[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50103.1

[Show Plain Result]


## Summary of Sequence Search
    1::254
   29::270     4e-37  32%  276 aa  SSUC_BACSU RecName: Full=Putative aliphatic sulfonates transport
   22::246     8e-32  33%  250 aa  Y3648_BRUA2 RecName: Full=Probable ABC transporter permease protein
   22::246     8e-32  33%  250 aa  Y3424_BRUAB RecName: Full=Probable ABC transporter permease protein
   22::246     8e-32  33%  246 aa  Y3107_BRUME RecName: Full=Probable ABC transporter permease protein
   22::246     1e-31  33%  250 aa  Y4188_BRUSU RecName: Full=Probable ABC transporter permease protein
   33::273     2e-31  29%  275 aa  TAUC_ECOLI RecName: Full=Taurine transport system permease protein
   23::249     8e-30  32%  267 aa  Y413_METJA RecName: Full=Putative ABC transporter permease protein
   17::239     1e-29  30%  263 aa  SSUC_ECOLI RecName: Full=Putative aliphatic sulfonates transport
   76::275     3e-21  31%  279 aa  NRTB_SYNE7 RecName: Full=Nitrate transport permease protein nrtB;
   34::271     1e-17  32%  275 aa  NRTB_SYNY3 RecName: Full=Nitrate transport permease protein nrtB;
   89::264     1e-17  28%  278 aa  CMPB_SYNP6 RecName: Full=Bicarbonate transport system permease
   89::264     1e-17  28%  278 aa  CMPB_SYNE7 RecName: Full=Bicarbonate transport system permease
   38::253     6e-16  26%  279 aa  NRTB_PHOLA RecName: Full=Nitrate transport permease protein nrtB;
   17::223     1e-13  21%  245 aa  Y355_HAEIN RecName: Full=Probable ABC transporter permease protein
   40::266     1e-12  27%  280 aa  CMPB_SYNY3 RecName: Full=Bicarbonate transport system permease
   41::254     3e-12  23%  270 aa  YTLD_BACSU RecName: Full=Uncharacterized ABC transporter permease
  147::295     8e-11  26%  354 aa  PROW_SALTY RecName: Full=Glycine betaine/L-proline transport system
   78::196     2e-10  32%  217 aa  OPUCB_BACSU RecName: Full=Glycine betaine/carnitine/choline
   78::213     4e-10  29%  217 aa  OPUBB_BACSU RecName: Full=Choline transport system permease protein
  160::295     9e-10  26%  354 aa  PROW_ECOLI RecName: Full=Glycine betaine/L-proline transport system
   24::219     4e-08  27%  229 aa  OPUCD_BACSU RecName: Full=Glycine betaine/carnitine/choline
   24::216     1e-06  27%  226 aa  OPUBD_BACSU RecName: Full=Choline transport system permease protein
  125::242     8e-05  20%  282 aa  OPUAB_BACSU RecName: Full=Glycine betaine transport system permease
    1::254

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxYLKGFVIPFVILILWLIGSATESINQYIIPPPTKVLQTALDLTASGILLKHITISLYRVFAGFLLTVL
SSUC_BACSU      --WMKGLLLPAVIIAIWQVIGGLGVVSAXXXXXXXXXXXXFKELILSGELFGHLQISIYRXXXXXXXXXX
Y3648_BRUA2     ----------------WYLLTATGAV---VLPGPVDVLERAVTLLLNGQLVGDIFASLRRVLSGFVLGVA
Y3424_BRUAB     ----------------WYLLTATGAV---VLPGPVDVLERAVTLLLNGQLVGDIFASLRRVLSGFVLGVA
Y3107_BRUME     ----------------WYLLTATGAV---VLPGPVDVLERAVTLLLNGQLVGDIFASLRRVLSGFVLGVA
Y4188_BRUSU     ----------------WYLLTATGAV---VLPGPVDVLERAVTLLLNGQLVGDIFASLRRVLSGFVLGVA
TAUC_ECOLI      -----------VLLTVWWTVATLQLISPLFLPPPQQVLEKLLTIAGDATLWQHLAASLTRIMLALFAAVL
Y413_METJA      --------LPALAVVIWEL-LAIYINNPVILPRVEAVINVLIHILGTGSLIDNTIISIKRVISGFLLASA
SSUC_ECOLI      --------LPVGIVAVWQLASSVGWLSTRILPSPEGVVTAFWTLSASGELWQHLAISSWRAXXXXXXXXX
NRTB_SYNE7      --------------------------------------------TSKGLGLQ-ILISLQRVAIGYLLAAC
NRTB_SYNY3      -----------VLLVVWQILCSGEGSN---LPSPVQVLEQTYPLTDKGLGIQ-IFASLTRXXXXXXXXXX
CMPB_SYNP6      --------------------------------------------------------SLTRVAQGFXXXXX
CMPB_SYNE7      --------------------------------------------------------SLTRVAQGFXXXXX
NRTB_PHOLA      ----------FVLLGIWQLLCSGENA----ACRPIQVVQESWDLIGSGTLFWQIAASLQRVAVGYLMXXX
Y355_HAEIN      --------------MIWQMVATLGSFPHYIFPSPQAVRQQLF--THAELLWQHTQVTXXXXXXXXXXXXX
CMPB_SYNY3      -------------LLLWQLISSAGLIK---LPPPTRTLLMYPFYDQGGLLFWQTLASLGRVAQGYSLAAI
YTLD_BACSU      ----------------WEISSRQGWIDPLIFSSPSAVWRXXXXXXXXXXXXXHIGVTLFETVLGFLLGTF
PROW_SALTY      -------------------------------------------------------ITLALVLTALLFCVV
OPUCB_BACSU     ----------------------------------------------------------------------
OPUBB_BACSU     ----------------------------------------------------------------------
PROW_ECOLI      --------------------------------------------------------------------IV
OPUCD_BACSU     ---------------------------------------------------RHFLMSVY----GVLFAAI
OPUBD_BACSU     ---------------------------------------------------RHFLMSAY----GVLFAAV
OPUAB_BACSU     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FAFPLAILVGINQRLAPYIDPVLDFLGHXXXXXXXXXXXXWFGIGETSKLAVIILATFFPVFLNTLNGIL
SSUC_BACSU      XXXXXXXXXXXSKRTELYLDPSLQMLRTVPHLAVTPLFILWFGFDEVSKILLIALGAFFPVYINTFNGIR
Y3648_BRUA2     LAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESPKIFVIFLASFLSSVVATYQGVI
Y3424_BRUAB     LAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESPKIFVIFLASFLSSVVATYQGVI
Y3107_BRUME     LAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESPKIFVIFLASFLSSVVATYQGVI
Y4188_BRUSU     LAIPVGFLMGWYRIARSPIEPWVQFFRMIPPLAVIPLAIVTLGIDESPKIFVIFLASFLSSVVATYQGVI
TAUC_ECOLI      FGIPVGIAMGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVK
Y413_METJA      VAIPLGILMGYYRTVNSLCDTLIELLRPIPPLAWVPLSLAWFGLGEMSMXXXXXXXXXXXXXXNTISGVK
SSUC_ECOLI      XXXXXXXXXXXXRWGERLLDTSIQMLRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYINTWHGIR
NRTB_SYNE7      TGILVGGVLGMSKFLGKGLDPVIQVLRTVPPLAWFPISLMVFQDANTSAIFVIFITAIWPIIINTAVGIN
NRTB_SYNY3      XXXXLGILIGSSKFMYDALDPIFQVLRTXXXXXXXXXXXXXXQEAEPSAIFVIFITAIWPIVINTTVGAQ
CMPB_SYNP6      XXXXXXXXXXXNRQLNAMLDPLFQFLRMIAPLAWVPIALVAFQQNQPAAIFVIFITAVWPILINTAEGVR
CMPB_SYNE7      XXXXXXXXXXXNRQLNAMLDPLFQFLRMIAPLAWVPIALVAFQQNQPAAIFVIFITAVWPILINTAEGVR
NRTB_PHOLA      XXXXXXXXXXVSVLMFQALDPIFQVLRTVPPLAWLPISLAAFRDSQPAAIFVIFITAIWPIIINTAVGVQ
Y355_HAEIN      XXXXXXXXXXXXRQISAVLLPILVISQAIPVFAIAPLLVLWFGYGMASKIVMSVLIIYFPVTAACYDGLR
CMPB_SYNY3      VGISTGILVGTQPLLDKALDPIFQFLRMVAPLAWVPIALVALQQNQPAAIFVIFITSVWPILINTTEGVK
YTLD_BACSU      MGTCLAALLWWSNRLARILDPYLVILNAMPKVALGPILIVALGPSFXXXXXXXXXXXXXXXXXXXXXAFQ
PROW_SALTY      IGLPMGIWLARSPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIN
OPUCB_BACSU     ------------------------------------------GVGKVPAIVALFFYSVLPILRNTYTGIK
OPUBB_BACSU     ------------------------------------------GVGKVPAIVALFFYSVLPILRNTYTGIR
PROW_ECOLI      IGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIN
OPUCD_BACSU     VGIPLGILIARYRRLSGWVFAVTNVIQTIPXXXXXXXXXXXXXXXXNTVILSLFLYSLLPIIRNTYTGII
OPUBD_BACSU     VGVPAGILIAHFRRLSAWVFAVTNVIQTIPXXXXXXXXXXXXXXXXNTVILSLFLYSLLPIIRNTYTGII
OPUAB_BACSU     ------------------VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIK


                         +         .         .         .         .         *         .:210
query           GCNKQLLEVGDVFGFTARDKFLRIVIPAALPSIIVGFRLGLGYSWRSLIGAELIAASSGIGYMIIDAEQL
SSUC_BACSU      GVDAKLFEVARVLEFKWHQQISKVILPAALPNILLGIRLSLGIAWLGLVVAELMGSSSGVGYMIMDARQF
Y3648_BRUA2     SVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVRIGLGSAWATVVAAELIAAQSGLGYRMQQAQLY
Y3424_BRUAB     SVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVRIGLGSAWATVVAAELIAAQSGLGYRMQQAQLY
Y3107_BRUME     SVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVRIGLGSAWATVVAAELIAAQSGLGYRMQQAQLY
Y4188_BRUSU     SVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVRIGLGSAWATVVAAELIAAQSGLGYRMQQAQLY
TAUC_ECOLI      SVQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEF
Y413_METJA      GVPTPLIEAALTLGAKGRDILIKVVIPASSPSILTGLRVGAGIAWMCVVAAEMLPSSAGLGYLIMYAYSL
SSUC_ECOLI      NIDRGLVEMARSYGLSGIPLFIHVILPGALPSIMVGVRFALGLMWLTLIVAETISANSGIGYLAMNAREF
NRTB_SYNE7      QIPDDYNNVARVLKLSKKDYILNILIPSTVPYVFAGLRIAVGLAWLAIVAAEMLKADGGIGYFIWDAYNA
NRTB_SYNY3      QVPQDYRNVSRVLKLSKSQYFFNILFPAAVPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAYNX
CMPB_SYNP6      QIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMSGVGIGFFIWDAYQQ
CMPB_SYNE7      QIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMSGVGIGFFIWDAYQQ
NRTB_PHOLA      NIPQDYNNVARVLKLSRLDYFLKVLLPATVPYIFTGLKIAIGLSWLAIVAAEMLTGGVGIGFFIWDAYNS
Y355_HAEIN      NTPQAWLDLAKTFNISPLRLLLKVRLPAALPAFASGLRIAVSVAPIGAVVGEWVGSSEGLGYLMIHANAR
CMPB_SYNY3      QIPQDYINVRKVLRLSPQKFFFKILIPSALPYIFTGXXXXXXXXXXXXXXXXXVMSGVGIGFFIWDAYQQ
YTLD_BACSU      EVDENYTKVMKTFGAKKWVIFKEVILPASSPAIISTLKVNVGLSWVGVIVGEFLVSKVGLGYMIIYGFQV
PROW_SALTY      QVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAV-GGLGQMVL-----
OPUCB_BACSU     GVNKNLLESGKGIGMTGWEQIRLVEIPLAIPIIMAGIRTSTIY----LIGWATLASXXXXXXXXXXXXNL
OPUBB_BACSU     GVNKNLLESGKGIGMTPAEQVRLVELPLAAPVIMAGIRTSTIY----LIGWATLASXXXXXXXXXXXXNL
PROW_ECOLI      QVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAV-GGLGQMVL-----
OPUCD_BACSU     SIEHAYLESGKAMGMTKFQVLRMVELPLALSVIMAGLRTALVIA-IGITAIGTFVGAGGLGDIIVRGSNA
OPUBD_BACSU     SIEHAYLESGKAMGMTKFQVLRMVELPLALSVIMAGLRTALVIA-IGITAIGTFVGAGGLGDMIVRGSNA
OPUAB_BACSU     QVPADLIEATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGA-PGLGSEVYSA---


                         .         .         .         +         .         .         .:280
query           SRPDIIIVGILTIGLFGYIIDYCFFKLTNHLIPWAGKRVSYxxx
SSUC_BACSU      SQTNKVFAGIIIFAVVGKLTDSFVRLLERKLLKW----------
Y3648_BRUA2     YDLPTIFVSLVTIGILGLFMDRLLQAADRRLTQW----------
Y3424_BRUAB     YDLPTIFVSLVTIGILGLFMDRLLQAADRRLTQW----------
Y3107_BRUME     YDLPTIFVSLVTIGILGLFMDRLLQAADRRLTQW----------
Y4188_BRUSU     YDLPTIFVSLVTIGILGLFMDRLLQAADRRLTQW----------
TAUC_ECOLI      LATDXXXXXXXXXXXXXXXXXXGLRALQRRLTPWHGE-------
Y413_METJA      SRMDVVIACMIIIGLIGLVLD-----------------------
SSUC_ECOLI      LQTDXXXXAIILYALLGKLAD-----------------------
NRTB_SYNE7      GSSSQIILAIFYVGLVGLSLD--------RLVAWVGRLVS----
NRTB_SYNY3      XXXXXXXXXXXYVGIVGLLLDRFIAFLESLVVP-----------
CMPB_SYNP6      NYVSDIILAVIYIGAVGLLLD-----------------------
CMPB_SYNE7      NYVSDIILAVIYIGAVGLLLD-----------------------
NRTB_PHOLA      GSNSEVILAII---------------------------------
Y355_HAEIN      MQVDLMFAALLIL-------------------------------
CMPB_SYNY3      NYISEIILAVFYIGAVGLLLD-----------------------
YTLD_BACSU      FNFTLVFLSLLIIAIFATLM------------------------
PROW_SALTY      --------------------------------------------
OPUCB_BACSU     YQPEYIIGGAVPVTILAIIIDY----------------------
OPUBB_BACSU     YQPEYIIGGAVPVTILAIVIDYVLAVAERKLTPAGMQRL-----
PROW_ECOLI      --------------------------------------------
OPUCD_BACSU     TNTAIILAGAIPTALMAVIADLVMGWLERALSPIKKKKGNF---
OPUBD_BACSU     TNTAIILAGAIPTAVMAVGADLLMAWLERALSPVKKKR------
OPUAB_BACSU     --------------------------------------------