[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50098.1

[Show Plain Result]


## Summary of Sequence Search
    1::307
    2::198     4e-17  38%  280 aa  Y368_RICPR RecName: Full=Uncharacterized protein RP368;
  141::226     3e-06  26%  333 aa  LSRC_PHOTE RecName: Full=Autoinducer 2 import system permease
  141::226     4e-06  27%  351 aa  LSRC_YERPP RecName: Full=Autoinducer 2 import system permease
  141::226     4e-06  27%  351 aa  LSRC_YERPN RecName: Full=Autoinducer 2 import system permease
  141::226     4e-06  27%  351 aa  LSRC_YERPG RecName: Full=Autoinducer 2 import system permease
  141::226     4e-06  27%  351 aa  LSRC_YERPE RecName: Full=Autoinducer 2 import system permease
  141::226     4e-06  27%  351 aa  LSRC_YERPA RecName: Full=Autoinducer 2 import system permease
  141::226     5e-06  27%  351 aa  LSRC_YERPY RecName: Full=Autoinducer 2 import system permease
  141::226     5e-06  27%  351 aa  LSRC_YERPS RecName: Full=Autoinducer 2 import system permease
  141::226     5e-06  27%  351 aa  LSRC_YERPB RecName: Full=Autoinducer 2 import system permease
  191::290     9e-06  28%  323 aa  RBSC_HAEIN RecName: Full=Ribose transport system permease protein
  147::232     1e-05  37%  360 aa  LSRC_YERE8 RecName: Full=Autoinducer 2 import system permease
  180::226     2e-05  43%  351 aa  LSRC_YERP3 RecName: Full=Autoinducer 2 import system permease
  141::226     2e-05  24%  342 aa  LSRC_ECOLI RecName: Full=Autoinducer 2 import system permease
  143::226     2e-05  36%  342 aa  LSRC_ECOLC RecName: Full=Autoinducer 2 import system permease
  143::226     2e-05  36%  342 aa  LSRC_ECOHS RecName: Full=Autoinducer 2 import system permease
  141::226     2e-05  24%  342 aa  LSRC_ECODH RecName: Full=Autoinducer 2 import system permease
  141::226     2e-05  24%  342 aa  LSRC_ECO57 RecName: Full=Autoinducer 2 import system permease
  141::226     2e-05  23%  342 aa  LSRC_SHIFL RecName: Full=Autoinducer 2 import system permease
  141::226     2e-05  23%  342 aa  LSRC_SHIF8 RecName: Full=Autoinducer 2 import system permease
  179::226     3e-05  40%  333 aa  LSRC_PHOLL RecName: Full=Autoinducer 2 import system permease
  143::226     5e-05  35%  342 aa  LSRC_ECOSM RecName: Full=Autoinducer 2 import system permease
  179::226     8e-05  40%  331 aa  LSRC_PHOLU RecName: Full=Autoinducer 2 import system permease
  183::226     5e-04  39%  347 aa  LSRC_SALTY RecName: Full=Autoinducer 2 import system permease
  183::226     5e-04  39%  347 aa  LSRC_SALTI RecName: Full=Autoinducer 2 import system permease
  182::225     5e-04  39%  346 aa  LSRC_SALPB RecName: Full=Autoinducer 2 import system permease
  183::226     5e-04  39%  347 aa  LSRC_SALPA RecName: Full=Autoinducer 2 import system permease
  140::225     5e-04  23%  343 aa  LSRC_ENT38 RecName: Full=Autoinducer 2 import system permease
    1::307

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxSIWLGVLEQGLLWGVMVLGVYITFRVLDFPDLTVDGSFTLGAAVAARMIIEGQDPWXXXXXXXXXXX
Y368_RICPR      ---NILITALEQSLIMLPLILGMYISYRILKITDLTVDGTYVLGAAVFARTIPFGL--FHALIFAIIAGG
LSRC_PHOTE      ----------------------------------------------------------------------
LSRC_YERPP      ----------------------------------------------------------------------
LSRC_YERPN      ----------------------------------------------------------------------
LSRC_YERPG      ----------------------------------------------------------------------
LSRC_YERPE      ----------------------------------------------------------------------
LSRC_YERPA      ----------------------------------------------------------------------
LSRC_YERPY      ----------------------------------------------------------------------
LSRC_YERPS      ----------------------------------------------------------------------
LSRC_YERPB      ----------------------------------------------------------------------
RBSC_HAEIN      ----------------------------------------------------------------------
LSRC_YERE8      ----------------------------------------------------------------------
LSRC_YERP3      ----------------------------------------------------------------------
LSRC_ECOLI      ----------------------------------------------------------------------
LSRC_ECOLC      ----------------------------------------------------------------------
LSRC_ECOHS      ----------------------------------------------------------------------
LSRC_ECODH      ----------------------------------------------------------------------
LSRC_ECO57      ----------------------------------------------------------------------
LSRC_SHIFL      ----------------------------------------------------------------------
LSRC_SHIF8      ----------------------------------------------------------------------
LSRC_PHOLL      ----------------------------------------------------------------------
LSRC_ECOSM      ----------------------------------------------------------------------
LSRC_PHOLU      ----------------------------------------------------------------------
LSRC_SALTY      ----------------------------------------------------------------------
LSRC_SALTI      ----------------------------------------------------------------------
LSRC_SALPB      ----------------------------------------------------------------------
LSRC_SALPA      ----------------------------------------------------------------------
LSRC_ENT38      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXNTRLRIAPLLSGILMMIALYSINLRVMGNKSMISLLRMDNIYTDVANIGVPAGMAVLTFGL
Y368_RICPR      INGSIVSFMQRNKRINGLIAGILANFMLYSVNLQIM-QRPNISVLGMPTLLSDLDNWLVP--------XX
LSRC_PHOTE      ----------------------------------------------IEGLPDELKSLSAPLWLNISPIGW
LSRC_YERPP      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERPN      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERPG      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERPE      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERPA      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERPY      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERPS      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERPB      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
RBSC_HAEIN      ----------------------------------------------------------------------
LSRC_YERE8      ----------------------------------------------IEGLPADLKSLSTPILFSISPIGW
LSRC_YERP3      ----------------------------------------------------------------------
LSRC_ECOLI      ----------------------------------------------IEGLPAELKQLSAPLLLGVSAIGW
LSRC_ECOLC      ---------------------------------------------------------GLPAELAPLLFGV
LSRC_ECOHS      ---------------------------------------------------------GLPAELAPLLFGV
LSRC_ECODH      ----------------------------------------------IEGLPAELKQLSAPLLLGVSAIGW
LSRC_ECO57      ----------------------------------------------IEGLPAELKQLSAPLLLGVSAIGW
LSRC_SHIFL      ----------------------------------------------IEGLPAELKQLSAPLLLGISAIGW
LSRC_SHIF8      ----------------------------------------------IEGLPAELKQLSAPLLLGISAIGW
LSRC_PHOLL      ----------------------------------------------------------------------
LSRC_ECOSM      ---------------------------------------------------------GLPAELAPLLFGV
LSRC_PHOLU      ----------------------------------------------------------------------
LSRC_SALTY      ----------------------------------------------------------------------
LSRC_SALTI      ----------------------------------------------------------------------
LSRC_SALPB      ----------------------------------------------------------------------
LSRC_SALPA      ----------------------------------------------------------------------
LSRC_ENT38      ----------------------------------------------IEGLPSSLKSLSEPVALGVSPLGM


                         +         .         .         .         .         *         .:210
query           VXXXXXXXXXXAFLQTEIGMALRATGDNEQMIRSLGVNTNSTKILGLSMGNALVAMSGALVAQYQSYSDX
Y368_RICPR      XXXXXXXXXXXXXXXXXXXXXXRAFGFNKDLLIDLGKPAELYRMLGLSISNGLAALTGTLSAQVNGFAD-
LSRC_PHOTE      LLMILVLAMAWILAKTAFGRGFYATGDNLQGARQLGVRTNSIRIIAFSVNGVMAALAGIVFA--------
LSRC_YERPP      LTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLRIFAFSMNGVMAALAGIVFA--------
LSRC_YERPN      LTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLRIFAFSMNGVMAALAGIVFA--------
LSRC_YERPG      LTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLRIFAFSMNGVMAALAGIVFA--------
LSRC_YERPE      LTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLRIFAFSMNGVMAALAGIVFA--------
LSRC_YERPA      LTMLLILAMAWLLGKTAFGRSFYATGDNLQGARQLGVRTDSLRIFAFSMNGVMAALAGIVFA--------
LSRC_YERPY      LTMLLILAMAWLLGNTAFGRSFYATGDNLQGARQLGVRTDSIRIFAFSMNGVMAALAGIVFA--------
LSRC_YERPS      LTMLLILSMAWLLGNTAFGRSFYATGDNLQGARQLGVRTDSIRIFAFSMNGVMAALAGIVFA--------
LSRC_YERPB      LTMLLILSMAWLLGNTAFGRSFYATGDNLQGARQLGVRTDSIRIFAFSMNGVMAALAGIVFA--------
RBSC_HAEIN      ---------------TPIGRYIYALGGNEAATQLSGINVNKIKVFVFAVSGFLSALAGLIVTSRLSSAQP
LSRC_YERE8      XXXXXXXXXXXXXGKTAFGRSFYATGDNLQGARQLGIRTDSIRIFAFSMNGVMAALAGIVFA--------
LSRC_YERP3      ---------------TAFGRSFYATGDNLQGARQLGVRTDSIRIFAFSMNGVMAALAGIVFA--------
LSRC_ECOLI      LTIILVAFMAWLLAKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_ECOLC      SAIGWLTIILVAFMKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_ECOHS      SAIGWLTIILVAFMKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_ECODH      LTIILVAFMAWLLAKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_ECO57      LTIILVAFMAWLLAKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_SHIFL      LTIILVAFMAWLLAKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_SHIF8      LTIILVAFMAWLLAKTAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_PHOLL      --------------KTPFGRSFYATGDNLQGARQLGVRTDSIQIIAFSVNGVMAALAGIVFA--------
LSRC_ECOSM      SAIGWLTIILVAFMKTAFGRSFYVTGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFA--------
LSRC_PHOLU      --------------KTTFGRNFYATGDNLQGARQLGVRTDSIQIIAFSVNGIMAALAGIVFA--------
LSRC_SALTY      ------------------GRNFYATGDNLQGARQLGVRTEMVRIMAFSLNGGMAALAGIVFA--------
LSRC_SALTI      ------------------GRNFYATGDNLQGARQLGVRTEMVRIMAFSLNGGMAALAGIVFA--------
LSRC_SALPB      ------------------GRNFYATGDNLQGARQLGVRTEMVRIMAFSLNGGMAALAGIVFA--------
LSRC_SALPA      ------------------GRNFYATGDNLQGARQLGVRTEMVRIMAFSLNGGMAALAGIVFA--------
LSRC_ENT38      AVLFLVLIGAWTLSRTVSGRDFYAVGDNLAAARQLGVAVNRTRMLAFTINGMLAACAGIVFA--------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXLASVIVGEVVIGKRTLLRTLVAVLIGSIIYRAVxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y368_RICPR      ----------------------------------------------------------------------
LSRC_PHOTE      ----------------------------------------------------------------------
LSRC_YERPP      ----------------------------------------------------------------------
LSRC_YERPN      ----------------------------------------------------------------------
LSRC_YERPG      ----------------------------------------------------------------------
LSRC_YERPE      ----------------------------------------------------------------------
LSRC_YERPA      ----------------------------------------------------------------------
LSRC_YERPY      ----------------------------------------------------------------------
LSRC_YERPS      ----------------------------------------------------------------------
LSRC_YERPB      ----------------------------------------------------------------------
RBSC_HAEIN      TAGVSYELDAIAAVVVGSLMGGKGRVMGTLIGALIIGFLNNAL---------------------------
LSRC_YERE8      ----------------------------------------------------------------------
LSRC_YERP3      ----------------------------------------------------------------------
LSRC_ECOLI      ----------------------------------------------------------------------
LSRC_ECOLC      ----------------------------------------------------------------------
LSRC_ECOHS      ----------------------------------------------------------------------
LSRC_ECODH      ----------------------------------------------------------------------
LSRC_ECO57      ----------------------------------------------------------------------
LSRC_SHIFL      ----------------------------------------------------------------------
LSRC_SHIF8      ----------------------------------------------------------------------
LSRC_PHOLL      ----------------------------------------------------------------------
LSRC_ECOSM      ----------------------------------------------------------------------
LSRC_PHOLU      ----------------------------------------------------------------------
LSRC_SALTY      ----------------------------------------------------------------------
LSRC_SALTI      ----------------------------------------------------------------------
LSRC_SALPB      ----------------------------------------------------------------------
LSRC_SALPA      ----------------------------------------------------------------------
LSRC_ENT38      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
Y368_RICPR      ---------------------------
LSRC_PHOTE      ---------------------------
LSRC_YERPP      ---------------------------
LSRC_YERPN      ---------------------------
LSRC_YERPG      ---------------------------
LSRC_YERPE      ---------------------------
LSRC_YERPA      ---------------------------
LSRC_YERPY      ---------------------------
LSRC_YERPS      ---------------------------
LSRC_YERPB      ---------------------------
RBSC_HAEIN      ---------------------------
LSRC_YERE8      ---------------------------
LSRC_YERP3      ---------------------------
LSRC_ECOLI      ---------------------------
LSRC_ECOLC      ---------------------------
LSRC_ECOHS      ---------------------------
LSRC_ECODH      ---------------------------
LSRC_ECO57      ---------------------------
LSRC_SHIFL      ---------------------------
LSRC_SHIF8      ---------------------------
LSRC_PHOLL      ---------------------------
LSRC_ECOSM      ---------------------------
LSRC_PHOLU      ---------------------------
LSRC_SALTY      ---------------------------
LSRC_SALTI      ---------------------------
LSRC_SALPB      ---------------------------
LSRC_SALPA      ---------------------------
LSRC_ENT38      ---------------------------