[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50036.1

[Show Plain Result]


## Summary of Sequence Search
    1::240
    3::233     7e-44  38%  241 aa  YOBQ_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  148::283     2e-16  39%  303 aa  YDIP_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  187::284     1e-14  35%  287 aa  YISR_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  171::263     3e-12  33%  529 aa  YBBB_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   20::244     3e-12  25%  248 aa  LUMQ_PHOLE RecName: Full=Probable transcriptional regulator lumQ;
  164::292     3e-11  25%  303 aa  POCR_SALTY RecName: Full=Regulatory protein pocR;
  204::295     4e-11  36%  298 aa  Y1052_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
  680::767     1e-10  30%  772 aa  YTDP_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   40::273     4e-10  28%  280 aa  CHBR_ECOLI RecName: Full=HTH-type transcriptional regulator
  216::307     5e-10  30%  318 aa  YQHC_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  662::758     5e-10  31%  761 aa  YESS_BACSU RecName: Full=HTH-type transcriptional regulator yesS;
  168::273     5e-10  28%  279 aa  LACR_STAXY RecName: Full=Lactose operon transcription activator;
  194::288     1e-09  26%  291 aa  YDEC_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  106::199     1e-09  31%  211 aa  ADAA_BACSU RecName: Full=Methylphosphotriester-DNA
  190::283     2e-09  29%  310 aa  ARAC_ERWCH RecName: Full=Arabinose operon regulatory protein;
  177::274     3e-09  31%  277 aa  RAFR_PEDPE RecName: Full=Raffinose operon transcriptional
  195::277     4e-09  31%  284 aa  YKGD_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  177::271     5e-09  28%  283 aa  YIJO_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  177::271     5e-09  29%  278 aa  RHAS_ESCF3 RecName: Full=HTH-type transcriptional activator
  182::276     7e-09  27%  278 aa  MSMR_STRMU RecName: Full=Msm operon regulatory protein;
  179::271     9e-09  29%  278 aa  RHAS_ENT38 RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALTY RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALTI RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALPK RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALPC RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALPB RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALPA RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALNS RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALHS RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALG2 RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALEP RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALDC RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALCH RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALAR RecName: Full=HTH-type transcriptional activator
  179::271     2e-08  28%  278 aa  RHAS_SALA4 RecName: Full=HTH-type transcriptional activator
  179::271     3e-08  28%  278 aa  RHAS_SALSV RecName: Full=HTH-type transcriptional activator
  177::271     3e-08  27%  278 aa  RHAS_KLEP7 RecName: Full=HTH-type transcriptional activator
  177::271     3e-08  25%  278 aa  RHAS_ECOUT RecName: Full=HTH-type transcriptional activator
  177::271     3e-08  25%  278 aa  RHAS_ECOLU RecName: Full=HTH-type transcriptional activator
  177::271     3e-08  25%  278 aa  RHAS_ECOK1 RecName: Full=HTH-type transcriptional activator
  177::271     3e-08  25%  278 aa  RHAS_ECO7I RecName: Full=HTH-type transcriptional activator
  177::271     3e-08  25%  278 aa  RHAS_ECO45 RecName: Full=HTH-type transcriptional activator
  177::271     3e-08  27%  278 aa  RHAS_CITK8 RecName: Full=HTH-type transcriptional activator
  177::271     5e-08  27%  278 aa  RHAS_KLEP3 RecName: Full=HTH-type transcriptional activator
  169::295     5e-08  29%  302 aa  MELR_ECOLI RecName: Full=Melibiose operon regulatory protein;
  169::295     5e-08  29%  302 aa  MELR_ECOL6 RecName: Full=Melibiose operon regulatory protein;
  189::284     8e-08  23%  285 aa  YPDC_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  177::271     8e-08  24%  278 aa  RHAS_ECOSE RecName: Full=HTH-type transcriptional activator
  184::277     8e-08  27%  292 aa  ARAC_ECOLI RecName: Full=Arabinose operon regulatory protein;
  184::277     8e-08  27%  292 aa  ARAC_ECO57 RecName: Full=Arabinose operon regulatory protein;
  184::277     8e-08  27%  281 aa  ARAC_CITFR RecName: Full=Arabinose operon regulatory protein;
  177::271     1e-07  24%  278 aa  RHAS_SHISS RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_SHIFL RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_SHIF8 RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_SHIDS RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_SHIBS RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECOSM RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECOLI RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECOLC RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECOL6 RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECOL5 RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECOHS RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECODH RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECOBW RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECO8A RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECO81 RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECO5E RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECO57 RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECO55 RecName: Full=HTH-type transcriptional activator
  177::271     1e-07  24%  278 aa  RHAS_ECO27 RecName: Full=HTH-type transcriptional activator
   14::280     1e-07  24%  290 aa  RHAR_YERPY RecName: Full=HTH-type transcriptional activator
  184::277     1e-07  27%  281 aa  ARAC_SALTY RecName: Full=Arabinose operon regulatory protein;
  177::271     2e-07  23%  278 aa  RHAS_ECO24 RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERPS RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERPP RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERPN RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERPG RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERPE RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERPB RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERPA RecName: Full=HTH-type transcriptional activator
   14::280     2e-07  24%  290 aa  RHAR_YERP3 RecName: Full=HTH-type transcriptional activator
  163::254     2e-07  28%  745 aa  Y107_STAAR RecName: Full=Uncharacterized HTH-type transcriptional
  163::254     2e-07  28%  745 aa  Y101_STAAM RecName: Full=Uncharacterized HTH-type transcriptional
  163::254     2e-07  28%  745 aa  Y097_STAAN RecName: Full=Uncharacterized HTH-type transcriptional
  163::254     2e-07  28%  745 aa  Y078_STAAS RecName: Full=Uncharacterized HTH-type transcriptional
  163::254     2e-07  28%  745 aa  Y077_STAAW RecName: Full=Uncharacterized HTH-type transcriptional
   11::104     2e-07  27%  107 aa  SOXS_SALTY RecName: Full=Regulatory protein soxS;
  163::254     3e-07  28%  745 aa  Y084_STAAC RecName: Full=Uncharacterized HTH-type transcriptional
  176::268     3e-07  28%  278 aa  EXSA_PSEAE RecName: Full=Exoenzyme S synthesis regulatory protein
  163::254     4e-07  28%  745 aa  YHTH1_STAAU RecName: Full=Uncharacterized HTH-type transcriptional
  177::271     4e-07  23%  278 aa  RHAS_SHIB3 RecName: Full=HTH-type transcriptional activator
   15::275     5e-07  23%  282 aa  RHAR_SALDC RecName: Full=HTH-type transcriptional activator
   11::104     7e-07  27%  107 aa  SOXS_ECOLI RecName: Full=Regulatory protein soxS;
   11::104     7e-07  27%  107 aa  SOXS_ECOL6 RecName: Full=Regulatory protein soxS;
   11::104     7e-07  27%  107 aa  SOXS_ECO57 RecName: Full=Regulatory protein soxS;
   15::275     7e-07  23%  282 aa  RHAR_SALSV RecName: Full=HTH-type transcriptional activator
  230::298     7e-07  33%  307 aa  MMSR_PSEAE RecName: Full=MmsAB operon regulatory protein;
   10::109     1e-06  24%  295 aa  YBFP_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
   42::136     1e-06  29%  157 aa  XYLS2_PSEPU RecName: Full=XylDLEGF operon transcriptional activator
  153::263     1e-06  28%  271 aa  VIRF_YERE8 RecName: Full=Virulence regulon transcriptional
  174::267     1e-06  24%  268 aa  RHAS_MANSM RecName: Full=HTH-type transcriptional activator
  153::263     1e-06  28%  271 aa  LCRF_YERPE RecName: Full=Thermoregulatory protein lcrF;
   15::275     2e-06  23%  282 aa  RHAR_SALTY RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALPK RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALPB RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALPA RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALNS RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALEP RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALTI RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALHS RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALCH RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALAR RecName: Full=HTH-type transcriptional activator
   15::275     2e-06  23%  282 aa  RHAR_SALA4 RecName: Full=HTH-type transcriptional activator
   20::273     2e-06  27%  276 aa  RHAR_MANSM RecName: Full=HTH-type transcriptional activator
   29::275     2e-06  26%  282 aa  RHAR_ENT38 RecName: Full=HTH-type transcriptional activator
  212::296     2e-06  32%  296 aa  PCHR_PSEAE RecName: Full=Regulatory protein pchR;
  236::299     2e-06  36%  304 aa  ARACL_STRLI RecName: Full=Putative araC-like transcription
   36::128     3e-06  27%  138 aa  TETD_ECOLX RecName: Full=Transposon Tn10 tetD protein;AltName:
  197::291     4e-06  25%  314 aa  YFIF_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  155::248     4e-06  24%  251 aa  Y2406_STAEQ RecName: Full=Uncharacterized response regulatory
  177::270     4e-06  27%  273 aa  RHAS_YERPY RecName: Full=HTH-type transcriptional activator
  177::270     4e-06  27%  273 aa  RHAS_YERPS RecName: Full=HTH-type transcriptional activator
  177::270     4e-06  27%  273 aa  RHAS_YERPP RecName: Full=HTH-type transcriptional activator
  177::270     4e-06  27%  273 aa  RHAS_YERPG RecName: Full=HTH-type transcriptional activator
  177::270     4e-06  27%  273 aa  RHAS_YERPB RecName: Full=HTH-type transcriptional activator
  177::270     4e-06  27%  273 aa  RHAS_YERP3 RecName: Full=HTH-type transcriptional activator
  287::360     6e-06  31%  368 aa  YESN_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  102::311     6e-06  28%  321 aa  XYLS1_PSEPU RecName: Full=XylDLEGF operon transcriptional activator
  155::248     7e-06  24%  251 aa  Y165_STAES RecName: Full=Uncharacterized response regulatory
  177::263     7e-06  31%  271 aa  VIRF_YEREN RecName: Full=Virulence regulon transcriptional
   10::104     9e-06  24%  290 aa  YDEE_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  290::384     9e-06  26%  392 aa  XYLR_ECOLI RecName: Full=Xylose operon regulatory protein;
  290::384     9e-06  26%  392 aa  XYLR_ECOL6 RecName: Full=Xylose operon regulatory protein;
  290::384     9e-06  26%  392 aa  XYLR_ECO57 RecName: Full=Xylose operon regulatory protein;
  236::299     9e-06  34%  303 aa  ARACL_STRAT RecName: Full=Putative araC-like transcription
   72::164     1e-05  25%  166 aa  YCGK_ALTCA RecName: Full=Uncharacterized HTH-type transcriptional
  102::311     1e-05  27%  321 aa  XYLS_PSEPU RecName: Full=XylDLEGF operon transcriptional activator;
  210::275     1e-05  30%  281 aa  RHAR_KLEP7 RecName: Full=HTH-type transcriptional activator
   15::108     1e-05  22%  127 aa  MARA_SHIFL RecName: Full=Multiple antibiotic resistance protein
   15::108     1e-05  22%  127 aa  MARA_SALTY RecName: Full=Multiple antibiotic resistance protein
   15::108     1e-05  22%  127 aa  MARA_SALTI RecName: Full=Multiple antibiotic resistance protein
   15::108     1e-05  22%  127 aa  MARA_SALEN RecName: Full=Multiple antibiotic resistance protein
   15::108     1e-05  22%  127 aa  MARA_ECOLI RecName: Full=Multiple antibiotic resistance protein
   15::108     1e-05  22%  127 aa  MARA_ECO57 RecName: Full=Multiple antibiotic resistance protein
  122::249     2e-05  24%  252 aa  Y223_STAAM RecName: Full=Uncharacterized response regulatory
  122::249     2e-05  24%  252 aa  Y217_STAA3 RecName: Full=Uncharacterized response regulatory
  122::249     2e-05  24%  252 aa  Y215_STAAN RecName: Full=Uncharacterized response regulatory
  122::249     2e-05  24%  252 aa  Y201_STAAC RecName: Full=Uncharacterized response regulatory
  122::249     2e-05  24%  252 aa  Y198_STAAW RecName: Full=Uncharacterized response regulatory
  122::249     2e-05  24%  252 aa  Y198_STAAS RecName: Full=Uncharacterized response regulatory
  122::249     2e-05  24%  252 aa  Y184_STAA8 RecName: Full=Uncharacterized response regulatory
   34::275     3e-05  26%  282 aa  RHAR_SHIBS RecName: Full=HTH-type transcriptional activator
  188::276     3e-05  28%  283 aa  RHAR_ENTS8 RecName: Full=HTH-type transcriptional activator
   34::275     3e-05  26%  282 aa  RHAR_ECOL6 RecName: Full=HTH-type transcriptional activator
   34::275     3e-05  26%  282 aa  RHAR_ECOL5 RecName: Full=HTH-type transcriptional activator
   34::275     3e-05  26%  282 aa  RHAR_ECO24 RecName: Full=HTH-type transcriptional activator
  271::324     4e-05  33%  325 aa  VQSM_PSEAE RecName: Full=HTH-type transcriptional regulator
  211::275     5e-05  28%  282 aa  RHAR_SHIFL RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_SHIF8 RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_SHIDS RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_ECOUT RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_ECOLI RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_ECOK1 RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_ECOHS RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_ECOBW RecName: Full=HTH-type transcriptional activator
  211::275     5e-05  28%  282 aa  RHAR_ECO57 RecName: Full=HTH-type transcriptional activator
  136::249     6e-05  25%  252 aa  Y214_STAAR RecName: Full=Uncharacterized response regulatory
  102::311     8e-05  27%  331 aa  XYLS4_PSEPU RecName: Full=XylDLEGF operon transcriptional activator
  217::311     8e-05  27%  331 aa  XYLS3_PSEPU RecName: Full=XylDLEGF operon transcriptional activator
  205::280     1e-04  32%  284 aa  RHAR_PECCP RecName: Full=HTH-type transcriptional activator
  136::249     1e-04  24%  252 aa  Y161_STAAB RecName: Full=Uncharacterized response regulatory
  205::280     1e-04  30%  284 aa  RHAR_ERWCT RecName: Full=HTH-type transcriptional activator
  116::206     4e-04  31%  331 aa  RIPA_CORGL RecName: Full=HTH-type transcriptional repressor of iron
  212::309     5e-04  27%  314 aa  RHRA_RHIME RecName: Full=Transcriptional activator rhrA;
  217::324     9e-04  26%  332 aa  THCR_RHOER RecName: Full=Probable thc operon regulatory protein;
  181::241     9e-04  30%  274 aa  GADX_SHIFL RecName: Full=HTH-type transcriptional regulator gadX;
  181::241     9e-04  30%  274 aa  GADX_ECOLI RecName: Full=HTH-type transcriptional regulator gadX;
  181::241     9e-04  30%  274 aa  GADX_ECO57 RecName: Full=HTH-type transcriptional regulator gadX;
    1::240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDELRNILCERRIYTNSCLSHAHSFGQLLLPLQGTLFIETNLHRVRLDNKHLFFLPPGDNHTFYSKDKNE
YOBQ_BACSU      MDSLQEIICEKRTYTRLYHSHKHAYSQFLFPLEGSIDLETEGRQVKLNPDHFLYIPPQCEHRFRSIGRNE
YDIP_ECOLI      ----------------------------------------------------------------------
YISR_BACSU      ----------------------------------------------------------------------
YBBB_BACSU      ----------------------------------------------------------------------
LUMQ_PHOLE      --------------------HHHEYPQIILGLMGKSELSIEDSSVCLSPGMGYRINANVEHSFSGTSNNQ
POCR_SALTY      ----------------------------------------------------------------------
Y1052_HAEIN     ----------------------------------------------------------------------
YTDP_BACSU      ----------------------------------------------------------------------
CHBR_ECOLI      --------------------HQHDYYEFTLVLTGRYFQEINGKRVLLERGDFVFIPLGSHHSFYEFGATR
YQHC_ECOLI      ----------------------------------------------------------------------
YESS_BACSU      ----------------------------------------------------------------------
LACR_STAXY      ----------------------------------------------------------------------
YDEC_BACSU      ----------------------------------------------------------------------
ADAA_BACSU      ----------------------------------------------------------------------
ARAC_ERWCH      ----------------------------------------------------------------------
RAFR_PEDPE      ----------------------------------------------------------------------
YKGD_ECOLI      ----------------------------------------------------------------------
YIJO_ECOLI      ----------------------------------------------------------------------
RHAS_ESCF3      ----------------------------------------------------------------------
MSMR_STRMU      ----------------------------------------------------------------------
RHAS_ENT38      ----------------------------------------------------------------------
RHAS_SALTY      ----------------------------------------------------------------------
RHAS_SALTI      ----------------------------------------------------------------------
RHAS_SALPK      ----------------------------------------------------------------------
RHAS_SALPC      ----------------------------------------------------------------------
RHAS_SALPB      ----------------------------------------------------------------------
RHAS_SALPA      ----------------------------------------------------------------------
RHAS_SALNS      ----------------------------------------------------------------------
RHAS_SALHS      ----------------------------------------------------------------------
RHAS_SALG2      ----------------------------------------------------------------------
RHAS_SALEP      ----------------------------------------------------------------------
RHAS_SALDC      ----------------------------------------------------------------------
RHAS_SALCH      ----------------------------------------------------------------------
RHAS_SALAR      ----------------------------------------------------------------------
RHAS_SALA4      ----------------------------------------------------------------------
RHAS_SALSV      ----------------------------------------------------------------------
RHAS_KLEP7      ----------------------------------------------------------------------
RHAS_ECOUT      ----------------------------------------------------------------------
RHAS_ECOLU      ----------------------------------------------------------------------
RHAS_ECOK1      ----------------------------------------------------------------------
RHAS_ECO7I      ----------------------------------------------------------------------
RHAS_ECO45      ----------------------------------------------------------------------
RHAS_CITK8      ----------------------------------------------------------------------
RHAS_KLEP3      ----------------------------------------------------------------------
MELR_ECOLI      ----------------------------------------------------------------------
MELR_ECOL6      ----------------------------------------------------------------------
YPDC_ECOLI      ----------------------------------------------------------------------
RHAS_ECOSE      ----------------------------------------------------------------------
ARAC_ECOLI      ----------------------------------------------------------------------
ARAC_ECO57      ----------------------------------------------------------------------
ARAC_CITFR      ----------------------------------------------------------------------
RHAS_SHISS      ----------------------------------------------------------------------
RHAS_SHIFL      ----------------------------------------------------------------------
RHAS_SHIF8      ----------------------------------------------------------------------
RHAS_SHIDS      ----------------------------------------------------------------------
RHAS_SHIBS      ----------------------------------------------------------------------
RHAS_ECOSM      ----------------------------------------------------------------------
RHAS_ECOLI      ----------------------------------------------------------------------
RHAS_ECOLC      ----------------------------------------------------------------------
RHAS_ECOL6      ----------------------------------------------------------------------
RHAS_ECOL5      ----------------------------------------------------------------------
RHAS_ECOHS      ----------------------------------------------------------------------
RHAS_ECODH      ----------------------------------------------------------------------
RHAS_ECOBW      ----------------------------------------------------------------------
RHAS_ECO8A      ----------------------------------------------------------------------
RHAS_ECO81      ----------------------------------------------------------------------
RHAS_ECO5E      ----------------------------------------------------------------------
RHAS_ECO57      ----------------------------------------------------------------------
RHAS_ECO55      ----------------------------------------------------------------------
RHAS_ECO27      ----------------------------------------------------------------------
RHAR_YERPY      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
ARAC_SALTY      ----------------------------------------------------------------------
RHAS_ECO24      ----------------------------------------------------------------------
RHAR_YERPS      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
RHAR_YERPP      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
RHAR_YERPN      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
RHAR_YERPG      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
RHAR_YERPE      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
RHAR_YERPB      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
RHAR_YERPA      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
RHAR_YERP3      LSEQMPVAVTNRYPQETFVEHTHQFCEIVIVWRGNGLHVLNDHPYRITCGDVFYIQAADHHSYESVHD--
Y107_STAAR      ----------------------------------------------------------------------
Y101_STAAM      ----------------------------------------------------------------------
Y097_STAAN      ----------------------------------------------------------------------
Y078_STAAS      ----------------------------------------------------------------------
Y077_STAAW      ----------------------------------------------------------------------
SOXS_SALTY      ----------------------------------------------------------------------
Y084_STAAC      ----------------------------------------------------------------------
EXSA_PSEAE      ----------------------------------------------------------------------
YHTH1_STAAU     ----------------------------------------------------------------------
RHAS_SHIB3      ----------------------------------------------------------------------
RHAR_SALDC      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
SOXS_ECOLI      ----------------------------------------------------------------------
SOXS_ECOL6      ----------------------------------------------------------------------
SOXS_ECO57      ----------------------------------------------------------------------
RHAR_SALSV      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
MMSR_PSEAE      ----------------------------------------------------------------------
YBFP_BACSU      ----------------------------------------------------------------------
XYLS2_PSEPU     ----------------------------------------------------------------------
VIRF_YERE8      ----------------------------------------------------------------------
RHAS_MANSM      ----------------------------------------------------------------------
LCRF_YERPE      ----------------------------------------------------------------------
RHAR_SALTY      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALPK      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALPB      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALPA      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALNS      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALEP      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALTI      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALHS      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALCH      -DEQQAVTVADRYPQDIFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDQHSYTSV--ND
RHAR_SALAR      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNDRPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_SALA4      -DEQQAVTVADRYPQDVFAEHTHEFCELVMVWRGNGLHVLNERPYRITRGDLFYIRAEDKHSYTSV--ND
RHAR_MANSM      ------ITVERRHYQPPFPLHRHDFNEIVIISAGNHFWNDEIHPITTGN--VLYIESGDKHKYGEVDKDN
RHAR_ENT38      ---------------NVFAEHTHEFCELVLVWRGNGLHVLNDRPYRITRGDLFYIRAEDKHSYASV--ND
PCHR_PSEAE      ----------------------------------------------------------------------
ARACL_STRLI     ----------------------------------------------------------------------
TETD_ECOLX      ----------------------------------------------------------------------
YFIF_BACSU      ----------------------------------------------------------------------
Y2406_STAEQ     ----------------------------------------------------------------------
RHAS_YERPY      ----------------------------------------------------------------------
RHAS_YERPS      ----------------------------------------------------------------------
RHAS_YERPP      ----------------------------------------------------------------------
RHAS_YERPG      ----------------------------------------------------------------------
RHAS_YERPB      ----------------------------------------------------------------------
RHAS_YERP3      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
XYLS1_PSEPU     ---------------------------------------------------LLLLNPDDQADLYSEDCEK
Y165_STAES      ----------------------------------------------------------------------
VIRF_YEREN      ----------------------------------------------------------------------
YDEE_BACSU      ----------------------------------------------------------------------
XYLR_ECOLI      ----------------------------------------------------------------------
XYLR_ECOL6      ----------------------------------------------------------------------
XYLR_ECO57      ----------------------------------------------------------------------
ARACL_STRAT     ----------------------------------------------------------------------
YCGK_ALTCA      ----------------------------------------------------------------------
XYLS_PSEPU      ---------------------------------------------------LLLLNPDDQADLYSEDCEK
RHAR_KLEP7      ----------------------------------------------------------------------
MARA_SHIFL      ----------------------------------------------------------------------
MARA_SALTY      ----------------------------------------------------------------------
MARA_SALTI      ----------------------------------------------------------------------
MARA_SALEN      ----------------------------------------------------------------------
MARA_ECOLI      ----------------------------------------------------------------------
MARA_ECO57      ----------------------------------------------------------------------
Y223_STAAM      ----------------------------------------------------------------------
Y217_STAA3      ----------------------------------------------------------------------
Y215_STAAN      ----------------------------------------------------------------------
Y201_STAAC      ----------------------------------------------------------------------
Y198_STAAW      ----------------------------------------------------------------------
Y198_STAAS      ----------------------------------------------------------------------
Y184_STAA8      ----------------------------------------------------------------------
RHAR_SHIBS      --------------------HTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASV--ND
RHAR_ENTS8      ----------------------------------------------------------------------
RHAR_ECOL6      --------------------HTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASV--ND
RHAR_ECOL5      --------------------HTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASV--ND
RHAR_ECO24      --------------------HTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASV--ND
VQSM_PSEAE      ----------------------------------------------------------------------
RHAR_SHIFL      ----------------------------------------------------------------------
RHAR_SHIF8      ----------------------------------------------------------------------
RHAR_SHIDS      ----------------------------------------------------------------------
RHAR_ECOUT      ----------------------------------------------------------------------
RHAR_ECOLI      ----------------------------------------------------------------------
RHAR_ECOK1      ----------------------------------------------------------------------
RHAR_ECOHS      ----------------------------------------------------------------------
RHAR_ECOBW      ----------------------------------------------------------------------
RHAR_ECO57      ----------------------------------------------------------------------
Y214_STAAR      ----------------------------------------------------------------------
XYLS4_PSEPU     ---------------------------------------------------LLLLNPDDQADLYSEDCEK
XYLS3_PSEPU     ----------------------------------------------------------------------
RHAR_PECCP      ----------------------------------------------------------------------
Y161_STAAB      ----------------------------------------------------------------------
RHAR_ERWCT      ----------------------------------------------------------------------
RIPA_CORGL      ----------------------------------------------------------------------
RHRA_RHIME      ----------------------------------------------------------------------
THCR_RHOER      ----------------------------------------------------------------------
GADX_SHIFL      ----------------------------------------------------------------------
GADX_ECOLI      ----------------------------------------------------------------------
GADX_ECO57      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FLVLDIPASLLPEQNYKNMDGGVYLPLDQRWESLRFLFLSETGAHSKPNPSLHDLFRYASRLLYNFDQPV
YOBQ_BACSU      CLVLDVPLHAMKIDEYR-AGSGIEAALDPFWSSIRYLLTEEAKAGTAN--SLHMLVQYIKEKLQSHSY-A
YDIP_ECOLI      --------------------------------------------------SLWDAFAYTLAILYNFKNAY
YISR_BACSU      ----------------------------------------------------------------------
YBBB_BACSU      ----------------------------------------------------------------------
LUMQ_PHOLE      VLVMNLPPFI--SMTDVEQFGNSYFSLDARTHQLISLLATELKEHADDSQSISNTLQLIKRSLMLFDEKL
POCR_SALTY      -------------------------------KQLNFVVIKDNPQQSEANKTTRGPTPHDSKM------KK
Y1052_HAEIN     ----------------------------------------------------------------------
YTDP_BACSU      ----------------------------------------------------------------------
CHBR_ECOLI      ILNVGISKRFF-EQHYLPLLPYCFVASQVYRTNNAFLTYVETVISSLNETGLEEFFYVINRLRHYREEQV
YQHC_ECOLI      ----------------------------------------------------------------------
YESS_BACSU      ----------------------------------------------------------------------
LACR_STAXY      --------------------------------------------------------------IVNEDIQH
YDEC_BACSU      ----------------------------------------------------------------------
ADAA_BACSU      ----------------------------------------------------------------------
ARAC_ERWCH      ----------------------------------------------------------------------
RAFR_PEDPE      ---------------------------------------------------------------------L
YKGD_ECOLI      ----------------------------------------------------------------------
YIJO_ECOLI      ----------------------------------------------------------------------
RHAS_ESCF3      ----------------------------------------------------------------------
MSMR_STRMU      ----------------------------------------------------------------------
RHAS_ENT38      ----------------------------------------------------------------------
RHAS_SALTY      ----------------------------------------------------------------------
RHAS_SALTI      ----------------------------------------------------------------------
RHAS_SALPK      ----------------------------------------------------------------------
RHAS_SALPC      ----------------------------------------------------------------------
RHAS_SALPB      ----------------------------------------------------------------------
RHAS_SALPA      ----------------------------------------------------------------------
RHAS_SALNS      ----------------------------------------------------------------------
RHAS_SALHS      ----------------------------------------------------------------------
RHAS_SALG2      ----------------------------------------------------------------------
RHAS_SALEP      ----------------------------------------------------------------------
RHAS_SALDC      ----------------------------------------------------------------------
RHAS_SALCH      ----------------------------------------------------------------------
RHAS_SALAR      ----------------------------------------------------------------------
RHAS_SALA4      ----------------------------------------------------------------------
RHAS_SALSV      ----------------------------------------------------------------------
RHAS_KLEP7      ----------------------------------------------------------------------
RHAS_ECOUT      ----------------------------------------------------------------------
RHAS_ECOLU      ----------------------------------------------------------------------
RHAS_ECOK1      ----------------------------------------------------------------------
RHAS_ECO7I      ----------------------------------------------------------------------
RHAS_ECO45      ----------------------------------------------------------------------
RHAS_CITK8      ----------------------------------------------------------------------
RHAS_KLEP3      ----------------------------------------------------------------------
MELR_ECOLI      ------------------------------WEPI---LVNKTSRTHKNSVSRHAQF-YVSQML-------
MELR_ECOL6      ------------------------------WEPI---LVNKTSRTHKNSVSRHAQF-YVSQML-------
YPDC_ECOLI      ----------------------------------------------------------------------
RHAS_ECOSE      ----------------------------------------------------------------------
ARAC_ECOLI      ----------------------------------------------------------------------
ARAC_ECO57      ----------------------------------------------------------------------
ARAC_CITFR      ----------------------------------------------------------------------
RHAS_SHISS      ----------------------------------------------------------------------
RHAS_SHIFL      ----------------------------------------------------------------------
RHAS_SHIF8      ----------------------------------------------------------------------
RHAS_SHIDS      ----------------------------------------------------------------------
RHAS_SHIBS      ----------------------------------------------------------------------
RHAS_ECOSM      ----------------------------------------------------------------------
RHAS_ECOLI      ----------------------------------------------------------------------
RHAS_ECOLC      ----------------------------------------------------------------------
RHAS_ECOL6      ----------------------------------------------------------------------
RHAS_ECOL5      ----------------------------------------------------------------------
RHAS_ECOHS      ----------------------------------------------------------------------
RHAS_ECODH      ----------------------------------------------------------------------
RHAS_ECOBW      ----------------------------------------------------------------------
RHAS_ECO8A      ----------------------------------------------------------------------
RHAS_ECO81      ----------------------------------------------------------------------
RHAS_ECO5E      ----------------------------------------------------------------------
RHAS_ECO57      ----------------------------------------------------------------------
RHAS_ECO55      ----------------------------------------------------------------------
RHAS_ECO27      ----------------------------------------------------------------------
RHAR_YERPY      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
ARAC_SALTY      ----------------------------------------------------------------------
RHAS_ECO24      ----------------------------------------------------------------------
RHAR_YERPS      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
RHAR_YERPP      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
RHAR_YERPN      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
RHAR_YERPG      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
RHAR_YERPE      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
RHAR_YERPB      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
RHAR_YERPA      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
RHAR_YERP3      -LVLD-NIIYCPERLHLNAQWHKLLPPLGPEQNQGYWRLTTQGM-AQARPIIQQLAQWSIQLTEVLLLQL
Y107_STAAR      ----------------------------------------------------------------------
Y101_STAAM      ----------------------------------------------------------------------
Y097_STAAN      ----------------------------------------------------------------------
Y078_STAAS      ----------------------------------------------------------------------
Y077_STAAW      ----------------------------------------------------------------------
SOXS_SALTY      ----------------------------------------------------------------------
Y084_STAAC      ----------------------------------------------------------------------
EXSA_PSEAE      ----------------------------------------------------------------------
YHTH1_STAAU     ----------------------------------------------------------------------
RHAS_SHIB3      ----------------------------------------------------------------------
RHAR_SALDC      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
SOXS_ECOLI      ----------------------------------------------------------------------
SOXS_ECOL6      ----------------------------------------------------------------------
SOXS_ECO57      ----------------------------------------------------------------------
RHAR_SALSV      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
MMSR_PSEAE      ----------------------------------------------------------------------
YBFP_BACSU      ----------------------------------------------------------------------
XYLS2_PSEPU     ----------------------------------------------------------------------
VIRF_YERE8      ------------------------------------------------------LFLSALRHLGNRPEER
RHAS_MANSM      ----------------------------------------------------------------------
LCRF_YERPE      ------------------------------------------------------LFLSALRHLGNRPEER
RHAR_SALTY      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALPK      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALPB      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALPA      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALNS      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALEP      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALTI      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALHS      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALCH      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALAR      LVLQNIPERLKLNVNWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_SALA4      LVLQNIPERLKLNINWQAMIPGFQMGMNQARQVINQLEHESNGRDPLANEMAELLFRYATDDLPATSRET
RHAR_MANSM      ILYRPEKLSLFPIMKD-------YIPHNNEKKSLRISLISQLEIESKKTSSMHAIFLQILILICRTQQQE
RHAR_ENT38      LVLQNV--IYCPDRLKLNVDWASNIPGFNDARGAPHWRLSSNGADQSANEMAELLFAQLKRFRYATDNPS
PCHR_PSEAE      ----------------------------------------------------------------------
ARACL_STRLI     ----------------------------------------------------------------------
TETD_ECOLX      ----------------------------------------------------------------------
YFIF_BACSU      ----------------------------------------------------------------------
Y2406_STAEQ     ----------------------------------------------------------------------
RHAS_YERPY      ----------------------------------------------------------------------
RHAS_YERPS      ----------------------------------------------------------------------
RHAS_YERPP      ----------------------------------------------------------------------
RHAS_YERPG      ----------------------------------------------------------------------
RHAS_YERPB      ----------------------------------------------------------------------
RHAS_YERP3      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
XYLS1_PSEPU     FIV-KLPSVVLDENNWHKPREGIRFAARHNLQQLDGFIVCDEAEHTKSMPRVQEHYAIASKLLEMLGSNV
Y165_STAES      ----------------------------------------------------------------------
VIRF_YEREN      ----------------------------------------------------------------------
YDEE_BACSU      ----------------------------------------------------------------------
XYLR_ECOLI      ----------------------------------------------------------------------
XYLR_ECOL6      ----------------------------------------------------------------------
XYLR_ECO57      ----------------------------------------------------------------------
ARACL_STRAT     ----------------------------------------------------------------------
YCGK_ALTCA      ----------------------------------------------------------------------
XYLS_PSEPU      FIV-KLPSVVLDDNNWHKPREGIRFAARHNLQQLDGFIVCDEAEHTKSMPRVQEHYAIASKLLEMLGSNV
RHAR_KLEP7      ----------------------------------------------------------------------
MARA_SHIFL      ----------------------------------------------------------------------
MARA_SALTY      ----------------------------------------------------------------------
MARA_SALTI      ----------------------------------------------------------------------
MARA_SALEN      ----------------------------------------------------------------------
MARA_ECOLI      ----------------------------------------------------------------------
MARA_ECO57      ----------------------------------------------------------------------
Y223_STAAM      --------------------------------------LEQQSQNGRSLASCHDAFQPLLKVEYD-DYYV
Y217_STAA3      --------------------------------------LEQQSQNGRSLASCHDAFQPLLKVEYD-DYYV
Y215_STAAN      --------------------------------------LEQQSQNGRSLASCHDAFQPLLKVEYD-DYYV
Y201_STAAC      --------------------------------------LEQQSQNGRSLASCHDAFQPLLKVEYD-DYYV
Y198_STAAW      --------------------------------------LEQQSQNGRSLASCHDAFQPLLKVEYD-DYYV
Y198_STAAS      --------------------------------------LEQQSQNGRSLASCHDAFQPLLKVEYD-DYYV
Y184_STAA8      --------------------------------------LEQQSQNGRSLASCHDAFQPLLKVEYD-DYYV
RHAR_SHIBS      LVLQNI--IYCPERLKLNLDWQGAIPMAQARQVIGQLEHESSQHVSFANEMAELLFGQLVMLLYTSDSPT
RHAR_ENTS8      ----------------------------------------------------------------SLDVPF
RHAR_ECOL6      LVLQNI--IYCPERLKLNLDWQGAIPMAQARQVIGQLEHESSQHVSFANEMAELLFGQLVMLLYTSDSPT
RHAR_ECOL5      LVLQNI--IYCPERLKLNLDWQGAIPMAQARQVIGQLEHESSQHVSFANEMAELLFGQLVMLLYTSDSPT
RHAR_ECO24      LVLQNI--IYCPERLKLNLDWQGAIPMAQARQVIGQLEHESSQHVSFANEMAELLFGQLVMLLYTSDSPT
VQSM_PSEAE      ----------------------------------------------------------------------
RHAR_SHIFL      ----------------------------------------------------------------------
RHAR_SHIF8      ----------------------------------------------------------------------
RHAR_SHIDS      ----------------------------------------------------------------------
RHAR_ECOUT      ----------------------------------------------------------------------
RHAR_ECOLI      ----------------------------------------------------------------------
RHAR_ECOK1      ----------------------------------------------------------------------
RHAR_ECOHS      ----------------------------------------------------------------------
RHAR_ECOBW      ----------------------------------------------------------------------
RHAR_ECO57      ----------------------------------------------------------------------
Y214_STAAR      ----------------------------------------------------HDAFQPLLKVEYD-DYYV
XYLS4_PSEPU     FIV-KLPSVVLDDNNWHKPREGIRFAARHNLQQLDGFIVCDEAEHTKSMPRVQEHYAIASKLLEMLGSNV
XYLS3_PSEPU     ----------------------------------------------------------------------
RHAR_PECCP      ----------------------------------------------------------------------
Y161_STAAB      ----------------------------------------------------HDAFQPLLKVEYD-DYYV
RHAR_ERWCT      ----------------------------------------------------------------------
RIPA_CORGL      ----------------------------------------------------------------------
RHRA_RHIME      ---------------------------------------------------------------------I
THCR_RHOER      ----------------------------------------------EPKPALPGIVRLA-----------
GADX_SHIFL      ----------------------------------------------------------------------
GADX_ECOLI      ----------------------------------------------------------------------
GADX_ECO57      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLSPLAFIQKLRLEKAKYLLINTDFSLLRIAQE
YOBQ_BACSU      SIAYIHSHLFERLTIKKLAEIEHYHPAYYSSWFKKQTGKSPQNYIADLRLEEAKRMLMERNETLTVVSEA
YDIP_ECOLI      RSEYLNNNYREKITLEQLSKKFRASVSYICHEFTKEYRISPINYVIQRRMTEAKWSLTNTELSQAEISWR
YISR_BACSU      --RYLQEHYKEKTTIKDLSLALHYHQDYVSRCMQQVLGVTPAQYTNRVRMTEAKRLLSSTNDKMGVIAET
YBBB_BACSU      ---YIETHADTKITLAQLSQMAGISAKHYSESFKKWTGQSVTEFITKTRITKAKRLMAKSNCKLKEIAHQ
LUMQ_PHOLE      IDNYIEQHLQKKISVAELSSVAFLAQSQFYALFKSQMGITPHQYVLRKRLDLAKQLIAERQKPLSQVAQL
POCR_SALTY      ALRYIDAHLSDDLRLEDVASHVYLSPYYFSKLFKKYQGIGFNAWVNRQRMVSARELLCHSDWSIASIARN
Y1052_HAEIN     -LQQPQNDWH----IEQLAELATMSRANFIRIFQQHIGMSPGRFLTKVRLQSAAFLLKQSQQSVLAIALE
YTDP_BACSU      --------FESELTLDEIARRLHYNPNYLSSIFKKEMGISFSEYVSSYRHHMAKSWLAETDMAVKDIAEK
CHBR_ECOLI      IDDVPQMHDKEQFSLENMVALSAKSQEYLTRATQRYYGKTPMQIINEIRINFAKKQLEMTNYSVTDIAFE
YQHC_ECOLI      -LKRIENKYTENLSVEQLAAEANMSVSAFHHNFKSVTSTSPLQYLKNYRLHKARMMIIHDGMKASAAAMR
YESS_BACSU      -IAMIHEQYMADISLESCADALGMNSYTLSKAFKQVTGINFIDYVTQIRIEKAKELLVNTNKKIHDVSEE
LACR_STAXY      AVDFINTNYQKHITVEDVAKSVNITRSHLYKLFKKNLGCSPKEYLTYIRMYHASQLLIHTSTLISDISRQ
YDEC_BACSU      -LNWIHLHYVEKITLEDIAKAGQLSRSECCRYFKRMLNKTPLRYVMDYRIQKSLLLLQHPESNVTEVSYQ
ADAA_BACSU      --EYIDKNFTEKLTLESLADICHGSPYHMHRTFKKIKGITLVEYIQQVRVHAAKKYLIQTNKAIGDIAIC
ARAC_ERWCH      --QFITSNLAGELRIDEVARHVCLSPSRLAHLFREQVGINILRWREDQRVIRAKLLLQTTQESIANIGRV
RAFR_PEDPE      AVSYLQENYSTGCTIMDLCHYLNLSRSYLYTLFKTHANTSPQKLLTKLRLEDAKQRLSTSNNSVQSIANM
YKGD_ECOLI      -------------TVESLASIAHMSRASFAQLFRDVSGTTPLAVLTKLRLQIAAQMFSRETLPVVVIAES
YIJO_ECOLI      ---YIDERYASALTRESVAQAFYISPNYLSHLFQKTGAIGFNEYLNHTRLEHAKTLLKGYDLKVKEVAHA
RHAS_ESCF3      -IAWLEDHFAEAVSWEAIADRFALSLRTLHRQLKQHTGLTPQRYLNRLRLVKARHLLRHSDDSVTHIAFS
MSMR_STRMU      ----IHSQYGSSLRVNDIAKKLNLSRSYLYKIFRKSTNLSIKEYILQVRMKRSQYLLENPKLSIAEISNS
RHAS_ENT38      ---WLEDHFAEEVSWETVADVFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHTDESVTDIAYR
RHAS_SALTY      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALTI      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALPK      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALPC      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALPB      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALPA      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALNS      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALHS      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALG2      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALEP      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALDC      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALCH      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALAR      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALA4      ---WLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_SALSV      ---WLEEHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYR
RHAS_KLEP7      -LAWLEDHFAQEICWEEVAAQFSLSLRTLHRQLKQQTGLTPQRYLNRVRLMKARHLLRHSDESVTDIAYR
RHAS_ECOUT      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQKTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOLU      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQKTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOK1      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQKTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECO7I      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQKTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECO45      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQKTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_CITK8      -LAWLEDHFAEEVCWESIADKFSLSLRTLHRQLKQQTGLTPQRYLNRLRLIKARHLLRHSDESVTDIAYR
RHAS_KLEP3      -LAWLEDHFAQEICWEEVAAQFSLSLRTLHRQLKQQTGLTPQRYLNRVRLMKARHLLRHSDESVTDIAFR
MELR_ECOLI      --GFIAENYDQALTINDVAEHVKLNANYAMGIFQRVMQLTMKQYITAMRINHVRALLSDTDKSILDIALT
MELR_ECOL6      --GFIAENYDQALTINDVAEHVKLNANYAMGIFQRVMQLTMKQYITAMRINHVRALLSDTDKSILDIALT
YPDC_ECOLI      ---WVQDNYAQPLTRESVAQFFNITPNHLSKLFAQHGTMRFIEYVRWVRMAKARMILQKYHLSIHEVAQR
RHAS_ECOSE      -LAWLEDHFADEVNWDAVAEQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
ARAC_ECOLI      --QYISDHLADS-NFDIASVAQHVSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRN
ARAC_ECO57      --QYISDHLADS-NFDIASVAQHVSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRN
ARAC_CITFR      --QYISDHLADS-NFDIASVAQHVSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRN
RHAS_SHISS      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_SHIFL      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_SHIF8      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_SHIDS      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_SHIBS      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOSM      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOLI      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOLC      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOL6      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOL5      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOHS      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECODH      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECOBW      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECO8A      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECO81      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECO5E      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYH
RHAS_ECO57      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYH
RHAS_ECO55      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAS_ECO27      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAR_YERPY      AIVLKRHRYREQLDL-IMSALQYFDMANFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
ARAC_SALTY      --QYISDHLADS-HFDIASVAQHVSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRN
RHAS_ECO24      -LAWLEDHFADEVNWDAVAEQFSLSLRTLHRQLKQQTGVTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAR_YERPS      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
RHAR_YERPP      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
RHAR_YERPN      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
RHAR_YERPG      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
RHAR_YERPE      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
RHAR_YERPB      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
RHAR_YERPA      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
RHAR_YERP3      AIVLKRHRYREQLDL-IMSALQYFDMADFCQLFRQQTGMSISHYLRQIRLCHAKCLLRGSEHRISDIAAR
Y107_STAAR      ---YIELHFHEDLSLSELSEYVGWSESHLSKKFAESLGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQ
Y101_STAAM      ---YIELHFHEDLSLSELSEYVGWSESHLSKKFTESLGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQ
Y097_STAAN      ---YIELHFHEDLSLSELSEYVGWSESHLSKKFTESLGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQ
Y078_STAAS      ---YIELHFHEDLSLSELSEYVGWSESHLSKKFTESLGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQ
Y077_STAAW      ---YIELHFHEDLSLSELSEYVGWSESHLSKKFTESLGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQ
SOXS_SALTY      -IEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGEYIRQRRLLLAAVELRTTERPIFDIAMD
Y084_STAAC      ---YIELHFHEDLSLSELSEYVGWSESHLSKKFTESLGVGFHHFLNTTRIEHAKLDLTYTDETITDIALQ
EXSA_PSEAE      ---FMEKHYLNEWKLSDFSREFGMGLTTFKELFGSVYGVSPRAWISERRILYAHQLLLNSDMSIVDIAME
YHTH1_STAAU     ---YIELHFHEDLSLSELSEYVGWSESHLSKKFAESLGVGFQHFLNTTRIEHAKLDLTYTDEMITDIALQ
RHAS_SHIB3      -LAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYR
RHAR_SALDC      LITALANSLESSFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
SOXS_ECOLI      -IAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMD
SOXS_ECOL6      -IAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMD
SOXS_ECO57      -IAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMD
RHAR_SALSV      LITALANSLERPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
MMSR_PSEAE      ---------------------------HFVSRYKAITGRTPIQHFLHLKIEYACQLLDSSDQSVARVGQA
YBFP_BACSU      TINWIESHLHEQISNEDIVNVSSFSKFHFHRIFQKEVGMSVASYIXXXXXXXXXXXXXYTDHRIIDIALY
XYLS2_PSEPU     -VQFIEENVKRSISLEQLAELALMSPRSLYTMFEKHTGTTPMNYIRNRKLECVRACLSNPTTSITEVALD
VIRF_YERE8      LQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAHQLLLNCKMSIVDIAME
RHAS_MANSM      -IRWLENNFEKEIDWEELAEKFALPIRTLHRYIKSQTGHTPQNYVTKLRLAQAYYQLKYTEKNIINIAYD
LCRF_YERPE      LQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAHQLLLNGKMSIVDIAME
RHAR_SALTY      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_SALPK      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_SALPB      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_SALPA      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_SALNS      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_SALEP      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_SALTI      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMVSEISMQ
RHAR_SALHS      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMVSEISMQ
RHAR_SALCH      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMVSEISMQ
RHAR_SALAR      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_SALA4      LITALANSLECPFALDAFCQQEQCSERVLRQQFRAQTGMTINQYLRQVRICHAQYLLQHSPLMISEISMQ
RHAR_MANSM      NKAYSDISKLESLALNQSISQEFYLADFCRQHFKQQTNMTIAQYLQKLRLCRAATLLRNTSESVANIAIR
RHAR_ENT38      ANE--QEALLDKLSLNRSFVLEKFCEQEQCQQFRTQTGMTVNHYLRQLRICHAQYLLQHTELMVSEVAMR
PCHR_PSEAE      ---------QEPPSLDTLASRVGMNPRKLTAGFRKVFGASVFGYLQEYRLREAHRMLCDEEANVSTVAYR
ARACL_STRLI     --------------------------------FKATVGQGPLEYLTRWRIELAARQLREGNATLASIAHS
TETD_ECOLX      ---WIEHNLDQSLLLDDVANKAGYTKWYFQRLFKKVTGVTLASYIRARRLTKAAVELRLTKKTILEIALK
YFIF_BACSU      ---HIKDNLSQPLKLTDVASHFHISGRHLSRLFAAELGVSYSEFVQNEKINKAAELLKSTNLSIKEIAEE
Y2406_STAEQ     -LSQIKQHYHKKVTVLDLINPIDVSESYAMRTFKEHVGITIVDYLNRYRILKSLHLL-DQHYKHYEIAEK
RHAS_YERPY      -LDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTRLRLLQARHQLCYSDNSVTDIAYL
RHAS_YERPS      -LDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTRLRLLQARHQLCYSDNSVTDIAYL
RHAS_YERPP      -LDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTRLRLLQARHQLCYSDNSVTDIAYL
RHAS_YERPG      -LDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTRLRLLQARHQLCYSDNSVTDIAYL
RHAS_YERPB      -LDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTRLRLLQARHQLCYSDNSVTDIAYL
RHAS_YERP3      -LDWLQNNYSEAVEWPELADRFALPLRTLHRQLKNKTGMTPQRYLTRLRLLQARHQLCYSDNSVTDIAYL
YESN_BACSU      ------------------------NPDYLGKLFKQETGEKFSQYVTRVRLEHAKQMKIRRDVSVSEIAEE
XYLS1_PSEPU     SVQFIEENLKRNISLERLAELAMMSPRSLYNLFEKHAGTTPKNYIRNRKLESIRACLNDPSASITEIALD
Y165_STAES      -LSQIKQHYHKKVTVLDLINPIVVSESYAMRTFKEHVGITIVDYLNRYRILKSLHLL-DQHYKHYEIAEK
VIRF_YEREN      ---YLQGWKLSKFAREFGMGLTTFK-----ELFGTVYGISPRAWISERRILYAHQLLLNGKMSIVDIAME
YDEE_BACSU      ALKYIEENLTNDIDFQEAAKLAFCSEYHFKRMFSFLAGISLSEYIRRRRLTLAAFELKDSNVKVIDIAIK
XYLR_ECOLI      AMHYIRNHACKGIKVDQVLDAVGISRSNLEKRFKEEVGETIHAMIHAEKLEKARSLLISTTLSINEISQM
XYLR_ECOL6      AMHYIRNHACKGIKVDQVLDAVGISRSNLEKRFKEEVGETIHAMIHAEKLEKARSLLISTTLSINEISQM
XYLR_ECO57      AMHYIRNHACKGIKVDQVLDAVGISRSNLEKRFKEEVGETIHAMIHAEKLEKARSLLISTTLSINEISQM
ARACL_STRAT     --------------------------------FKATVGQGPLEYLTRWRIELTARQLREGSAPLAAIAHS
YCGK_ALTCA      ---YIENNYFNDINIDTVAFSVGVSRSYLVKQFKLATNKTINNRIIEVRIEQAKKVLLKK--SVTETAYE
XYLS_PSEPU      SVQFIEENLKRNISLERLAELAMMSPRSLYNLFEKHAGTTPKNYIRNRKLESIRACLNDPSASITEIALD
RHAR_KLEP7      ------------------------------QQFRQQTGMTINHYLRQLRICHAQYLLQHTERLIGDIAMQ
MARA_SHIFL      -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
MARA_SALTY      -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
MARA_SALTI      -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
MARA_SALEN      -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
MARA_ECOLI      -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
MARA_ECO57      -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
Y223_STAAM      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
Y217_STAA3      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
Y215_STAAN      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
Y201_STAAC      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
Y198_STAAW      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
Y198_STAAS      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
Y184_STAA8      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
RHAR_SHIBS      SSETLLDKLITRLSLKSPFALDKFCDEASCQQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ENTS8      DLQHFCSHYQ--IAERPLRQL-----------FRQQTGMTISQYLRQLRICQAQYLLRHSSLLISEIAAR
RHAR_ECOL6      SSETLLDKLITRLSLKSPFALDKFCDEASCQQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECOL5      SSETLLDKLITRLSLKSPFALDKFCDEASCQQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECO24      SSETLLDKLITRLSLKSPFALDKFCDEASCQQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
VQSM_PSEAE      --------------------------------------------VDKARKERAIALLLNSSIPVDRISDI
RHAR_SHIFL      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_SHIF8      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_SHIDS      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECOUT      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECOLI      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECOK1      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECOHS      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECOBW      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
RHAR_ECO57      ------------------------------QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTE
Y214_STAAR      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
XYLS4_PSEPU     SVQFIEENLKRNISLERLAELALMSPRSLYTLFEKHAGTTPKNYIRNRKLECIRARLSDPNASVTEMALD
XYLS3_PSEPU     -VQFIEDNLKQSISLERLAELALMSPRSLYTLFEKHAGTTPKNYIRNRKLECIRARLSDPNASVTEMALD
RHAR_PECCP      ----------------------HFSARSLRSRFKEQTGMSVPHYLRQLRLCKAMELLRYDLQTIGDIAAL
Y161_STAAB      NVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLL-DRHYKHYEIADK
RHAR_ERWCT      ----------------------HFSARSLRSRFKEQTGMSVPHYLRQLRLCKAMELLRYDLQTIGDVAAL
RIPA_CORGL      --QVLVSNPADQTSLEEFAEIQGVSARTLQRQFLKSTGYSFSEWRAAQRVCVAASLLAH-DFSISVVANL
RHRA_RHIME      KMRVEQNLANGSFSITDVAEAERITPRAIQKFFSRETTFSRYVLGRRLSLAKSLILAEGEATSISQIAYN
THCR_RHOER      -VDYLEAHAQQPLTVAQVARNVGVSVRSLQVGFQNSLGTTPMRQLKIIRMQKARKDLLRADEGVTEIAQR
GADX_SHIFL      ---------------------------------EEETSYSQL--LTECRMQRALQLIVIHGFSIKRVAVS
GADX_ECOLI      ---------------------------------EEETSYSQL--LTECRMQRALQLIVIHGFSIKRVAVS
GADX_ECO57      ---------------------------------EEETSYSQL--LTECRMQRALQLIVIHGFSIKRVAVS


                         .         .         .         +         .         .         .:280
query           VGYEQQSSLARLFRQKEGMSASDYRKAFQR
YOBQ_BACSU      LGFQNLSSFTRWFTKSTGMPPRLYR-----
YDIP_ECOLI      VGYENVDHFAKLFLRHVGCSPSDYRRQFK-
YISR_BACSU      VGMEDPTYFSKLFKQIEGISPIEYRKIVSR
YBBB_BACSU      TGYQDEFYFSRIFKKYTGCSPTSYMK----
LUMQ_PHOLE      CGXXXXXXXXXAFRRLYGMSPTRYQ-----
POCR_SALTY      LGFSQTSYFCKVFRQTYQVTPQAYRQ----
Y1052_HAEIN     VGYQSEAHFCKVFKNYYQLSPSQYRKS---
YTDP_BACSU      LKYKNSQNFIRSFKKLEGITPGNYRQ----
CHBR_ECOLI      AGYSSPSLFIKTFKKLTSFTPKSYRK----
YQHC_ECOLI      VGYESASQFSREFKRYFGVTPGE-------
YESS_BACSU      VGY-RHNYFNRIFKKQVGMPPGVFRQMYQ-
LACR_STAXY      VGYKDPLLFSKNFTKHFEISASEYRHHF--
YDEC_BACSU      VGFNSTSYFISKFQQAMNMTPLSYKK----
ADAA_BACSU      VGIANAPYFITLFKKKTGQTPARFRQ----
ARAC_ERWCH      VGYDDQLYFSRVFRKRVGVSPSDFRR----
RAFR_PEDPE      VGYKDSFTFSKAFKRYSGASPSYYRKS---
YKGD_ECOLI      VGYASESSFHKAFVREFGCTPGEYRE----
YIJO_ECOLI      CGFVDSNYFCRLFRKNTERSPSEYRRQY--
RHAS_ESCF3      CGFADSNHFSTLFRREFGWSPREIRQ----
MSMR_STRMU      VGFSDSLAFSKAFKNYFGKSPSKFRKEIQ-
RHAS_ENT38      CGFGDSNHFSTLFRREFSWSPREIRQ----
RHAS_SALTY      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALTI      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALPK      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALPC      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALPB      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALPA      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALNS      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALHS      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALG2      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALEP      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALDC      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALCH      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALAR      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALA4      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SALSV      CGFGDSNHFSTLFRREFNWSPRDIRQ----
RHAS_KLEP7      CGFGDSNHFSTLFRREFDWSPRDIRQ----
RHAS_ECOUT      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOLU      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOK1      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO7I      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO45      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_CITK8      CGFGDSNHFSTLFRREFDWSPRDIRQ----
RHAS_KLEP3      CGFGDSNHFSTLFRREFDWSPRDIRQ----
MELR_ECOLI      AGFRSSSRFYSTFGKYVGMSPQQYRKLSQQ
MELR_ECOL6      AGFRSSSRFYSTFGKYVGMSPQQYRKLSQQ
YPDC_ECOLI      CGFPDSDYFCRVFRRQFGLTPGEYSARFQ-
RHAS_ECOSE      CGFSDSNHFSTLFRREFNWSPRDIRQ----
ARAC_ECOLI      VGFDDQLYFSRVFKKCTGASPSEFR-----
ARAC_ECO57      VGFDDQLYFSRVFKKCTGASPSEFR-----
ARAC_CITFR      VGFDDQLYFSRVFKKCTGASPSEFR-----
RHAS_SHISS      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SHIFL      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SHIF8      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SHIDS      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_SHIBS      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOSM      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOLI      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOLC      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOL6      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOL5      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOHS      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECODH      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECOBW      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO8A      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO81      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO5E      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO57      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO55      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAS_ECO27      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAR_YERPY      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
ARAC_SALTY      VGFDDQLYFSRVFKKCTGASPSEFR-----
RHAS_ECO24      CGFSDSNHFSTLFRREFNWSPRDIRQ----
RHAR_YERPS      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
RHAR_YERPP      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
RHAR_YERPN      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
RHAR_YERPG      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
RHAR_YERPE      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
RHAR_YERPB      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
RHAR_YERPA      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
RHAR_YERP3      CGFEDSNYFSAVFTREAGMTPRDYRQRFIR
Y107_STAAR      NGFSSAASFARTFKHFTHQTPKQYR-----
Y101_STAAM      NGFSSAASFARTFKHFTHQTPKQYR-----
Y097_STAAN      NGFSSAASFARTFKHFTHQTPKQYR-----
Y078_STAAS      NGFSSAASFARTFKHFTHQTPKQYR-----
Y077_STAAW      NGFSSAASFARTFKHFTHQTPKQYR-----
SOXS_SALTY      LGYVSQQTFSRVFRREFDRTPSDYR-----
Y084_STAAC      NGFSSAASFARTFKHFTHQTPKQYR-----
EXSA_PSEAE      AGFSSQSYFTQSYRRRFGCTPSRSRQ----
YHTH1_STAAU     NGFSSAASFARTFKHITHQTPKQYR-----
RHAS_SHIB3      CGFSDSNHFSTLFHREFNWSPRDIRQ----
RHAR_SALDC      CGFEDSNYFSVVFTRETGMTPSQWR-----
SOXS_ECOLI      LGYVSQQTFSRVFRRQFDRTPSDYR-----
SOXS_ECOL6      LGYVSQQTFSRVFRRQFDRTPSDYR-----
SOXS_ECO57      LGYVSQQTFSRVFRRQFDRTPSDYR-----
RHAR_SALSV      CGFEDSNYFSVVFTRETGMTPSQWR-----
MMSR_PSEAE      VGYDDSYYFSRLFSKVMGLSPSAYRQ----
YBFP_BACSU      YQFESQEAFTRTFKKMYHMPPGAYRTFMKR
XYLS2_PSEPU     YGFLHLGRFAEKYRSTFGELPSD-------
VIRF_YERE8      AGFSSQSYFTQSYRRRFGCTPSQAR-----
RHAS_MANSM      CGFNDSSYFSTCFKNEYSIAPRELR-----
LCRF_YERPE      AGFSSQSYFTQSYRRRFGCTPSQAR-----
RHAR_SALTY      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALPK      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALPB      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALPA      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALNS      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALEP      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALTI      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALHS      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALCH      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALAR      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SALA4      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_MANSM      CGYSDSNYFSSVFGKTFSCTPTEYRSRF--
RHAR_ENT38      CGFEDSNYFSVVFNREVGMTPVQWR-----
PCHR_PSEAE      VGY-SPAHFSIAFRKRYGISPSEIR-----
ARACL_STRLI     VGYGSESALSVAFKRVLGMPPGDYRK----
TETD_ECOLX      YQFDSQQSFTRRFKYIFKVTPSYYRR----
YFIF_BACSU      IGFSVH-YFTRVFSAKIGSSPGLFRSLYK-
Y2406_STAEQ     VGFSEYKMFCYHFKKYLHMSPSDYNK----
RHAS_YERPY      CGFGDSNHFSTLFKREFSQSPRDLR-----
RHAS_YERPS      CGFGDSNHFSTLFKREFSQSPRDLR-----
RHAS_YERPP      CGFGDSNHFSTLFKREFSQSPRDLR-----
RHAS_YERPG      CGFGDSNHFSTLFKREFSQSPRDLR-----
RHAS_YERPB      CGFGDSNHFSTLFKREFSQSPRDLR-----
RHAS_YERP3      CGFGDSNHFSTLFKREFSQSPRDLR-----
YESN_BACSU      IGFDNPKYFSLVFKKYTGLTPSEFRR----
XYLS1_PSEPU     YGFLHLGRFAENYRSAFGELPSD-------
Y165_STAES      VGFSEYKMFCYHFKKYLHMSPSDYNK----
VIRF_YEREN      AGFSSQSYFTQSYRRRFGCTPSQAR-----
YDEE_BACSU      YGYNSPDSFARAFQNLHGINPSKAR-----
XYLR_ECOLI      CGYPSLQYFYSVFKKAYDTTPKEYR-----
XYLR_ECOL6      CGYPSLQYFYSVFKKAYDTTPKEYR-----
XYLR_ECO57      CGYPSLQYFYSVFKKAYDTTPKEYR-----
ARACL_STRAT     VGYGSESALSVAFKRVLGMNPGDYRK----
YCGK_ALTCA      VGFNNSNYFATVFKKRTNYTPKQFKRTF--
XYLS_PSEPU      YGFLHLGRFAENYRSAFGELPSD-------
RHAR_KLEP7      CGFEDSNYFSVVFSREIGMSPGQWRQ----
MARA_SHIFL      YGFESQQTLTRTFKNYFDVPPHKYR-----
MARA_SALTY      YGFESQQTLTRTFKNYFDVPPHKYR-----
MARA_SALTI      YGFESQQTLTRTFKNYFDVPPHKYR-----
MARA_SALEN      YGFESQQTLTRTFKNYFDVPPHKYR-----
MARA_ECOLI      YGFESQQTLTRTFKNYFDVPPHKYR-----
MARA_ECO57      YGFESQQTLTRTFKNYFDVPPHKYR-----
Y223_STAAM      VGFSEYKMFSYHFKKYLQMSPSDYCK----
Y217_STAA3      VGFSEYKMFSYHFKKYLQMSPSDYCK----
Y215_STAAN      VGFSEYKMFSYHFKKYLQMSPSDYCK----
Y201_STAAC      VGFSEYKMFSYHFKKYLQMSPSDYCK----
Y198_STAAW      VGFSEYKMFSYHFKKYLQMSPSDYCK----
Y198_STAAS      VGFSEYKMFSYHFKKYLQMSPSDYCK----
Y184_STAA8      VGFSEYKMFSYHFKKYLQMSPSDYCK----
RHAR_SHIBS      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ENTS8      CGFEDSNYFSVVFTRETGVTPRVWRQ----
RHAR_ECOL6      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECOL5      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECO24      CGFEDSNYFSVVFTRETGMTPSQWR-----
VQSM_PSEAE      LGYSETASFRHAFRRWTGQSTTEFRNSF--
RHAR_SHIFL      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SHIF8      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_SHIDS      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECOUT      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECOLI      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECOK1      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECOHS      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECOBW      CGFEDSNYFSVVFTRETGMTPSQWR-----
RHAR_ECO57      CGFEDSNYFSVVFTRETGMTPSQWR-----
Y214_STAAR      VGFSEYKMFSYHFKKYLQMSPSDYCK----
XYLS4_PSEPU     YGFFHTGRFAENYRSTFGELPSD-------
XYLS3_PSEPU     YGFFHTGRFAENYRSTFGELPSD-------
RHAR_PECCP      CGFEDSNYFSVVFHQAFGVSPSAYRQRF--
Y161_STAAB      VGFSEYKMFSYHFKKYLQMAPSDYCK----
RHAR_ERWCT      CGFEDSNYFSVVFHQAFGVSPSAYRQRF--
RIPA_CORGL      VGFAATSSLTRAFRRHTGATPSTF------
RHRA_RHIME      VGFNDLSYFNRTFRSRYGVRPSDLRR----
THCR_RHOER      WGFLHVGRFAGEYKQTFGVSPSE-------
GADX_SHIFL      CGYHSVSYFIYVFRNYYGMTPTEYQE----
GADX_ECOLI      CGYHSVSYFIYVFRNYYGMTPTEYQE----
GADX_ECO57      CGYHSVSYFIYVFRNYYGMTPTEYQE----