[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO49955.1

[Show Plain Result]


## Summary of Sequence Search
    1::426
  498::603     7e-04  35%  666 aa  ABCG1_MOUSE RecName: Full=ATP-binding cassette sub-family G member
  510::615     7e-04  35%  678 aa  ABCG1_HUMAN RecName: Full=ATP-binding cassette sub-family G member
  137::242     0.001  32%  245 aa  YDHB_BACSU RecName: Full=UPF0721 transmembrane protein ydhB;
    1::426

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ABCG1_MOUSE     ----------------------------------------------------------------------
ABCG1_HUMAN     ----------------------------------------------------------------------
YDHB_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ABCG1_MOUSE     ----------------------------------------------------------------------
ABCG1_HUMAN     ----------------------------------------------------------------------
YDHB_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ABCG1_MOUSE     ----------------------------------------------------------------------
ABCG1_HUMAN     ----------------------------------------------------------------------
YDHB_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIMGVGGGFLTFPMFVYGLGVSS
ABCG1_MOUSE     ----------------------------------------------------------------------
ABCG1_HUMAN     ----------------------------------------------------------------------
YDHB_BACSU      ------------------------------------------------ILGIAAGVLSG---TFGIGSAP


                         .         *         .         .         .         .         +:350
query           FTTVGTDILQIIFTAGYSSIAQYAVYGYIFYTLAMGMLVGSLLGIQIGAATTKVVSGIYIRAFYAIAIMA
ABCG1_MOUSE     ---------QIMFPVAYCSIVYWAVRFVLFAALGMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLS
ABCG1_HUMAN     ---------QIMFPVAYCSIVYWAVRFVLFAALGMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLS
YDHB_BACSU      FISVGTTMLVIIPLAVGGGIG-YITEGFVDYVLLVKVLVGTMCGAYVGAKFTNLMPKVVLKAIFLTPAIA


                         .         .         .         .         *         .         .:420
query           GFVNRAFALPEKMAQMGYISIAKENGVLFSNIGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ABCG1_MOUSE     GFFVSFDTIPAYLQWMSYISYVRYEGVILSIYG-------------------------------------
ABCG1_HUMAN     GFFVSFDTIPTYLQWMSYISYVRYEGVILSIYG-------------------------------------
YDHB_BACSU      GLL-------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxx
ABCG1_MOUSE     ------
ABCG1_HUMAN     ------
YDHB_BACSU      ------