMCLDAD-------------------------------------------------------
ICAA_STAA8      IKQASYDYVMCLDAD-------------------------------------------------------
ARNC_SERP5      FNQVSGDLVITLDADLQNPPEEIPRLVK-VAE---EGYVVGTVRANRQDSWFRKSASRIINMMIQRATGK
ARNC_ECO7I      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
YUKF_BACSU      ----------------------------------------------------------------------
Y2245_ARATH     ----------------------------------------------------------------------
Y1515_ARATH     ----------------------------------------------------------------------
TMTC1_DROME     ----------------------------------------------------------------------
SPY_HORVU       ----------------------------------------------------------------------
OGT1_RAT        ----------------------------------------------------------------------
OGT1_PIG        ----------------------------------------------------------------------
OGT1_MOUSE      ----------------------------------------------------------------------
OGT1_HUMAN      ----------------------------------------------------------------------
DPM1_DROME      IKHATGDFIVIIDAD-------------------------------------------------------
YFNE_BACSU      LRNARGDILIFHDSDMLAA---KDLVAKHIKAHENEENLV-------------VC-GLFWKRIYSFYYER
YCF3_MICAN      ----------------------------------------------------------------------
Y1428_METJA     ----------------------------------------------------------------------
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     ----------------------------------------------------------------------
PEX5_PICAN      ----------------------------------------------------------------------
IFT1L_HUMAN     ----------------------------------------------------------------------
EPSJ_BACSU      IKAARGTYIGFVDGDDYVSSAMFQRLTEEAEQNQLD----------------------------------
ARNC_ECO5E      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
ARNC_ECO57      FSHVTGDLIITLDADLQNPPEEIPRLVA----KADEGYVVGTVRQNRQDSWRKTASKMINRLIQ-RTTGK
SPY_ORYSJ       ----------------------------------------------------------------------
SOLR_CLOAB      ----------------------------------------------------------------------
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       VSFAKGYYIGQLDSDDYLEPDAVELCLK------------------------------------------
CHS_PASMU       VSFAKGYYIGQLDSDDYLEPDAVELCLK------------------------------------------
ARNC_PSEFS      FEQCRGDVVITLDADLQNPPEEIPRLVEQAA---------------------------------------
ARNC_PECCP      FQQAVGDVVITLDADLQNPPEEIPRLVEYAA---------------------------------------
ARNC_AERHH      FETAKGDLVITLDAD-------------------------------------------------------
AMSB_ERWAM      IDLATGDYVCFLDADDE-----------------------------------------------------
PEX5_PICPA      ----------------------------------------------------------------------
MDM20_YEAST     ----------------------------------------------------------------------
ARNC_YERPN      FNQVSGDLIITLDADLQNPPEETPRLV-HVAEE-------------------------------------
ARNC_YERPG      FNQVSGDLIITLDADLQNPPEETPRLV-HVAEE-------------------------------------
ARNC_YERPE      FNQVSGDLIITLDADLQNPPEETPRLV-HVAEE-------------------------------------
ARNC_YERPA      FNQVSGDLIITLDADLQNPPEETPRLV-HVAEE-------------------------------------


                         +         .         .         .         .         *         .:210
query           FRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHY
Y270_SYNE7      FQRPYHELVDDSLLAQQQEPNWRITPTPVIRHYGYGRDRLQQRGTAERMRQSLETWLADHPEDAYLCSKL
YOLJ_BACSU      FHGKVHEE----PMNYNHSLPFNFIVNLKVYHNGYNPSENNIKSKTRRNINLTEEMLRLEPENPKWLFFF
WAAE_KLEPN      YNNLVHESL-------------------------------------------------------------
Y653_HAEIN      -DSLVHEKVAGTKVEKLEHFTYKSIHHYLVKSAGYAKAWADQRQAKGKKATLWQ----------------
Y337_RICFE      ----------------------------------------------------------------------
Y209_RICTY      ----------------------------------------------------------------------
KDTX_SERMA      YNDDLVHELLNI----------------------------------------------------------
Y292_RICCN      ----------------------------------------------------------------------
Y218_RICPR      FANTINSTTHDVVFNKDVDFTGKIYL-LNGIAYHYSGTSIEQLVNKANFYSSEQAKDLVKQGKKLSNFRL
Y523_RICBR      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
Y1345_METJA     -------KIIDKILKKYPKSAIAWAEKGEILY---------REGKLKKSLECFDNALKINPKDCQSLLYK
SEC_ARATH       ----------------------------------------------------------------------
EPSH_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
Y263_METJA      ----------------------------------------------------------------------
Y940_METJA      ----------------------------------------------------------------------
Y060_MYCGE      ----------------------------------------------------------------------
LPSC_RHIME      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
Y461_RICCN      ----------------------------------------------------------------------
ICAA_STAEP      ----------------------------------------------------------------------
STIP1_DICDI     VKSKVYTRLGNIYLKKNQLDDAYKAYSSAVLEDKNADTTANMKKKKQRD-----DEAYLSVDQSIIEKNK
ICAA_STAEQ      ----------------------------------------------------------------------
CYC8_SCHPO      ----------------------------------------------------------------------
TTC17_HUMAN     ----------------------------------------------------------------------
OGT1_CAEEL      -------------------------------------------------------------GNYVEAEKY
EPSE_BACSU      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
TMTC2_HUMAN     --------------------------------------------------------------NEEMLYRS
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
ARNC_ECOUT      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECOSM      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECOL6      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECOL5      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECOK1      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECO81      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECO45      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECO27      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
ARNC_SERP5      SMGAYRRHIIEAMLNCHERSTF------------------------------------------------
ARNC_ECO7I      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
YUKF_BACSU      -------QYLDVLNEKRKQAG----------HYNYSLSKLEQYDRDHQSNMVIEADSNVNTASKLLNIHV
Y2245_ARATH     ------------------------------------------KYKESKDEFLLALEAAESGGNYLLPQIY
Y1515_ARATH     ------------------------------------------KCKESKDEFLLALEAAESGGNYLLPQIY
TMTC1_DROME     ----------------------------------------------------------------------
SPY_HORVU       ----------------------------------------------------------------------
OGT1_RAT        ----------------------------------------------------------------------
OGT1_PIG        ----------------------------------------------------------------------
OGT1_MOUSE      ----------------------------------------------------------------------
OGT1_HUMAN      ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
YFNE_BACSU      FEEEHKEQLAKLTGEMPKKDKQKLLEEADIKNGSFLDKSFD----LDTDFIDVLKKILDEYGDDLKGYH-
YCF3_MICAN      ----------------------------------------------------------------------
Y1428_METJA     -----------------------------LIHYKRGEIILAYKYLKKASEKIKNEELFEILGDISVKYG-
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     --------------------------------------------------------------NEEMLYRS
PEX5_PICAN      ----------------------------------------------------------------------
IFT1L_HUMAN     ------------------------------------------------SLHVLKRAVRLNPDDVYIRVLL
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
ARNC_ECO57      AMGAYRRHIVDAMLHCHERSTF------------------------------------------------
SPY_ORYSJ       ----------------------------------------------------------------------
SOLR_CLOAB      ----------------------------------------------------------------------
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
PEX5_PICPA      ----------------------------------------------------------------------
MDM20_YEAST     --------------------------------------------KYDEALHVYERGNFKFP-SYELSYHW
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHY
Y270_SYNE7      GGLLVQEGDLKAAQRWLKQGLKQGRPEPAVRYELLYHLALLERRQGDLDAAIDRYQAALQ----------
YOLJ_BACSU      GRELHLLDKDEEAIDYLKKSINN-----------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
Y337_RICFE      ----------------------------------------------------------------------
Y209_RICTY      ----------------------------------------------------------------------
KDTX_SERMA      ----------------------------------------------------------------------
Y292_RICCN      ----------------------------------------------------------------------
Y218_RICPR      ATEM------------------------------------------------------------------
Y523_RICBR      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
Y1345_METJA     GEILFKLGRYGEALKCLVFERNNKDRALMYIIQILIYL-------GRLNQALEYTKKALKLNPDDPLLYL
SEC_ARATH       ----------------------------------------AYMRKGRLSEATQCCQQALSLNPLLVDAHS
EPSH_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
Y263_METJA      ----------------------------------------------------------------------
Y940_METJA      ----------------------------------LTYLIKSYEDRGNLLESLYYLDKALELNPDFKFAKF
Y060_MYCGE      ----------------------------------------------------------------------
LPSC_RHIME      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
Y461_RICCN      ----------------------------------------------------------------------
ICAA_STAEP      ----------------------------------------------------------------------
STIP1_DICDI     GVEHFKKGEFPEAIKCFEEARRNPKDHTIYSNRSAAYSKLLEYK-----LAIKDADKCIELEPTFIKGYI
ICAA_STAEQ      ----------------------------------------------------------------------
CYC8_SCHPO      ----------------------------------------------------------------------
TTC17_HUMAN     ---------------------------------------------GQGKKAIDCLRQALHYAP-----HQ
OGT1_CAEEL      CNLVFQSDPNNLPTLLLLSAIN---FQTKNLEKSMQYSMLAIKVNNQCAEA-------------YSNLNY
EPSE_BACSU      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
TMTC2_HUMAN     GIKVNPAKAWGNLGNVLISEAESAYRNALYYRSMLYNLGLLLQENSRFAEALHYYKLAIGSRPTLASAYL
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
YUKF_BACSU      NTLNYRLKRISQIAEIDLKNVN--QKFTIYLDIKLRHMDL------------------------------
Y2245_ARATH     GISL-------EGEGMVLSACEYYREAAILCPRALKLLGSALFGVGEYRAAVKALEEAIYLKPDYADAHC
Y1515_ARATH     GIAL-------EGEGMVLSACEYYREAAILCPTHFRALKLALFGVGEYRAAVKALEEAIYLKPDYADAHC
TMTC1_DROME     ----------------------------------------------------------------------
SPY_HORVU       ----------------------------------------------------------------------
OGT1_RAT        -----------------------------HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADLNN
OGT1_PIG        -----------------------------HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADLNN
OGT1_MOUSE      -----------------------------HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADLNN
OGT1_HUMAN      -----------------------------HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADLNN
DPM1_DROME      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
YCF3_MICAN      -----------------------------------------------------------------AFVYY
Y1428_METJA     --------RYEEALKYYLKSYKMANSKNLNALFKAGKIYLLF---GDIDKAYDAFNEILQQNPSYEDLN-
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     GIKVNPAKAWGNLGNVLKSQSKISEAESAYMADMLYNLGLLLQENSRFAEALHYYKLAIGSRPTLASAYL
PEX5_PICAN      GVLFYSMEEYSKTLDCFQAAIEHNPNDALAWNRLGASLA----NSNKPEQAIEAYSRTLQLNPNFVRARY
IFT1L_HUMAN     ALKLQDEGQEAEGEKYIEEALTSISSQAYVF----QYAAKFYRRKGSVDKALELLKMALETTPTSAFLHH
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
SPY_ORYSJ       ----------------------------------------------------------------------
SOLR_CLOAB      ----------------------------------------------------------------------
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
PEX5_PICPA      ----------------------------------------------KPEEAVEAYSRALQLNPNFVRARY
MDM20_YEAST     FMKALEDSNYNQMSKASLQLAKYSDSGNL--PKRAYYFWNAI-----SILAVSRFQENTLSDPKKILLSR
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD
Y270_SYNE7      ----------------------------------------------------------------------
YOLJ_BACSU      ----------------------------------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
Y337_RICFE      ----------------------------------------------------------------------
Y209_RICTY      ----------------------------------------------------------------------
KDTX_SERMA      ----------------------------------------------------------------------
Y292_RICCN      ----------------------------------------------------------------------
Y218_RICPR      ----------------------------------------------------------------------
Y523_RICBR      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
Y1345_METJA     YKGIILNKLGKYNEAIKYFDKVLEINPNIPDAWNGKAI----ALEKLGKINEAIECYNRALDIY------
SEC_ARATH       NLGNLMKAQGLIHEAYSCYLEAVRI--QPTFAIAWSNLAGL--FMESGDL-------NRALQYYKEAVKL
EPSH_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
Y263_METJA      -------------------------------------------------------NFDKALEYLEKAQKD
Y940_METJA      LKAISLAILGDINKSIECLEDITSNSNDPVAYAL------------LGQLYELLGNFDNALECYEKSLGI
Y060_MYCGE      ----------------------------------------------------------------------
LPSC_RHIME      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
Y461_RICCN      ----------------------------------------------------------------------
ICAA_STAEP      ----------------------------------------------------------------------
STIP1_DICDI     RKGTALFAMREYQQALEVYDQGLRIEANNPE---------------------------------------
ICAA_STAEQ      ----------------------------------------------------------------------
CYC8_SCHPO      ---------------------ANVLPPNAPESVRHLISLNEETWIQIGRLAELFDDQDKALSAYESALRQ
TTC17_HUMAN     MKDVPLISLANILHNAKLWNDAVIVATMAVEIAPHFAVNHFT----LGNVYVAMEEFEKALVWYESTLKL
OGT1_CAEEL      YKEKGQLQLENYKLAVKL------KPEFIDAYINLAA-----ALVSGGDL-------EQAVTAYFNALQI
EPSE_BACSU      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
TMTC2_HUMAN     NTGIILMNQGRTEEARRTFLKCSEIPDEKDPHAHKSSVTS--CLYNLGKLYHEQGHYEEALSVYKEAIQK
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
YRRB_BACSU      ------MQEGDYEKAAEAFTKAIEEKEDAIPYINFANL--------LSSVNEL----ERALAFYDKALEL
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
YUKF_BACSU      ----------------------------------------------------------------------
Y2245_ARATH     DLASSLHAMGEDERAIEVFQRAIDL---KPGHVD--------ALYNLGGLYMDLGRFQRASEMYTRVLAV
Y1515_ARATH     DLASSLHSMGEDERAIEVFQRAIDL---KPGHVD--------ALYNLGGLYMDLGRFQRASEMYTRVLTV
TMTC1_DROME     ----------------------------------------------------------------------
SPY_HORVU       ------------------------------------------AMYNLGVAYGEMLNFEMAIVFYELALHF
OGT1_RAT        LANIKREQVRLYRKALEVF------PEFAAAHSNLASV-----LQQQGKL-------QEALMHYKEAIRI
OGT1_PIG        LANIKREQVRLYRKALEVF------PEFAAAHSNLASV-----LQQQGKL-------QEALMHYKEAIRI
OGT1_MOUSE      LANIKREQVRLYRKALEVF------PEFAAAHSNLASV-----LQQQGKL-------QEALMHYKEAIRI
OGT1_HUMAN      LANIKREQVRLYRKALEVF------PEFAAAHSNLASV-----LQQQGKL-------QEALMHYKEAIRI
DPM1_DROME      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
YCF3_MICAN      RDGMSAQADGEYAEALDNYYEALTLEEDPNDRSYI--------LYNIGIIHASNGEHEKALEYYEEAIQL
Y1428_METJA     -NGLTMIKNKDYIGALKIFNKVLQIDENSDI-----------SYYYKSVIAEIFEEYKKALEYIDKSISI
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     NTGIILMNQGKTEEARRTFLKCSEIPDEKDPHAHKSSVTS--CLYNLGKLYHEQGRYEEALSVYREAIQK
PEX5_PICAN      NLGVSFINMGMYRDAVDHLLTGLSMHEVESLDGSSSVARSNQSTSLIETLKRAFL---------------
IFT1L_HUMAN     QMGLQMIQIK------------------------------------------------------------
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
SPY_ORYSJ       ------------------------------------------AMYNLGVAYGEMLNFEMAIVFYELALHF
SOLR_CLOAB      ----------------------------------------------------------------------
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
PEX5_PICPA      NLGVSFINMGRYKEAVEHLLTGISLHE-------------------------------------------
MDM20_YEAST     LARQSLLDLKPFQNVQEIIVYCLVLDELFPQSREISE----------EIVAITFANFDTSVNLYLKNF--
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSS
Y270_SYNE7      ----------------------------------------------------------------------
YOLJ_BACSU      ----------------------------------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
Y337_RICFE      ----------------------------------------------------------------------
Y209_RICTY      ----------------------------------------------------------------------
KDTX_SERMA      ----------------------------------------------------------------------
Y292_RICCN      ----------------------------------------------------------------------
Y218_RICPR      ----------------------------------------------------------------------
Y523_RICBR      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
Y1345_METJA     ----------------------------------------------------------------------
SEC_ARATH       KPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRF
EPSH_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
Y263_METJA      NPLVLYVKGIVLKLKGDMEKAEKYFECLENIEGTS----LLSLGNLIFVKGEYERTLKYIEKLSRLSKPC
Y940_METJA      EEKFATAF--FLKVLCLGLSGKYDEKCCDRLISFAPNPAYIIKANMLRKLGRYEEALACVNKVLELKEND
Y060_MYCGE      ----------------------------------------------------------------------
LPSC_RHIME      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
Y461_RICCN      ----------------------------------------------------------------------
ICAA_STAEP      ----------------------------------------------------------------------
STIP1_DICDI     ----------------------------------------------------------------------
ICAA_STAEQ      ----------------------------------------------------------------------
CYC8_SCHPO      NPYSIPAMLQIATILRNREQFPLAIEYYQTILDCDPKQGEI-----------------------------
TTC17_HUMAN     QPEFVPAKNRI-----------------------------------------------------------
OGT1_CAEEL      NPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIE-TQPQFAVAWSNVFNSQGEIWLAIHHFEKAVTLDPNF
EPSE_BACSU      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
TMTC2_HUMAN     MP--------------------------------------------------------------------
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
YRRB_BACSU      DSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLMLGTVLVKLEQPKLALPYLQRAVELNEND
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
YUKF_BACSU      ----------------------------------------------------------------------
Y2245_ARATH     WPNWRAQLNKAVSLLGAGETEEAKRALKE-----------------------------------------
Y1515_ARATH     WPNWRAQLNKAVSLLGAGETEEAKRALKE-----------------------------------------
TMTC1_DROME     ----------------------------------------------------------------------
SPY_HORVU       NPRCAEACNNLGVIYKDRDNLDKAVECYQMALSI-KPNFSQSLNNVYTVQGKMDAAASMIEKAILANPTY
OGT1_RAT        SPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQIN-----------------------------------
OGT1_PIG        SPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQIN-----------------------------------
OGT1_MOUSE      SPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQIN-----------------------------------
OGT1_HUMAN      SPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQIN-----------------------------------
DPM1_DROME      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
YCF3_MICAN      NPRMPSALNNIAVIYKAREDGQQAEEALDKAAEYWKQAIRLAPNNYIEAQNWLKIT--------------
Y1428_METJA     ---FNRSLYYAKKILYKLGDEEGAIEAYNKAIKLNSPYAYFGLAILYYRKGELEKSSNFFDKVL------
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     MP--------------------------------------------------------------------
PEX5_PICAN      ----------------------------------------------------------------------
IFT1L_HUMAN     ----------------------------------------------------------------------
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
SPY_ORYSJ       NPRCAEACNNLGVIYKDRDNLDKAVECYQMALSI-KPNFSQSLNNVYTVQGKMDAASSMIQKAIFANSTY
SOLR_CLOAB      ----------------------------------------------------------------------
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
PEX5_PICPA      ----------------------------------------------------------------------
MDM20_YEAST     ----------ILKHTKLLNSPQKLFEVCSKLIEKGLDDYELITNLI---DAAYKLS--------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDT
Y270_SYNE7      ----------------------------------------------------------------------
YOLJ_BACSU      ----------------------------------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
Y337_RICFE      ----------------------------------------------------------------------
Y209_RICTY      ----------------------------------------------------------------------
KDTX_SERMA      ----------------------------------------------------------------------
Y292_RICCN      ----------------------------------------------------------------------
Y218_RICPR      ----------------------------------------------------------------------
Y523_RICBR      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
Y1345_METJA     ----------------------------------------------------------------------
SEC_ARATH       LEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMAN-------------LGNIYMEWNMMGPA---
EPSH_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
Y263_METJA      YLSPFHKALIYIEFGEFEKALEALDEFLK---IYP-----------------------------------
Y940_METJA      TNAIYLKALILNRIGNCDEALK------------------------------------------------
Y060_MYCGE      ----------------------------------------------------------------------
LPSC_RHIME      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
Y461_RICCN      ----------------------------------------------------------------------
ICAA_STAEP      ----------------------------------------------------------------------
STIP1_DICDI     ----------------------------------------------------------------------
ICAA_STAEQ      ----------------------------------------------------------------------
CYC8_SCHPO      ----------------------------------------------------------------------
TTC17_HUMAN     ----------------------------------------------------------------------
OGT1_CAEEL      LDAYINLGNVLKEARIFDRALRALNDLAIDTYKFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHDS
EPSE_BACSU      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
TMTC2_HUMAN     ----------------------------------------------------------------------
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
YRRB_BACSU      TEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQP----
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
YUKF_BACSU      ----------------------------------------------------------------------
Y2245_ARATH     ----------------------------------------------------------------------
Y1515_ARATH     ----------------------------------------------------------------------
TMTC1_DROME     ----------------------------------------------------------------------
SPY_HORVU       AE--------------------------------------------------------------------
OGT1_RAT        ----------------------------------------------------------------------
OGT1_PIG        ----------------------------------------------------------------------
OGT1_MOUSE      ----------------------------------------------------------------------
OGT1_HUMAN      ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
YCF3_MICAN      ----------------------------------------------------------------------
Y1428_METJA     ----------------------------------------------------------------------
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     ----------------------------------------------------------------------
PEX5_PICAN      ----------------------------------------------------------------------
IFT1L_HUMAN     ----------------------------------------------------------------------
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
SPY_ORYSJ       AE--------------------------------------------------------------------
SOLR_CLOAB      ----------------------------------------------------------------------
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
PEX5_PICPA      ----------------------------------------------------------------------
MDM20_YEAST     ----------------------------------------------------------------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYH
Y270_SYNE7      ----------------------------------------------------------------------
YOLJ_BACSU      ----------------------------------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
Y337_RICFE      ----------------------------------------------------------------------
Y209_RICTY      ----------------------------------------------------------------------
KDTX_SERMA      ----------------------------------------------------------------------
Y292_RICCN      ----------------------------------------------------------------------
Y218_RICPR      ----------------------------------------------------------------------
Y523_RICBR      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
Y1345_METJA     ----------------------------------------------------------------------
SEC_ARATH       SSLFKATL----------AVTTGLSAPFNNLAIIYKQQYSDAISCYNEVL-RIDP-LAADALVNRGNTYK
EPSH_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
Y263_METJA      ----------------------------------------------------------------------
Y940_METJA      ----------------------------------------------------------------------
Y060_MYCGE      ----------------------------------------------------------------------
LPSC_RHIME      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
Y461_RICCN      ----------------------------------------------------------------------
ICAA_STAEP      ----------------------------------------------------------------------
STIP1_DICDI     ----------------------------------------------------------------------
ICAA_STAEQ      ----------------------------------------------------------------------
CYC8_SCHPO      ----------------------------------------------------------------------
TTC17_HUMAN     ----------------------------------------------------------------------
OGT1_CAEEL      QNNLANIKREQGKIEDATRLYLAHSNLASILQQQGKLLHYKEAIRIAPTFADAYSN-MGNTLKEMGDSSA
EPSE_BACSU      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
TMTC2_HUMAN     ----------------------------------------------------------------------
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
YUKF_BACSU      ----------------------------------------------------------------------
Y2245_ARATH     ----------------------------------------------------------------------
Y1515_ARATH     ----------------------------------------------------------------------
TMTC1_DROME     --------------------------------------------------------------LQLSVLYR
SPY_HORVU       ----------------------------------------------------------------------
OGT1_RAT        ----------------------------------------------------------------------
OGT1_PIG        ----------------------------------------------------------------------
OGT1_MOUSE      ----------------------------------------------------------------------
OGT1_HUMAN      ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
YCF3_MICAN      ----------------------------------------------------------------------
Y1428_METJA     ----------------------------------------------------------------------
TOM71_YEAST     ----------------------------------------------------------------------
TMTC2_MOUSE     ----------------------------------------------------------------------
PEX5_PICAN      ----------------------------------------------------------------------
IFT1L_HUMAN     ----------------------------------------------------------------------
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
SPY_ORYSJ       ----------------------------------------------------------------------
SOLR_CLOAB      --------------------------------------------------------------------YY
SGT_DICDI       ----------------------------------------------------------------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
PEX5_PICPA      ----------------------------------------------------------------------
MDM20_YEAST     ----------------------------------------------------------------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYExxx
Y270_SYNE7      ----------------------------------------------------------------------
YOLJ_BACSU      ----------------------------------------------------------------------
WAAE_KLEPN      ----------------------------------------------------------------------
Y653_HAEIN      ----------------------------------------------------------------------
Y337_RICFE      ----------------------------------------------------------------------
Y209_RICTY      ----------------------------------------------------------------------
KDTX_SERMA      ----------------------------------------------------------------------
Y292_RICCN      ----------------------------------------------------------------------
Y218_RICPR      ----------------------------------------------------------------------
Y523_RICBR      ----------------------------------------------------------------------
YIBD_ECOLI      ----------------------------------------------------------------------
CRTQ_STAHJ      ----------------------------------------------------------------------
Y1345_METJA     ----------------------------------------------------------------------
SEC_ARATH       EIG---RVTEAIQDYMHAPTMAEAHANLASAYKDSGHVEAAITSYKQALLLRPDFP--------------
EPSH_BACSU      ----------------------------------------------------------------------
Y075_MYCPN      ----------------------------------------------------------------------
Y263_METJA      ----------------------------------------------------------------------
Y940_METJA      ----------------------------------------------------------------------
Y060_MYCGE      ----------------------------------------------------------------------
LPSC_RHIME      ----------------------------------------------------------------------
GLTR1_MYCTU     ----------------------------------------------------------------------
GLTR1_MYCTA     ----------------------------------------------------------------------
GLTR1_MYCBP     ----------------------------------------------------------------------
GLTR1_MYCBO     ----------------------------------------------------------------------
Y706_RICBR      ----------------------------------------------------------------------
Y543_RICFE      ----------------------------------------------------------------------
Y461_RICCN      ----------------------------------------------------------------------
ICAA_STAEP      ----------------------------------------------------------------------
STIP1_DICDI     ----------------------------------------------------------------------
ICAA_STAEQ      ----------------------------------------------------------------------
CYC8_SCHPO      ----------------------------------------------------------------------
TTC17_HUMAN     ----------------------------------------------------------------------
OGT1_CAEEL      AIACYNRAIQINPAFADAHSN------LASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCHQ---
EPSE_BACSU      ----------------------------------------------------------------------
Y868_HAEIN      ----------------------------------------------------------------------
TMTC2_HUMAN     ----------------------------------------------------------------------
ICAA_STAAW      ----------------------------------------------------------------------
ICAA_STAAS      ----------------------------------------------------------------------
ARNC_ECOUT      ----------------------------------------------------------------------
ARNC_ECOSM      ----------------------------------------------------------------------
ARNC_ECOL6      ----------------------------------------------------------------------
ARNC_ECOL5      ----------------------------------------------------------------------
ARNC_ECOK1      ----------------------------------------------------------------------
ARNC_ECO81      ----------------------------------------------------------------------
ARNC_ECO45      ----------------------------------------------------------------------
ARNC_ECO27      ----------------------------------------------------------------------
YRRB_BACSU      ----------------------------------------------------------------------
ICAA_STAAR      ----------------------------------------------------------------------
ICAA_STAAN      ----------------------------------------------------------------------
ICAA_STAAM      ----------------------------------------------------------------------
ICAA_STAAC      ----------------------------------------------------------------------
ICAA_STAA8      ----------------------------------------------------------------------
ARNC_SERP5      ----------------------------------------------------------------------
ARNC_ECO7I      ----------------------------------------------------------------------
YUKF_BACSU      ----------------------------------------------------------------------
Y2245_ARATH     ----------------------------------------------------------------------
Y1515_ARATH     ----------------------------------------------------------------------
TMTC1_DROME     SDGRLQDAAAALRESLKAKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVT---------
SPY_HORVU       ----------------------------------------------------------------------
OGT1_RAT        ----------------------------------------------------------------------
OGT1_PIG        ----------------------------------------------------------------------
OGT1_MOUSE      ----------------------------------------------------------------------
OGT1_HUMAN      ----------------------------------------------------------------------
DPM1_DROME      ----------------------------------------------------------------------
YFNE_BACSU      ----------------------------------------------------------------------
YCF3_MICAN      ----------------------------------------------------------------------
Y1428_METJA     ----------------------------------------------------------------------
TOM71_YEAST     ------------QAYAVQLKNRGNHFFTAK------NFNEAIKYYQYAIELDPNEPVFYSNISACY----
TMTC2_MOUSE     ----------------------------------------------------------------------
PEX5_PICAN      ----------------------------------------------------------------------
IFT1L_HUMAN     ----------------------------------------------------------------------
EPSJ_BACSU      ----------------------------------------------------------------------
ARNC_ECO5E      ----------------------------------------------------------------------
ARNC_ECO57      ----------------------------------------------------------------------
SPY_ORYSJ       ----------------------------------------------------------------------
SOLR_CLOAB      LTGKYDKAIENFEKAISMGSTNSVYRSLGITYAKIGDYKKSEEYLKKALDAEPEKPSTHIYFSYL-----
SGT_DICDI       ----FEKSIEDCLEAIKRNPNGKAYTRMGSAYTSLGKFSEAMEAYNKAIELEPNNETF------------
HAS_PASMU       ----------------------------------------------------------------------
CHS_PASMU       ----------------------------------------------------------------------
ARNC_PSEFS      ----------------------------------------------------------------------
ARNC_PECCP      ----------------------------------------------------------------------
ARNC_AERHH      ----------------------------------------------------------------------
AMSB_ERWAM      ----------------------------------------------------------------------
PEX5_PICPA      ----------------------------------------------------------------------
MDM20_YEAST     ----------------------------------------------------------------------
ARNC_YERPN      ----------------------------------------------------------------------
ARNC_YERPG      ----------------------------------------------------------------------
ARNC_YERPE      ----------------------------------------------------------------------
ARNC_YERPA      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxx
Y270_SYNE7      ----------
YOLJ_BACSU      ----------
WAAE_KLEPN      ----------
Y653_HAEIN      ----------
Y337_RICFE      ----------
Y209_RICTY      ----------
KDTX_SERMA      ----------
Y292_RICCN      ----------
Y218_RICPR      ----------
Y523_RICBR      ----------
YIBD_ECOLI      ----------
CRTQ_STAHJ      ----------
Y1345_METJA     ----------
SEC_ARATH       ----------
EPSH_BACSU      ----------
Y075_MYCPN      ----------
Y263_METJA      ----------
Y940_METJA      ----------
Y060_MYCGE      ----------
LPSC_RHIME      ----------
GLTR1_MYCTU     ----------
GLTR1_MYCTA     ----------
GLTR1_MYCBP     ----------
GLTR1_MYCBO     ----------
Y706_RICBR      ----------
Y543_RICFE      ----------
Y461_RICCN      ----------
ICAA_STAEP      ----------
STIP1_DICDI     ----------
ICAA_STAEQ      ----------
CYC8_SCHPO      ----------
TTC17_HUMAN     ----------
OGT1_CAEEL      ----------
EPSE_BACSU      ----------
Y868_HAEIN      ----------
TMTC2_HUMAN     ----------
ICAA_STAAW      ----------
ICAA_STAAS      ----------
ARNC_ECOUT      ----------
ARNC_ECOSM      ----------
ARNC_ECOL6      ----------
ARNC_ECOL5      ----------
ARNC_ECOK1      ----------
ARNC_ECO81      ----------
ARNC_ECO45      ----------
ARNC_ECO27      ----------
YRRB_BACSU      ----------
ICAA_STAAR      ----------
ICAA_STAAN      ----------
ICAA_STAAM      ----------
ICAA_STAAC      ----------
ICAA_STAA8      ----------
ARNC_SERP5      ----------
ARNC_ECO7I      ----------
YUKF_BACSU      ----------
Y2245_ARATH     ----------
Y1515_ARATH     ----------
TMTC1_DROME     ----------
SPY_HORVU       ----------
OGT1_RAT        ----------
OGT1_PIG        ----------
OGT1_MOUSE      ----------
OGT1_HUMAN      ----------
DPM1_DROME      ----------
YFNE_BACSU      ----------
YCF3_MICAN      ----------
Y1428_METJA     ----------
TOM71_YEAST     ----------
TMTC2_MOUSE     ----------
PEX5_PICAN      ----------
IFT1L_HUMAN     ----------
EPSJ_BACSU      ----------
ARNC_ECO5E      ----------
ARNC_ECO57      ----------
SPY_ORYSJ       ----------
SOLR_CLOAB      ----------
SGT_DICDI       ----------
HAS_PASMU       ----------
CHS_PASMU       ----------
ARNC_PSEFS      ----------
ARNC_PECCP      ----------
ARNC_AERHH      ----------
AMSB_ERWAM      ----------
PEX5_PICPA      ----------
MDM20_YEAST     ----------
ARNC_YERPN      ----------
ARNC_YERPG      ----------
ARNC_YERPE      ----------
ARNC_YERPA      ----------