[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50205.1

[Show Plain Result]


## Summary of Sequence Search
    1::474
    8::376     7e-83  46%  422 aa  YITG_BACSU RecName: Full=Uncharacterized MFS-type transporter yitG;
    6::162     2e-28  39%  194 aa  BBEX_BACSU RecName: Full=Bacillibactin exporter;
    4::111     1e-25  63%  124 aa  YMFD_BACSU RecName: Full=Uncharacterized MFS-type transporter ymfD;
   22::360     3e-15  26%  396 aa  YFMO_BACSU RecName: Full=Multidrug efflux protein yfmO;
   21::142     2e-13  33%  400 aa  BMR2_BACSU RecName: Full=Multidrug resistance protein 2;AltName:
    1::156     2e-12  29%  395 aa  MDTL_SALTI RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALSV RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALPK RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALPA RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALEP RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALDC RecName: Full=Multidrug resistance protein mdtL;
   13::156     2e-12  32%  395 aa  MDTL_SALAR RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALTY RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALPC RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALPB RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALNS RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALHS RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALCH RecName: Full=Multidrug resistance protein mdtL;
    1::156     2e-12  29%  395 aa  MDTL_SALA4 RecName: Full=Multidrug resistance protein mdtL;
   23::361     6e-12  27%  454 aa  YAJR_ECOLI RecName: Full=Inner membrane transport protein yajR;
    1::197     2e-11  29%  391 aa  MDTL_ECOUT RecName: Full=Multidrug resistance protein mdtL;
    1::197     2e-11  29%  391 aa  MDTL_ECOK1 RecName: Full=Multidrug resistance protein mdtL;
    1::197     2e-11  29%  391 aa  MDTL_ECO45 RecName: Full=Multidrug resistance protein mdtL;
    1::197     2e-11  29%  391 aa  MDTL_ECO27 RecName: Full=Multidrug resistance protein mdtL;
   36::173     3e-11  33%  514 aa  QACA_STAAU RecName: Full=Antiseptic resistance protein;
   36::173     3e-11  33%  514 aa  QACA_STAAM RecName: Full=Antiseptic resistance protein;
    1::156     4e-11  30%  391 aa  MDTL_SHISS RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_SHIFL RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_SHIDS RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_SHIBS RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_SHIB3 RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ESCF3 RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOSM RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOSE RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOLU RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOLI RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOLC RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOL6 RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOL5 RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOHS RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECODH RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECOBW RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECO8A RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECO81 RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECO7I RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECO5E RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECO57 RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECO55 RecName: Full=Multidrug resistance protein mdtL;
    1::156     4e-11  30%  391 aa  MDTL_ECO24 RecName: Full=Multidrug resistance protein mdtL;
    1::156     7e-11  30%  391 aa  MDTL_SHIF8 RecName: Full=Multidrug resistance protein mdtL;
   24::362     2e-10  22%  403 aa  YVMA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvmA;
   26::156     2e-10  31%  396 aa  MDTL_VIBPA RecName: Full=Multidrug resistance protein mdtL;
   17::153     3e-10  33%  390 aa  Y466_BUCAI RecName: Full=Uncharacterized transporter BU466;
    2::155     3e-10  29%  399 aa  TCR1_ECOLX RecName: Full=Tetracycline resistance protein, class A; 
   21::138     4e-10  31%  389 aa  BMR1_BACSU RecName: Full=Multidrug resistance protein 1;AltName:
    2::160     6e-10  25%  518 aa  YFIU_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiU;
    3::156     6e-10  37%  396 aa  MDTL_SHEON RecName: Full=Multidrug resistance protein mdtL;
    2::167     7e-10  25%  472 aa  YCNB_BACSU RecName: Full=Uncharacterized MFS-type transporter ycnB;
   20::183     7e-10  22%  466 aa  MDTD_PECCP RecName: Full=Putative multidrug resistance protein
    1::156     1e-09  30%  392 aa  MDTL_KLEP3 RecName: Full=Multidrug resistance protein mdtL;
   10::156     1e-09  36%  396 aa  MDTL_SHESA RecName: Full=Multidrug resistance protein mdtL;
    8::120     6e-09  32%  475 aa  HSRA_ECOLI RecName: Full=Probable transport protein hsrA;AltName:
   13::156     8e-09  33%  390 aa  MDTL_CITK8 RecName: Full=Multidrug resistance protein mdtL;
   33::317     1e-08  25%  453 aa  YJJL_ECOLI RecName: Full=Inner membrane transport protein yjjL;
    2::154     2e-08  24%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
    1::156     2e-08  29%  392 aa  MDTL_KLEP7 RecName: Full=Multidrug resistance protein mdtL;
   17::160     2e-08  20%  469 aa  MDTD_YERE8 RecName: Full=Putative multidrug resistance protein
   35::207     3e-08  27%  498 aa  SPNS3_DANRE RecName: Full=Protein spinster homolog 3;AltName:
   82::267     4e-08  31%  526 aa  SPNS1_XENLA RecName: Full=Protein spinster homolog 1;
   22::165     7e-08  19%  477 aa  MDTD_SERP5 RecName: Full=Putative multidrug resistance protein
   64::355     1e-07  22%  396 aa  YWOG_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoG;
   27::168     1e-07  24%  458 aa  TCRB_BACSU RecName: Full=Tetracycline resistance protein;
  115::257     1e-07  27%  605 aa  SPIN_DROME RecName: Full=Protein spinster;AltName: Full=Protein
   21::164     1e-07  19%  465 aa  MDTD_YERPY RecName: Full=Putative multidrug resistance protein
   21::164     1e-07  19%  465 aa  MDTD_YERPP RecName: Full=Putative multidrug resistance protein
   21::164     1e-07  19%  465 aa  MDTD_YERPN RecName: Full=Putative multidrug resistance protein
   21::164     1e-07  19%  465 aa  MDTD_YERPG RecName: Full=Putative multidrug resistance protein
   21::164     1e-07  19%  465 aa  MDTD_YERPE RecName: Full=Putative multidrug resistance protein
   21::164     1e-07  19%  465 aa  MDTD_YERPB RecName: Full=Putative multidrug resistance protein
   21::164     1e-07  19%  465 aa  MDTD_YERPA RecName: Full=Putative multidrug resistance protein
   21::164     1e-07  19%  465 aa  MDTD_YERP3 RecName: Full=Putative multidrug resistance protein
   81::201     2e-07  29%  515 aa  YO378_YEAST RecName: Full=Drug resistance protein YOR378W;
   47::270     2e-07  24%  513 aa  SPNS2_XENTR RecName: Full=Protein spinster homolog 2;
   28::165     2e-07  31%  405 aa  PMRA_LACLA RecName: Full=Multi-drug resistance efflux pump pmrA
   21::164     2e-07  19%  465 aa  MDTD_YERPS RecName: Full=Putative multidrug resistance protein
   20::117     2e-07  28%  466 aa  MDTD_ERWCT RecName: Full=Putative multidrug resistance protein
   13::215     2e-07  28%  398 aa  BCR_HAEIN RecName: Full=Bicyclomycin resistance protein homolog;
    7::168     3e-07  23%  458 aa  TCR_STRPN RecName: Full=Tetracycline resistance protein;
    7::168     3e-07  23%  458 aa  TCR_STAHY RecName: Full=Tetracycline resistance protein;
    7::168     3e-07  23%  458 aa  TCR_BACSU RecName: Full=Tetracycline resistance protein;
    7::168     3e-07  23%  458 aa  TCR_BACST RecName: Full=Tetracycline resistance protein;
    7::168     3e-07  23%  458 aa  TCR_BACCE RecName: Full=Tetracycline resistance protein;
   65::208     3e-07  31%  514 aa  SPNS3_MOUSE RecName: Full=Protein spinster homolog 3;
   24::118     3e-07  28%  471 aa  MDTD_KLEP3 RecName: Full=Putative multidrug resistance protein
    2::118     3e-07  26%  471 aa  MDTD_ENTS8 RecName: Full=Putative multidrug resistance protein
    1::137     3e-07  28%  401 aa  TCR2_ECOLX RecName: Full=Tetracycline resistance protein, class B; 
   24::118     3e-07  27%  471 aa  MDTD_KLEP7 RecName: Full=Putative multidrug resistance protein
   15::261     6e-07  27%  422 aa  EXUT_BACSU RecName: Full=Hexuronate transporter;
    7::170     8e-07  24%  458 aa  TCR_STRAG RecName: Full=Tetracycline resistance protein;
   82::267     8e-07  27%  526 aa  SPNS1_XENTR RecName: Full=Protein spinster homolog 1;
   50::202     8e-07  24%  506 aa  SPNS1_DANRE RecName: Full=Protein spinster homolog 1;AltName:
   24::118     8e-07  25%  471 aa  MDTD_ENT38 RecName: Full=Putative multidrug resistance protein
    3::165     8e-07  28%  512 aa  BMR3_BACSU RecName: Full=Multidrug resistance protein 3;AltName:
  128::243     1e-06  25%  589 aa  YAN6_SCHPO RecName: Full=Uncharacterized transporter C3H1.06c;
   78::186     1e-06  31%  504 aa  SPNS2_DANRE RecName: Full=Protein spinster homolog 2;AltName:
   29::171     1e-06  23%  510 aa  EMRB_HAEIN RecName: Full=Multidrug resistance protein B homolog;
   84::221     2e-06  24%  563 aa  YIM0_YEAST RecName: Full=Uncharacterized transporter YIL120W;
   24::118     2e-06  24%  470 aa  MDTD_SALTY RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALTI RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALSV RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALPK RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALPB RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALPA RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALNS RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALHS RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALEP RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALDC RecName: Full=Putative multidrug resistance protein
   24::118     2e-06  24%  470 aa  MDTD_SALA4 RecName: Full=Putative multidrug resistance protein
   42::350     3e-06  25%  390 aa  YCEJ_BACSU RecName: Full=Uncharacterized MFS-type transporter yceJ;
    2::118     3e-06  25%  471 aa  MDTD_ECOLU RecName: Full=Putative multidrug resistance protein
   18::366     4e-06  23%  412 aa  YWFA_BACSU RecName: Full=Uncharacterized MFS-type transporter ywfA;
  128::243     4e-06  24%  589 aa  YI32_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   34::199     5e-06  22%  404 aa  YYBF_BACSU RecName: Full=Uncharacterized MFS-type transporter yybF;
   22::166     6e-06  37%  391 aa  Y450_BUCAP RecName: Full=Uncharacterized transporter BUsg_450;
  125::252     6e-06  29%  549 aa  SPNS2_MOUSE RecName: Full=Protein spinster homolog 2;
  125::252     6e-06  29%  549 aa  SPNS2_HUMAN RecName: Full=Protein spinster homolog 2;
   18::161     6e-06  23%  512 aa  EMRB_ECOLI RecName: Full=Multidrug resistance protein B;
   18::161     6e-06  23%  512 aa  EMRB_ECO57 RecName: Full=Multidrug resistance protein B;
   57::339     8e-06  21%  417 aa  YNFM_ECOLI RecName: Full=Inner membrane transport protein ynfM;
   49::204     8e-06  27%  512 aa  SPNS3_HUMAN RecName: Full=Protein spinster homolog 3;
   24::118     8e-06  25%  471 aa  MDTD_SHISS RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_SHIFL RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_SHIBS RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_SHIB3 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ESCF3 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOUT RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOSM RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOSE RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOLI RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOLC RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOL6 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOL5 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOK1 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOHS RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECODH RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECOBW RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO8A RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO81 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO7I RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO5E RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO57 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO55 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO45 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO27 RecName: Full=Putative multidrug resistance protein
   24::118     8e-06  25%  471 aa  MDTD_ECO24 RecName: Full=Putative multidrug resistance protein
  115::248     1e-05  25%  586 aa  AQR1_YEAST RecName: Full=Probable transporter AQR1;
   24::118     1e-05  24%  471 aa  MDTD_SHIF8 RecName: Full=Putative multidrug resistance protein
  180::361     1e-05  25%  398 aa  LTAA_STAS1 RecName: Full=Probable glycolipid permease ltaA;AltName:
   10::158     2e-05  26%  394 aa  Y411_BUCBP RecName: Full=Uncharacterized transporter bbp_411;
   48::179     2e-05  23%  473 aa  PHDK_NOCSK RecName: Full=Probable 1-hydroxy-2-naphthoate
   24::118     2e-05  23%  471 aa  MDTD_CITK8 RecName: Full=Putative multidrug resistance protein
   27::157     2e-05  26%  408 aa  YCXA_BACSU RecName: Full=Uncharacterized MFS-type transporter
   17::350     2e-05  24%  393 aa  TCR7_VIBAN RecName: Full=Tetracycline resistance protein, class G; 
    1::162     2e-05  31%  397 aa  LPLT_KLEP7 RecName: Full=Lysophospholipid transporter lplT;
    1::162     2e-05  31%  397 aa  LPLT_KLEP3 RecName: Full=Lysophospholipid transporter lplT;
   64::164     2e-05  27%  477 aa  BAIG_EUBSP RecName: Full=Bile acid transporter;
    5::151     3e-05  24%  403 aa  YDHC_ECOLI RecName: Full=Inner membrane transport protein ydhC;
  161::214     3e-05  35%  670 aa  SO1A1_RAT RecName: Full=Solute carrier organic anion transporter
   48::194     5e-05  23%  491 aa  YJA1_SCHPO RecName: Full=Uncharacterized transporter C1529.01;
   24::162     5e-05  28%  401 aa  YHJO_BACSU RecName: Full=Uncharacterized MFS-type transporter yhjO;
   73::145     5e-05  38%  391 aa  YFKF_BACSU RecName: Full=Uncharacterized MFS-type transporter yfkF;
    7::138     5e-05  24%  396 aa  TCR3_ECOLX RecName: Full=Tetracycline resistance protein, class C; 
  160::348     5e-05  32%  670 aa  SO1A3_RAT RecName: Full=Solute carrier organic anion transporter
  160::214     9e-05  35%  670 aa  SO1A6_MOUSE RecName: Full=Solute carrier organic anion transporter
  160::214     9e-05  35%  670 aa  SO1A5_RAT RecName: Full=Solute carrier organic anion transporter
   64::162     9e-05  31%  396 aa  LPLT_SHIFL RecName: Full=Lysophospholipid transporter lplT;
   64::162     9e-05  31%  396 aa  LPLT_SHIF8 RecName: Full=Lysophospholipid transporter lplT;
   64::162     9e-05  32%  398 aa  LPLT_CITK8 RecName: Full=Lysophospholipid transporter lplT;
   22::83      9e-05  27%  394 aa  EMRD_ECOLI RecName: Full=Multidrug resistance protein D;
   23::158     1e-04  26%  410 aa  YQJV_BACSU RecName: Full=Uncharacterized MFS-type transporter yqjV;
  140::331     1e-04  22%  580 aa  YN41_SCHPO RecName: Full=Uncharacterized transporter C36.01c;
   19::138     1e-04  23%  386 aa  Y1560_METJA RecName: Full=Uncharacterized MFS-type transporter
  160::214     1e-04  33%  670 aa  SO1A5_MOUSE RecName: Full=Solute carrier organic anion transporter
   64::162     1e-04  34%  406 aa  LPLT_YERPY RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERPS RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERPP RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERPN RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERPG RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERPE RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERPB RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERPA RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  34%  406 aa  LPLT_YERP3 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_SHISS RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_SHIDS RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_SHIBS RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_SHIB3 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOUT RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOSM RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOSE RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOLU RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOLI RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOLC RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOL6 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOL5 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOK1 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOHS RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECODH RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECOBW RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO8A RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO81 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO7I RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO5E RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO57 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO55 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO45 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO27 RecName: Full=Lysophospholipid transporter lplT;
   64::162     1e-04  31%  397 aa  LPLT_ECO24 RecName: Full=Lysophospholipid transporter lplT;
  160::214     2e-04  31%  670 aa  SO1A1_MOUSE RecName: Full=Solute carrier organic anion transporter
   25::158     2e-04  26%  399 aa  PMRA_STRR6 RecName: Full=Multi-drug resistance efflux pump pmrA;
   25::158     2e-04  26%  399 aa  PMRA_STRPN RecName: Full=Multi-drug resistance efflux pump pmrA;
   42::180     2e-04  30%  466 aa  MFSD9_MOUSE RecName: Full=Major facilitator superfamily
   64::162     2e-04  33%  398 aa  LPLT_SERP5 RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALTY RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALTI RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALSV RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALPK RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALPC RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALPB RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALPA RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALNS RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALHS RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALG2 RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALEP RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALDC RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALCH RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  34%  400 aa  LPLT_SALA4 RecName: Full=Lysophospholipid transporter lplT;
   16::169     2e-04  22%  457 aa  YEBQ_ECOLI RecName: Full=Uncharacterized transporter yebQ;
   93::271     2e-04  23%  659 aa  TPO4_YEAST RecName: Full=Polyamine transporter 4;
    7::117     2e-04  36%  495 aa  SMVA_SALTY RecName: Full=Methyl viologen resistance protein smvA;
   64::162     2e-04  34%  404 aa  LPLT_YERE8 RecName: Full=Lysophospholipid transporter lplT;
   64::162     2e-04  31%  398 aa  LPLT_SALAR RecName: Full=Lysophospholipid transporter lplT;
   76::247     3e-04  25%  403 aa  Y532_BUCBP RecName: Full=Uncharacterized transporter bbp_532;
   62::218     3e-04  22%  528 aa  SPNS1_HUMAN RecName: Full=Protein spinster homolog 1;AltName:
   69::145     3e-04  26%  428 aa  MMLH_RALEJ RecName: Full=Probable 4-methylmuconolactone
   33::168     4e-04  19%  405 aa  YJHB_ECOLI RecName: Full=Putative metabolite transport protein
   47::172     4e-04  22%  410 aa  Y588_BUCAI RecName: Full=Uncharacterized transporter BU588;
   58::196     4e-04  25%  493 aa  VACHT_DANRE RecName: Full=Probable vesicular acetylcholine
   92::257     5e-04  25%  456 aa  MFS10_MOUSE RecName: Full=Major facilitator superfamily
   91::200     5e-04  29%  455 aa  MFS10_HUMAN RecName: Full=Major facilitator superfamily
  189::364     5e-04  25%  398 aa  LTAA_STAHJ RecName: Full=Probable glycolipid permease ltaA;AltName:
   30::157     5e-04  30%  398 aa  LPLT_PHOLL RecName: Full=Lysophospholipid transporter lplT;
   64::162     5e-04  31%  397 aa  LPLT_ENT38 RecName: Full=Lysophospholipid transporter lplT;
   87::184     5e-04  28%  490 aa  HIAT1_HUMAN RecName: Full=Hippocampus abundant transcript 1
   18::161     6e-04  27%  444 aa  YVKA_BACSU RecName: Full=Uncharacterized MFS-type transporter yvkA;
  365::415     6e-04  35%  541 aa  YUSP_BACSU RecName: Full=Uncharacterized MFS-type transporter yusP;
    7::121     6e-04  28%  404 aa  YDIM_ECOLI RecName: Full=Inner membrane transport protein ydiM;
  128::405     6e-04  22%  449 aa  TUB3_AGRVI RecName: Full=Putative tartrate transporter;
  291::359     6e-04  29%  396 aa  LTAA_STAAC RecName: Full=Probable glycolipid permease ltaA;AltName:
  291::359     6e-04  29%  396 aa  LTAA_STAA8 RecName: Full=Probable glycolipid permease ltaA;AltName:
  291::359     6e-04  29%  396 aa  LTAA_STAA3 RecName: Full=Probable glycolipid permease ltaA;AltName:
   87::182     6e-04  28%  490 aa  HIAT1_MOUSE RecName: Full=Hippocampus abundant transcript 1
   62::218     8e-04  22%  528 aa  SPNS1_BOVIN RecName: Full=Protein spinster homolog 1;
  291::359     8e-04  29%  396 aa  LTAA_STAAW RecName: Full=Probable glycolipid permease ltaA;AltName:
  291::359     8e-04  29%  396 aa  LTAA_STAAS RecName: Full=Probable glycolipid permease ltaA;AltName:
  291::359     8e-04  29%  396 aa  LTAA_STAAR RecName: Full=Probable glycolipid permease ltaA;AltName:
  291::359     8e-04  29%  396 aa  LTAA_STAAN RecName: Full=Probable glycolipid permease ltaA;AltName:
  291::359     8e-04  29%  396 aa  LTAA_STAAM RecName: Full=Probable glycolipid permease ltaA;AltName:
  291::359     8e-04  29%  396 aa  LTAA_STAAB RecName: Full=Probable glycolipid permease ltaA;AltName:
    1::474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSQAASTDIQENKVNKYTLAALAGVPLIMVLGNSMLIPVLPQMAKSLNVSQMQISLIITLFSVPAGLVIP
YITG_BACSU      --------------NGMTIVAIGSIPLILTLGNSMLIPILPKMKSELHLSQFQVSLVITVFSLIAAFAIP
BBEX_BACSU      ----------------------------------------------------------------------
YMFD_BACSU      ------------------IIALSSVPLVMTLGNSMLIPVLPMMEKKLSVTSFQVSLIITVYSVVAIICIP
YFMO_BACSU      --------------------AVAFACVISFMGIGLVDPILPAIAAQLHASPSEVSLLFTSYLLVTGFMMF
BMR2_BACSU      ---------------------------VAFLGIGLIIPVMPSFMKIMHLSGSTMGYLVAAFAISQLITSP
MDTL_SALTI      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALSV      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALPK      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALPA      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALEP      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALDC      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALAR      --------------------------LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALTY      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALPC      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAVDLNASESQLHIAFSVYLAGMATAML
MDTL_SALPB      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALNS      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALHS      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
MDTL_SALCH      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAVDLNASESQLHIAFSVYLAGMATAML
MDTL_SALA4      -------------MKRFLLCSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
YAJR_ECOLI      ---------------------------LRMLGMFMVLPVLTTYGMALQGASEXXXXXXXXXXXXTQAVIP
MDTL_ECOUT      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOK1      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO45      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO27      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
QACA_STAAU      ---------------------------------TILIMALPELVRELEPSGTQQLWIVDIYSVLAGFIIP
QACA_STAAM      ---------------------------------TILIMALPELVRELEPSGTQQLWIVDIYSVLAGFIIP
MDTL_SHISS      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_SHIFL      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_SHIDS      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_SHIBS      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_SHIB3      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ESCF3      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOSM      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOSE      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOLU      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOLI      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOLC      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOL6      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOL5      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOHS      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECODH      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECOBW      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO8A      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO81      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO7I      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO5E      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO57      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO55      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_ECO24      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
MDTL_SHIF8      -------------MSRFLICSFALV-LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYXXXXXXXXX
YVMA_BACSU      ------------------------------LSQNIYSPILPIIKESFHVSTAMVNLSVSVFMIVTAIMQI
MDTL_VIBPA      ---------------------------------------LPQIASDLNASESQLHIAFSVYLAGMATTML
Y466_BUCAI      --------------------------LLRMLGMFMILPILSKYGMLLDGNKFLIGLSMGIYGISQVIFIP
TCR1_ECOLX      ------------KPNRPLIVILSTVALDAV-GIGLIMPVLPGLLRDLNDVTAHYGILLALYALMQFACAP
BMR1_BACSU      -------------------------------GIGLVIPVTPTIMNELHLSGTAVGYMVACFAITQLIVSP
YFIU_BACSU      -----SEALTEQKSQKWAISLFTIGVFMAALDNGIISAALTTINESFSVSPSWGSWGITLYTLGLSVSVP
MDTL_SHEON      ---------------RYLLCSF-GLVLMYPTGIDMYLVGLPQIASQLGASEAQLHIAFSVYLAGMATTML
YCNB_BACSU      -----NTSIEQKPFNRSVIVGLAGA-FVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFMLTNGILIP
MDTD_PECCP      ---------------------------MQTLDTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVMLP
MDTL_KLEP3      -------------MTRFLLCSFALV-LLYPSGIDMYLVGLPRIAQDLGASEAQLHIAFSVYLAGMASAML
MDTL_SHESA      -----------------------GLVLMYPTGIDMYLVGLPQIANQLGATEAQLHIAFSVYLAGMATTML
HSRA_ECOLI      --------------------SMAGLPWIQALDATILNTALPAIAHSLNRSPLAMQSAIISYTLTVAMLIP
MDTL_CITK8      --------------------------LLYPAGIDMYLVGLPRIAADLNASEAQLHIAFSVYLAGMATAML
YJJL_ECOLI      -----STRIKRIQTTAMLLLFFAAV--INYLDRSSLSVANLTIREELGLSATEIGALLSVFSLAYGIAQL
YHCA_BACSU      -----ATGKEKNAKNPMSLLIVLMAGLFLAILNQTLLNVMPHLMTEFGVSATTIQWLTTGYMLVNGVLIP
MDTL_KLEP7      -------------MTRFLLCSFALV-LLYPSGIDMYLVGLPRIAQDLGASEAQLHIAFSVYLAGMASAML
MDTD_YERE8      ---------------------------MQTLDTTIVNTALPSMAASLGENPLRMQSVIVSYVLTVAVMLP
SPNS3_DANRE     -STPQTTSISQRR-SYIAVAVLCYINLLNYMDRYTIAGVLLRIQKFFFISDSTSGLLQTVFICSFMFLAP
SPNS1_XENLA     --------------------------------------VLPDIKKAFNISDSNSGLVQTVFICSYMFLAP
MDTD_SERP5      ---------------------------MQTLDTTIVNTALPSMAVSLGENPLRMQSVIVSYVLTVAVMLP
YWOG_BACSU      ---------------------------------------------------------------------P
TCRB_BACSU      -----------------------------VLNEMVLNVSLPDIANEFNKLPASANWVNTAFMLTFSIGTA
SPIN_DROME      ----------------FTVTVLCFVNLINYMDRFTIAGVLTDVRNDFDIGNDSAGLLQTVFVISYMVCAP
MDTD_YERPY      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_YERPP      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_YERPN      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_YERPG      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_YERPE      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_YERPB      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_YERPA      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_YERP3      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
YO378_YEAST     ----------------------------------------------------QLSWFASAYSLTVGTFIL
SPNS2_XENTR     -----SSSSKPDKAYNWKRASVAAAGILSVLDRYTVAGVLLDIQQHFEVKDSGAGLLQTVFICSFMVAAP
PMRA_LACLA      ---------------------------------SLVMPFLPLYIQGLGVSGGNVELYSGLFSLPAGLVAP
MDTD_YERPS      ---------------------------MQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLP
MDTD_ERWCT      ---------------------------MQTLDTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVMLP
BCR_HAEIN       -----------------TLGILSMLP---PFGVDMYLPSFLEIAKDLDVSPEQVQHTLTSFAYGMAFGQL
TCR_STRPN       ---------QSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTA
TCR_STAHY       ---------QSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTA
TCR_BACSU       ---------QSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTA
TCR_BACST       ---------QSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTA
TCR_BACCE       ---------QSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTA
SPNS3_MOUSE     --------------------------------NWFIIPVLLDVQKYFHISDSHAGLLQTVFISCLLVSAP
MDTD_KLEP3      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMIIVSYVLTVAVMLP
MDTD_ENTS8      ------TDLPQNV--RWQLWIVAFGFFMQALDTTIVNTALPSMAASLGESPLRMHMVIVSYVLTVAVMLP
TCR2_ECOLX      -------------MNSSTKIALV-ITLLDAMGIGLIMPVLPTLLREFIASENHFGVLLALYALMQVIFAP
MDTD_KLEP7      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMIIVSYVLTVAVMLP
EXUT_BACSU      ---------------------LAGV--INYLDRSALSIAAPFIQDDLTLSATQMGLIFSSFSIGYAIFNF
TCR_STRAG       ---------QSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTA
SPNS1_XENTR     --------------------------------------VLSDIKEDYHISDSNSGLVQTVFICSYMFLAP
SPNS1_DANRE     -----------------TVIVLCYINLLNYMDRFTVAGVLPDIEHFFGIGDGTSGLLQTVFICSYMFLAP
MDTD_ENT38      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVIVSYVLTVAVMLP
BMR3_BACSU      -----TTTAKQASTKFVVLGLLLGI-LMSAMDNTIVATAMGNIVADLG-SFDKFAWVTASYMVAVMAGMP
YAN6_SCHPO      ------------------------------------------------------SWIGTAYTLAQTSILP
SPNS2_DANRE     --------------------------------------VLLDIQKQFKVGDSSAGLLQTVFICSFMVAAP
EMRB_HAEIN      ---------------------------MQVLDSTIANVAIPTIAGDLGASFSQGTWVITSFGVANAISIP
YIM0_YEAST      ------------------------------VAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPS
MDTD_SALTY      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALTI      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALSV      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALPK      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALPB      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALPA      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALNS      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALHS      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALEP      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALDC      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
MDTD_SALA4      ------------------------------LDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLP
YCEJ_BACSU      --------------------------------------------------------MVSAYALGYALFAF
MDTD_ECOLU      ------TDLPDN--TRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
YWFA_BACSU      ------------------LLALALTMGVFAAGSEELVPLLPDLAKAFSSDVSVLALSISIYGVMIFIGAP
YI32_SCHPO      ------------------------------------------------------SWIGTAYSLAETSILP
YYBF_BACSU      -------------------------------------PLMEEFTREFHVTPTAASLSLSVTTMLLAVSML
Y450_BUCAP      --------------------------LLRMLGIFSVLPILSKYGLYLNGNKFLIGLAVGIYGATQIVFIP
SPNS2_MOUSE     --------------------------------------VLLDIQQHFGVKDRGAGLLQSVFICSFMVAAP
SPNS2_HUMAN     --------------------------------------VLLDIQQHFGVKDRGAGLLQSVFICSFMVAAP
EMRB_ECOLI      --------------------ALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIP
EMRB_ECO57      --------------------ALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGVANAISIP
YNFM_ECOLI      -------------------------------------PILPVLSQEFGLTPANSSISLSISTAMLAIGLL
SPNS3_HUMAN     -------------------AVLCYINLLNYMNWFIIAGVLLDIQEVFQISDNHAGLLQTVFVSCLLLSAP
MDTD_SHISS      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_SHIFL      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_SHIBS      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_SHIB3      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ESCF3      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOUT      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOSM      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOSE      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOLI      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOLC      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOL6      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOL5      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOK1      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOHS      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECODH      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECOBW      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO8A      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO81      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO7I      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO5E      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO57      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO55      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO45      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO27      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
MDTD_ECO24      ------------------------------LDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
AQR1_YEAST      ------------------------------LGSPIYYPALRQLEKQFXXXXXXXXXXXXXYLLFQGISPT
MDTD_SHIF8      ------------------------------LDTTIVNTAIPSMAQSLGESPLHMHMVIVSYVLTVAVMLP
LTAA_STAS1      ----------------------------------------------------------------------
Y411_BUCBP      --------------NKKAIIGIFMIFSLRVFGMFMIVPVLSTYGMCLKNSNILVGVAXXXXXXXXXXXXX
PHDK_NOCSK      --------------------------------------LFPPVIRDWGVPVSAVTLVVSLGVVAMAIGAL
MDTD_CITK8      ------------------------------LDTTIVNTALPSMALSLGESPLHMHMVVVSYVLTVAVMLP
YCXA_BACSU      --------------------------------NSFQFFMLP-MADAFHADRSLISVSVSIFMITTGIVQF
TCR7_VIBAN      ------------------------------MGLGLIMPVLPTLLRELVPAEQHYGALLSLYALMQVVFAP
LPLT_KLEP7      MSESVHTN--PSLYSKGMLAVICAQFLSAFGDNALLFATLALM-KQLYYPEWSQPVLQMLFVGAYILFAP
LPLT_KLEP3      MSESVHTN--PSLYSKGMLAVICAQFLSAFGDNALLFATLALM-KQLYYPEWSQPVLQMLFVGAYILFAP
BAIG_EUBSP      ---------------------------------------------------------------------P
YDHC_ECOLI      ---------------KRFLVWLAGLSVLGFLATDMYLPAFAAIQADLQTPXXXXXXXXXXXXXXXXXXXX
SO1A1_RAT       ----------------------------------------------------------------------
YJA1_SCHPO      ------------------LILVSAFALLGPMASSMVAPCLDQIADRFHINSTEKALILSIYLLVFAISPM
YHJO_BACSU      --------------------------LLTSLTGAMMGPFMVYLHEQLNGSIMMPMLIISLQPFADIFLTL
YFKF_BACSU      ----------------------------------------------------------------------
TCR3_ECOLX      ------------------LIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASVLLALYALMQFLCAP
SO1A3_RAT       ----------------------------------------------------------------------
SO1A6_MOUSE     ----------------------------------------------------------------------
SO1A5_RAT       ----------------------------------------------------------------------
LPLT_SHIFL      ------------------------------------------------------------------LLAP
LPLT_SHIF8      ------------------------------------------------------------------LLAP
LPLT_CITK8      ------------------------------------------------------------------LFAP
EMRD_ECOLI      ------------------------------MAQTIYIPAIADMARDLNVREGAVQSVMGAYLLTYGVSQL
YQJV_BACSU      ------------------------------MATSMSIPFLAIYLTAVQGASASYAGLVIAASSSVGILAS
YN41_SCHPO      -----------------TTSIYAYASLTIAWGSSVLSPASATLAKKYHIGMTTSLLNVSLFMLGYCLGPI
Y1560_METJA     -----------------------------MLGVGFIAPIMAIYAQTLGATNLEIGLIFGSFALARTVAQI
SO1A5_MOUSE     ----------------------------------------------------------------------
LPLT_YERPY      ------------------------------------------------------------------VLAP
LPLT_YERPS      ------------------------------------------------------------------VLAP
LPLT_YERPP      ------------------------------------------------------------------VLAP
LPLT_YERPN      ------------------------------------------------------------------VLAP
LPLT_YERPG      ------------------------------------------------------------------VLAP
LPLT_YERPE      ------------------------------------------------------------------VLAP
LPLT_YERPB      ------------------------------------------------------------------VLAP
LPLT_YERPA      ------------------------------------------------------------------VLAP
LPLT_YERP3      ------------------------------------------------------------------VLAP
LPLT_SHISS      ------------------------------------------------------------------LFAP
LPLT_SHIDS      ------------------------------------------------------------------LFAP
LPLT_SHIBS      ------------------------------------------------------------------LFAP
LPLT_SHIB3      ------------------------------------------------------------------LFAP
LPLT_ECOUT      ------------------------------------------------------------------LFAP
LPLT_ECOSM      ------------------------------------------------------------------LFAP
LPLT_ECOSE      ------------------------------------------------------------------LFAP
LPLT_ECOLU      ------------------------------------------------------------------LFAP
LPLT_ECOLI      ------------------------------------------------------------------LFAP
LPLT_ECOLC      ------------------------------------------------------------------LFAP
LPLT_ECOL6      ------------------------------------------------------------------LFAP
LPLT_ECOL5      ------------------------------------------------------------------LFAP
LPLT_ECOK1      ------------------------------------------------------------------LFAP
LPLT_ECOHS      ------------------------------------------------------------------LFAP
LPLT_ECODH      ------------------------------------------------------------------LFAP
LPLT_ECOBW      ------------------------------------------------------------------LFAP
LPLT_ECO8A      ------------------------------------------------------------------LFAP
LPLT_ECO81      ------------------------------------------------------------------LFAP
LPLT_ECO7I      ------------------------------------------------------------------LFAP
LPLT_ECO5E      ------------------------------------------------------------------LFAP
LPLT_ECO57      ------------------------------------------------------------------LFAP
LPLT_ECO55      ------------------------------------------------------------------LFAP
LPLT_ECO45      ------------------------------------------------------------------LFAP
LPLT_ECO27      ------------------------------------------------------------------LFAP
LPLT_ECO24      ------------------------------------------------------------------LFAP
SO1A1_MOUSE     ----------------------------------------------------------------------
PMRA_STRR6      ---------------------------------SLVVPFMPIFVENLGVGSQQVAFYAXXXXXXXXXXXP
PMRA_STRPN      ---------------------------------SLVVPFMPIFVENLGVGSQQVAFYAXXXXXXXXXXXP
MFSD9_MOUSE     ------------------------VGFLDLFGVSMVVPLLNLHVRSLGASPVVAGIVGSSYGVLQLFSST
LPLT_SERP5      ------------------------------------------------------------------ILAP
LPLT_SALTY      ------------------------------------------------------------------LFAP
LPLT_SALTI      ------------------------------------------------------------------LFAP
LPLT_SALSV      ------------------------------------------------------------------LFAP
LPLT_SALPK      ------------------------------------------------------------------LFAP
LPLT_SALPC      ------------------------------------------------------------------LFAP
LPLT_SALPB      ------------------------------------------------------------------LFAP
LPLT_SALPA      ------------------------------------------------------------------LFAP
LPLT_SALNS      ------------------------------------------------------------------LFAP
LPLT_SALHS      ------------------------------------------------------------------LFAP
LPLT_SALG2      ------------------------------------------------------------------LFAP
LPLT_SALEP      ------------------------------------------------------------------LFAP
LPLT_SALDC      ------------------------------------------------------------------LFAP
LPLT_SALCH      ------------------------------------------------------------------LFAP
LPLT_SALA4      ------------------------------------------------------------------LFAP
YEBQ_ECOLI      -----------------------GAILTIVIGISMAVVALPTIATDLHATPASSIWVVNAYQIAIVISLL
TPO4_YEAST      ----------------YTTMTSAFLCLVVTMGSSLYVSSVPELVERYHVSQTLALAGLTFYLL--GLSTV
SMVA_SALTY      -----------------TLVIIVLVYIPVAIDATVLHVAAPTLSMTLGASGNELLWIIDIYSVMAGMVLP
LPLT_YERE8      ------------------------------------------------------------------VLAP
LPLT_SALAR      ------------------------------------------------------------------LFAP
Y532_BUCBP      ----------------------------------------------------------------------
SPNS1_HUMAN     ------------------VAVLCYINLLNYMDRFTVAGVLPDIEQFFNIGDSSSGLIQTVFISSYMVLAP
MMLH_RALEJ      ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------MIFYILHIIKADLGITDIQATLIGTVAFIARPIGGG
Y588_BUCAI      --------------------------------------ILPMFSKQFYLTPAESSLALSAATITMSLGML
VACHT_DANRE     ----------------------------------VIVPIIPDYLADLRGERIQIGVLFASKALLQLLVNP
MFS10_MOUSE     -------------------------------------------------------LIGSAFSLLQFFSAP
MFS10_HUMAN     -------------------------------------------------------LIGSAFSVLQFLCAP
LTAA_STAHJ      ----------------------------------------------------------------------
LPLT_PHOLL      --------------------------------NALLFAILAQLKAQFYPDWSQPILQI-VFVLAYILLAP
LPLT_ENT38      ------------------------------------------------------------------LFAP
HIAT1_HUMAN     ------------------------------------------------------------------LSAP
YVKA_BACSU      --------------------------ILVPINSTMIAVALSSISHTYNESIASITWVVTVYLIVMAVTQP
YUSP_BACSU      ----------------------------------------------------------------------
YDIM_ECOLI      -------------------------PTALGLYFNYLVHGMGVLLMSLNMASLEVSIVISSLGIGRLSVLL
TUB3_AGRVI      ----------------------------------------------------------------------
LTAA_STAAC      ----------------------------------------------------------------------
LTAA_STAA8      ----------------------------------------------------------------------
LTAA_STAA3      ----------------------------------------------------------------------
HIAT1_MOUSE     ------------------------------------------------------------------LSAP
SPNS1_BOVIN     ------------------VAVLCYINLLNYMDRFTVAGVLPDIEQFFDIGDGSSGLIQTVFISSYMVLAP
LTAA_STAAW      ----------------------------------------------------------------------
LTAA_STAAS      ----------------------------------------------------------------------
LTAA_STAAR      ----------------------------------------------------------------------
LTAA_STAAN      ----------------------------------------------------------------------
LTAA_STAAM      ----------------------------------------------------------------------
LTAA_STAAB      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FAGFLSDRFGRKKIIIPGLFLYXXXXXXXXXXXXIFKENAFPWILGGRILQGIGAAGTAPIAMAFCGDLW
YITG_BACSU      IVGYLADRFSRKVIIIPCLILYXXXXXXXXXXXXXX-DNAYPWVMAGRALQGIGAAGTGPIAMALTGDLF
BBEX_BACSU      ----------------------------------------------------------------------
YMFD_BACSU      IAGYLSDRFGRKKILLP-CXXXXXXXXXXXXXXSTYMKNPYAMILAGRVLQGIGSAG-------------
YFMO_BACSU      FSGAISSRIGAKWTLILGLIFIIVFAGLGG------SSSSIAQLVGYRGGWGLGNALFISTALAVI-XXX
BMR2_BACSU      FAGRWVDRFGRKKMIILGLLIFSLSELIFGLGTHV---SIFYF---SRILGGVSAAFIMPAVTAYVADIT
MDTL_SALTI      FAGKIADQSGRKPVAIVGAIVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALSV      FAGKIADQSGRKPVAIVGALVFMTASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALPK      FAGKIADQSGRKPVAIVGAIVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALPA      FAGKIADQSGRKPVAIVGAIVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALEP      FAGKIADQSGRKPVAIVGAIVFMMASLLCS------RASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTL
MDTL_SALDC      FAGKIADQSGRKPVAIVGAIVFMMASLLCS------RASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTL
MDTL_SALAR      FAGKIADRSGRKPVAIVGVFMMASLLCSQATEGSLF--------LSGRFLQGVGAGSCYVVAFAILRDTL
MDTL_SALTY      FAGKIADQSGRKPVAIVGALVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALPC      FAGKIADQSGRKPVAIVGAIVFMMASLLCS------RASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTL
MDTL_SALPB      FAGKIADQSGRKPVAIVGALVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALNS      FAGKIADQSGRKPVAIVGALVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALHS      FAGKIADQSGRKPVAIVGALVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
MDTL_SALCH      FAGKIADQSGRKPVAIVGAIVFMMASLLCS------RASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTL
MDTL_SALA4      FAGKIADQSGRKPVAIVGALVFMMASLLCS------RASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTL
YAJR_ECOLI      F-GLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIW------GIILGRALQGSGAIAAA--VMALLSDLT
MDTL_ECOUT      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSALF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOK1      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSALF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO45      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSALF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO27      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSALF--------LAGRFLQGLGAGCCYVVAFAILRDTL
QACA_STAAU      LSAF-ADKWGRKKALLTGFALFGLVSLA------IFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIF
QACA_STAAM      LSAF-ADKWGRKKALLTGFALFGLVSLA------IFFAESAEFVIAIRFLLGIAGALIMPTTLSMIRVIF
MDTL_SHISS      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_SHIFL      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_SHIDS      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_SHIBS      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_SHIB3      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ESCF3      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOSM      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOSE      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOLU      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOLI      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOLC      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOL6      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSALF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOL5      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSALF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOHS      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECODH      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECOBW      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO8A      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO81      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSALF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO7I      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO5E      XXXKVADRSGRKPVAIPGLFIITSVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO57      XXXKVADRSGRKPVAIPGLFIITSVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO55      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_ECO24      XXXKVADRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
MDTL_SHIF8      XXXXXXDRSGRKPVAIPGLFIIASVFCSLAETSTLF--------LAGRFLQGLGAGCCYVVAFAILRDTL
YVMA_BACSU      ILGAIIDFKGARIVLITGILATAAASIGCAVTTD------FTLFLIFRMIQXXXXXXXXXXXXTTIGQLF
MDTL_VIBPA      FAGKIADSVGRKPIAVVGAMIFVLASFLGGMAE---QPNTF---LIARFCQGIGAGSCYVVAFAILRDTL
Y466_BUCAI      F-GILSDKFNRKKIILLGLFMFFIGNIISASIHSIW------GLIIGRFFQGSGA--ISGVCMAFLSDLI
TCR1_ECOLX      VLGALSDRFGRRPVLLVSL-------AGAAVDYAIMATAPFLWVLYXXXXXXXXXXXXXXXXXXXXXDIT
BMR1_BACSU      IAGRWVDRFGRKIMIVIGLLFFSVSEFLFGIGKTV------EMLFISRMLGGISAAFIMPGVTAFIADIT
YFIU_BACSU      IVGKLSDRYGRKKLFLIEVCLF------GLGSLLVALSQSFPLFLISRLIQALXXXXXXXXXSSHILATL
MDTL_SHEON      FAGSLADRIGRKPI------TXXXXXXXXXXXXXXXXXQTSDLFLIARFAQGIGAGCCYVVAFAILRDVL
YCNB_BACSU      ITAFLIEKFTSRALLITAMSIF-----TAGTVVGAFAPN-FPVLLTARIIQAAGAGIMMPLMQTVFLTIF
MDTD_PECCP      ASGWLADRIGVKNIFFAAILLFTLGSLLCA------RSETLNELLASRVIQGIGGAMMVPVGRLTVMKIV
MDTL_KLEP3      FAGRIADRSGRKPXXXXXXXXXXXXSLLCA------QAHASSHFLVGRFIQGIGAGSCYVVAFAILRDTL
MDTL_SHESA      FAGSLADRIGRKPI------TXXXXXXXXXXXXXXXXXQSSDLFLVARFVQGVGAGCCYVVAFAILRDAL
HSRA_ECOLI      VSGWLADRFGTRRIFTLAVSLFTLGSLACAL------SNSLPQLVVFRVIQGIGGAMMMPVA--------
MDTL_CITK8      FAGKVADQSGRK----PXXXXXXXXXXXXSMLCSRATDGSL--FLTGRFIQGIGAGCCYVVAFAILRDTL
YJJL_ECOLI      PCGPLLDRKGPRLMLGLGMFFWSLFQAMSGMV------HNFTQFVLVRIGMGIGEAPMNPCGVKVINDWF
YHCA_BACSU      LSAFLITRFGQRSLFLVAMFCFTLGTLVCGIAPN------FSTMLIGRLIQAVGGGILQPLVMTTILLIF
MDTL_KLEP7      FAGRIADRSGRKPXXXXXXXXXXXXSLICA------QVHTSSHFLIGRFIQGIAAGSCYVVAFAILRDTL
MDTD_YERE8      ASGWLADRVGVKWVFFSAIILFTLGSLLCAQAETLNE------LISSRVIQGIGGAMMVPVGRLTVMKIV
SPNS3_DANRE     VFGYLGDRYDRKLIMIVGLVMWIVTTLGSS-----FVRKSHFWVLATRALVGTGEASYSTIAPTIIGDLF
SPNS1_XENLA     VFGYLGDRYNRKLIMCVGISFWSLVTLLSS-----FVSNQYFWLLITRGLVGVGEASYSTIAPTIIADLF
MDTD_SERP5      ASGWLADRVGVQRVFFSAIVLFTLGSILCA------RSETLNELIASRVVQGIGGAMMVPVGRLTVMKIV
YWOG_BACSU      FSGAIVERFGKKRMAIVSMALFALSSFLYMPI------HNFSLLLGLRFFQGIWFSILTTVTGAIAADII
TCRB_BACSU      LYGKLSDQLGIKNLLLFGIMV-----NGLGSIIGFVGHSFFPILILARFIQGIGAAAFPALVMVVVARYI
SPIN_DROME      IFGYLGDRYSRPWIMAVGVGLWSTTTLLGSFM------KQFGWFIAFRALVGIGEASYSTIAPTIISDLF
MDTD_YERPY      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
MDTD_YERPP      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
MDTD_YERPN      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
MDTD_YERPG      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
MDTD_YERPE      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
MDTD_YERPB      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
MDTD_YERPA      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
MDTD_YERP3      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGGAMMVPVGRLTVMKIV
YO378_YEAST     IAGRLGDIFGHKKFFVLGFFWY--ALWSLLAGFSVYSNQIF--FDCCRAFQGMGPAFLLPNAIAILGRTY
SPNS2_XENTR     IFGYLGDRFNRKVILSSGIFFWSAITFSSS-----FIPKKYFWLLVSRGLVGIGEASYSTIAPTIIGDLF
PMRA_LACLA      IWGRLADEHGRKVMMVRASIVMTLTMGGIAFAPNVW------WLLGLRLLMGF-FSGYIPNSTAMIASQA
MDTD_YERPS      ASGWLADRIGVKWVFFSAIILFTFGSLMCAQSATLNE------LILSRVLQGVGDAMMVPVGRLTVMKIV
MDTD_ERWCT      ASGWLADRIGVKNIFFAAILLFTLGSLLCA------RSETLDELLISRVIQGIGGAMMVPV---------
BCR_HAEIN       FWGPFGDSFGRKPIILLGVIV------GALTALVLTEINSVGNFTALRFVQGFFGAAPVVLSGALLRDLF
TCR_STRPN       VYGKLSDQLGIKRLLLFGIII-----NCFGSVIGFVGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYI
TCR_STAHY       VYGKLSDQLGIKRLLLFGIII-----NCFGSVIGFVGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYI
TCR_BACSU       VYGKLSDQLGIKRLLLFGIII-----NCFGSVIGFVGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYI
TCR_BACST       VYGKLSDQLGIKRLLLFGIII-----NCFGSVIGFVGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYI
TCR_BACCE       VYGKLSDQLGIKRLLLFGIII-----NCFGSVIGFVGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYI
SPNS3_MOUSE     VFGYLGDRYNRKAILSFGILLWSGAGLSSS-----FISYQYSWLFFSRGFVGTGAASYSTIAPTVLGDLF
MDTD_KLEP3      ASGWLADRVGVRNIFFTAIVLFTAGSLFCA------QASTLDQLVMARVLQGIGGAMMVPV---------
MDTD_ENTS8      ASGWLADRVGVRNIFFTAIVLFTLGSLFCA------QSSTLNELVAARVLQGIGGAMMVPV---------
TCR2_ECOLX      WLGKMSDRFGRRPVLLLSLI-------GASLDYLLLAFSSALWMLYGRLLSGITGA-TGAVAASVIADTT
MDTD_KLEP7      ASGWLADRVGVRNIFFTAIVLFTAGSLFCA------QASTLDQLVMARVLQGVGGAMMVPV---------
EXUT_BACSU      LGGVASDRYGAK------LTLFVAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGPLSATINKMVNNWF
TCR_STRAG       VYGKLSDQLGIKRLLLFGIII-----NCFGSVIGFVGHSFFSLLIMARFIQGAGAAAFPALVMVVVARYI
SPNS1_XENTR     VFGYLGDRYNRKLIMCIGISFWSLVTLLSS-----FVSKQYFWLLLTRGLVGVGEASYSTIAPTIIADLF
SPNS1_DANRE     LFGYLGDRYNRKLIMCVGIFFW----SVVTLASSFIGKDHFWALLLTRGLVGVGEASYSTIAPTIIADLF
MDTD_ENT38      ASGWMADKIGVRNIFFTAIVLFTLGSLFCA------KADTLNELVMSRVLQGVGGAMMVPV---------
BMR3_BACSU      IYGKLSDMYGRKRXXXXXXXXXXXXSALCGIAQTMNQLIIF------RAIQGIGGGALLPIAFTIIFDLF
YAN6_SCHPO      FCGIMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNML------WLVLCRAVQGIGGGGITSLVTIVIADIT
SPNS2_DANRE     IFGYLGDRFNRKIILSCGIFFWSAVTLLSS-----FITKEYYWLLVSRCLVGIGESSYSSISPTIIGDLF
EMRB_HAEIN      ITGWLAKRFGEVRLFLVSTFLFVVSSWLCGI------ADSLEALIIFRVIQGAVAGPVIPLSQSLLLNNY
YIM0_YEAST      IMGGLADTFGRRPIVLWAILAY------FCACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDVT
MDTD_SALTY      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALTI      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALSV      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALPK      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALPB      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALPA      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALNS      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALHS      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALEP      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALDC      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
MDTD_SALA4      ASGWLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQ------LVLARVLQGVGGAMMVPV---------
YCEJ_BACSU      IAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLF------RFAAGVSAAFVTPQIWASIPVIV
MDTD_ECOLU      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
YWFA_BACSU      LLVPLGDKYSRELSLLAGLMIFIIGTVICALAQNIXXXXXXXXXXXXXXXXXV------PTAYAVVGDRV
YI32_SCHPO      FCGIMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNML------WLVLCRAVQGIGGGGIMSLVTIVIADIT
YYBF_BACSU      VFGSLSEVWGRKPIM--GISMLAASVLCLASAF----SPSFHTLLVLRTIQGVALAGLPSIAMAYLGEEI
Y450_BUCAP      F-GILSDRFGRKQXXXXXXXXXXXXXXXXXXTNSIF------GLIIGRAIQGSGA--ISGVSMALLSDLI
SPNS2_MOUSE     IFGYLGDRFNRKVILSCGIFFWSAVTFSSS-----FIPQQYFWLLVSRGLVGIGEASYSTIAPTIIGDLF
SPNS2_HUMAN     IFGYLGDRFNRKVILSCGIFFWSAVTFSSS-----FIPQQYFWLLVSRGLVGIGEASYSTIAPTIIGDLF
EMRB_ECOLI      LTGWLAKRVGEVKLFLWSTIAFAIASWACGV------SSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNY
EMRB_ECO57      LTGWLAKRVGEVKLFLWSTIAFAIASWACGV------SSSLNMLIFFRVIQGIVAGPLIPLSQSLLLNNY
YNFM_ECOLI      FTGPLSDAIGRKPVMVTALLLASICTLLSTMM------TSWHGILIMRALIGLSLSGVAAVGMTYLSEEI
SPNS3_HUMAN     VFGYLGDRHSRKATMSFGILLWSGAGLSSS-----FISPRYSWLFFSRGIVGTGSASYSTIAPTVLGDLF
MDTD_SHISS      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_SHIFL      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_SHIBS      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_SHIB3      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ESCF3      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSATLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOUT      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOSM      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOSE      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOLI      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOLC      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOL6      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOL5      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOK1      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOHS      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECODH      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECOBW      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO8A      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO81      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO7I      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO5E      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO57      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO55      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO45      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO27      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
MDTD_ECO24      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
AQR1_YEAST      VSGGLADCFGRRPIILAGMLIYVIASIGLACAP------SYGVIIFLRCIQSIGISPTIAISSGVVGDFT
MDTD_SHIF8      ASGWLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNE------LLLARALQGVGGAMMVPV---------
LTAA_STAS1      ----------------------------------------------------------------------
Y411_BUCBP      XXGWLSDKYGQKLIINIGLLCF------LLGNIIAWSSNSIWGIILGRGLQGSGAISS--VCMTLLSELV
PHDK_NOCSK      VSGPVADRWGRKGVTVVGFVLFCLATAGLGLTGDIHSFAAL------RIISCFGLGAVMPVALTIVADWM
MDTD_CITK8      ASGWLADKVGVRNIFFTAIVLFTLGSLFCAWSSTLNE------LVLARVLQGVGGAMMVPV---------
YCXA_BACSU      FVGFFIDRFSVRKIMALGAVCISASFLVLPYSPNVHVFSAIYGVLG-----GIGYSCAVGVTTQYFISCW
TCR7_VIBAN      MLGQLSDSYGRRPVLLASL-------AGAAVDYTIMASAPVLWVLYGRLXXXXXXXXXXXXXXXIADSTG
LPLT_KLEP7      FVGQFADSFGRVMMVANGLKLLGAGCIC-------FGVNPFI----GYTLVGIGAAAYSPAKYGILGELT
LPLT_KLEP3      FVGQFADSFGRVMMVANGLKLLGAGCIC-------FGVNPFI----GYTLVGIGAAAYSPAKYGILGELT
BAIG_EUBSP      ILGKLGDVLGRRTTLLLGIVIFAAGNVLTAVATSLI------FMLAARFIVGIGTAAISPIVMAYIVTEY
YDHC_ECOLI      XWGPLSDRYGRKPVLLIGLTIF-----ALGSLGMLWVENA-ATLLVLRFVQAVGVCAAAVIWQALVTDYY
SO1A1_RAT       -------------------------------------------VMVGNIIRGIGETPIVPLGISYIEDFA
YJA1_SCHPO      ISAPLSEVFGRRMLLQVGNVIFIVFNMACG----LARTKAQMYIF--RFLAGFGSATPMGLGSGTISDLF
YHJO_BACSU      AAGRVTDRLGRRTAILTALLL-----QSAAMTGFVFAEHAYVFAI-LYVMNGIGRSLYIPASRAQIAEST
YFKF_BACSU      ----------------------------------------------------------------------
TCR3_ECOLX      VLGALSDRFGRRPVLLASLL-------GATIDYAIMATTPVLWILYXXXXXXXXXXXXXXXXXXXXXDIT
SO1A3_RAT       ------------------------------------------YVLVGNIIRGIGETPIMPLGVSYIENFA
SO1A6_MOUSE     ------------------------------------------YVLVGNIIRGIGETPIMPLGISYIEDFA
SO1A5_RAT       ------------------------------------------YVLVGNIIRGIGETPIMPLGISYIEDFA
LPLT_SHIFL      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_SHIF8      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_CITK8      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGFNPFV----GYTLVGIGAAAYSPAKYGILGELT
EMRD_ECOLI      FYGPISDRVGRRPVILVGMSIF------------------------------------------------
YQJV_BACSU      FGGYISDKFGRKNMMLVSIFLVFAGFAAASNLWVFFVVNA---------LNGLCKSLFEPASKALLSDMT
YN41_SCHPO      CWAPMSEITGRKTPLYIGLFLFSVFQIAVATAQDI------QTIMICRFFGGYGACVPLCVVAAAFADMY
Y1560_METJA     PVGVLSDIYGKKFFIVCGTFFYGVSTLMYNFVSTVL------GFLIVRIFTGIFSAFVTPVAGSYIAAIA
SO1A5_MOUSE     ------------------------------------------YVLVGNIIRGIGETPIMPLGISYIEDFA
LPLT_YERPY      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERPS      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERPP      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERPN      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERPG      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERPE      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERPB      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERPA      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_YERP3      FVGQIADGFGRVMMVANGLKL-------AGALVICFGLNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_SHISS      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_SHIDS      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_SHIBS      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_SHIB3      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOUT      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOSM      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOSE      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOLU      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOLI      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOLC      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOL6      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOL5      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOK1      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOHS      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECODH      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECOBW      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO8A      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO81      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO7I      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO5E      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO57      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO55      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO45      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO27      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
LPLT_ECO24      FVGQVADSFAKGRVM-----MFANGLKLLGAASICFGINPFL----GYTLVGVGAAAYSPAKYGILGELT
SO1A1_MOUSE     ------------------------------------------YVLIGNTMRGIGETPIMPLGISYIEDFA
PMRA_STRR6      IWGILADKYGRKPMMIAGLAM------TITMGGLAFVPNIY-WLIFLRLLNGV-FAGFVPNATALIASQV
PMRA_STRPN      IWGILADKYGRKPMMIAGLAM------TITMGGLAFVPNIY-WLIFLRLLNGV-FAGFVPNATALIASQV
MFSD9_MOUSE     FVGCWSDVVGRRSSLLVCIXXXXXXXXXXG-----MSTNVFLFTLA-RVPVGV-FKHTLSISRALLSDLV
LPLT_SERP5      FVGQVADSFGRVMMVANGLKL-------AGALVICFGFNPFL----GYTLVGVGAAAYSPAKYGILGEIT
LPLT_SALTY      FVGQIADSFGRVMMVANGLKLAGAAGICLGINPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALTI      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALSV      FVGQIADSFGRVMMVANGLKLAGAAGVCLGINPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALPK      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALPC      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALPB      FVGQIADSFGRVMMVANGLKLAGAAGICLGINPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALPA      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALNS      FVGQIADSFGRVMMVANGLKLAGAAGICLGINPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALHS      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALG2      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALEP      FVGQMADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALDC      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALCH      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
LPLT_SALA4      FVGQIADSFGRVMMVANGLKLAGAAGICLGVNPFV-----------GYTLVGIGAAAYSPAKYGILGELT
YEBQ_ECOLI      SFSFLGDMFGYRRIYKCGLVVFLLSSLFCAL------SDSLQMLTLARVIQGFGGAALMSVNTALIRLIY
TPO4_YEAST      IGAPLSEVFGRKPV-----YLFSLPVSMLFTMGVGLSNGHMRIILPLRFLSGVFASPALSVGSGTILDIF
SMVA_SALTY      M-GALGDRIGFKRLLMXXXXXXXXXXXXXXXX------HTASWLIATRVLLAIGAAMIVPATLA------
LPLT_YERE8      FVGQFADSFGRVMMVANGLKL-------AGALVICFGFNPFL----GYSLVGVGAAAYSPAKYGILGEIT
LPLT_SALAR      FVGQIADSFAKGRVM-----MFANGLKLAGAASICLGVNPFV----GYTLVGIGAAAYSPAKYGILGELT
Y532_BUCBP      FTGPLSDSIGRKVVMSSSLFLASFCTFCCSNM------NSWESIIFMRALTGLALSGVAAVAMTYLSEEM
SPNS1_HUMAN     VFGYLGDRYNRKYLMCGGIAFW----SLVTLGSSFIPGEHFWXXXXXXXXXXXXEASYSTIAPTLIADLF
MMLH_RALEJ      -AGILSDRYGRARILVLAIIWFTLFGVLAGF------AQSYQQLLIARTLQGLGFGGEWAVGAALMAEVI
YJHB_ECOLI      FFGAMADKYGRKPMMMWAIFIYSVGTGLSGIATNLY------MLAVCRFIVGLGMSGEYACASTYAVESW
Y588_BUCAI      FTGPLSDIIGRKSIMSTSLFIAAMLTMICSMM------TSWISIVLLRALTGLALSGVVAVAMTYISEEI
VACHT_DANRE     LSGTFIDRVGYDLPLLIGLLVMFLSTCIFA-----FAEN-YGTLFAARSLQGLGSAFADTSGIAMIADKF
MFS10_MOUSE     LTGAASDYLGRRPVMMLSL------TGLAISYAVWATSRSFKAFLASRVIGGI-SKGNVNLSTAIVADLG
MFS10_HUMAN     LTGATSDCLGRRPVMLLCLM------GVATSYAVWATSRSFAAFLASRLIGGI-SKGNVSLSTAIVADLG
LTAA_STAHJ      ----------------------------------------------------------------------
LPLT_PHOLL      FVGQIADRFPKDRVML---------------FANSFKLGAFTICLGGYALVGVGAASYSPAKYGILVELT
LPLT_ENT38      FVGQVADSFPKGRVM-----MFANSLKLLGAASICFGFNPFI----GYTLVGIGAAAYSPAKYGILGELT
HIAT1_HUMAN     LIGALSDVWGRKSFLLLTVFF-------TCAPIPLMKISPW-WYFAVISVSGVFAV-TFSVVFAYVADIT
YVKA_BACSU      IAGKLGDMYGNKTMYLWGVGLFLIAXXXXXXXXXXXXXIVF------RALQAVGGALLTPNSIAIIRHVV
YUSP_BACSU      ----------------------------------------------------------------------
YDIM_ECOLI      FAGLLSDRFGRRPFIMLGMCCYMAFFFGILQTNNIIIAYVFGFLAG--MANSFLDAGTYPSLM-------
TUB3_AGRVI      -----------------------------------------------RFLLGVAEAGFFPGIILYLSFWF
LTAA_STAAC      ----------------------------------------------------------------------
LTAA_STAA8      ----------------------------------------------------------------------
LTAA_STAA3      ----------------------------------------------------------------------
HIAT1_MOUSE     LIGALSDVWGRKSFLLLTVFF-------TCAPIPLMKISPW-WYFAVISVSGVFAV-TFSVVFAYVADIT
SPNS1_BOVIN     VFGYLGDRYNRKYLMCGGIAFW----SLVTLGSSFIPRERFWXXXXXXXXXXXXEASYSTIAPTLIADLF
LTAA_STAAW      ----------------------------------------------------------------------
LTAA_STAAS      ----------------------------------------------------------------------
LTAA_STAAR      ----------------------------------------------------------------------
LTAA_STAAN      ----------------------------------------------------------------------
LTAA_STAAM      ----------------------------------------------------------------------
LTAA_STAAB      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGKERAKSLGVIEASNGLGKVASPILGALIGLIAWWYXXXXXXXXXXXXXLGVWFICKEPETNKQPKKVN
YITG_BACSU      KGAQESKVLGLVEASNGMGKVLSPIIGSLIALLVWYGAFFAFPVFCIISIVLTWIFIXXXXXXXXXXXIG
BBEX_BACSU      ----------------------------------------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
YFMO_BACSU      XXXXXAQAIILYEAALGLGISVGPLAGGELGSISWRAPFFGVSVLMFIALIAISFML--PKLPKPAKRVG
BMR2_BACSU      TLKERSKAMGYVSAA-------------------------------------------------------
MDTL_SALTI      DEHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPW----------------------------------
MDTL_SALSV      DEHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPW----------------------------------
MDTL_SALPK      DEHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPW----------------------------------
MDTL_SALPA      DEHRRAKVLSLLNGITCIVPVLAPVMGHLIMLRFPW----------------------------------
MDTL_SALEP      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALDC      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALAR      DERRRAKVLSLLNGITCIVPVLAPVLGHLIMLRFPW----------------------------------
MDTL_SALTY      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALPC      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALPB      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALNS      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALHS      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALCH      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
MDTL_SALA4      DEHRRAKVLSLLNGITCIVPVLAPVVGHLIMLRFPW----------------------------------
YAJR_ECOLI      REQNRTKAMAFIGVSFGIAMVLGPIITHKLGLHALFW--MIAILATTGIALTIWVV-----PNSSTHVLN
MDTL_ECOUT      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLLFILKEPTTSDKPRENS
MDTL_ECOK1      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLLFILKEPTTSDKPRENS
MDTL_ECO45      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIALLMLLFILKEPTTSDKPRENS
MDTL_ECO27      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTMATMGIAVLMLLFILKEPTTSDKPRENS
QACA_STAAU      ENKERATALAVWSIASSIGAVFGPIIGALLEQFSW-----------------------------------
QACA_STAAM      ENKERATALAVWSIASSIGAVFGPIIGALLEQFSW-----------------------------------
MDTL_SHISS      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_SHIFL      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_SHIDS      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_SHIBS      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_SHIB3      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ESCF3      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOSM      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOSE      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOLU      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOLI      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOLC      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOL6      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLNFPW----------------------------------
MDTL_ECOL5      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOHS      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECODH      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECOBW      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECO8A      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECO81      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLNFPW----------------------------------
MDTL_ECO7I      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECO5E      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECO57      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECO55      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_ECO24      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
MDTL_SHIF8      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPW----------------------------------
YVMA_BACSU      TGNERGSAMGTYQMLLSVAPAIAPVLXXXXXXXXXXXXXXWILAAISIVLLSITFPKDSPTESMQQAKGN
MDTL_VIBPA      DDERRAKVLSMLNGITCIIPVIAPVIGHLIMLKFPW----------------------------------
Y466_BUCAI      REENRVKSIAAIGVSFAISFLIAVVSGPII----------------------------------------
TCR1_ECOLX      DGDERARHFGFMSACFGFGMVAGPVLGGLMG---------------------------------------
BMR1_BACSU      TIKTRPKALGYMSAA-------------------------------------------------------
YFIU_BACSU      PKEKQGKALGLLGAMNGMAAVLGPNIGSFL----------------------------------------
MDTL_SHEON      DDKRRAKVLSMVNGVTCIIPVIAPVIGHLIMLKFPW----------------------------------
YCNB_BACSU      PIEKRGQAMGMVGLVISFAPAIGPTLGWAVEAFSW-----------------------------------
MDTD_PECCP      PRDQYMAAMTFVTLPGQIGPLMGPALGGLVEYASWHWIFLINLPVGIIGALATWFL--------------
MDTL_KLEP3      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKYPW----------------------------------
MDTL_SHESA      DDKRRAKVLSMVNGVTCIIPVIAPVIGHLIMLRFPW----------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
MDTL_CITK8      DDRRRAKVLSLLNGITCIVPVLAPVLGHLIMLKFPW----------------------------------
YJJL_ECOLI      NIKERGRPMGFFNAASTIGAVSPPILAAMMLVMGWRGMFITIGVLGIFLAIG-WYMLYRNREHVELTAVE
YHCA_BACSU      PPESRGKGMGIF----GLAMMFAPAVG-------------------------------------------
MDTL_KLEP7      DDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKYPW----------------------------------
MDTD_YERE8      PREQYMSAMAFVTLPGQIGPLVGPALGGFLVEYASWH---------------------------------
SPNS3_DANRE     AGSKRTLMISFIPVGSGLGYIIGATVADATGDWRW-----------------------------------
SPNS1_XENLA     LADQRTRMLSFFYFATPVGCGLGYIVGSEMTSAAWHWALRVTPXXXXXXXXXXIFVAEEPPRGALERKTD
MDTD_SERP5      PREQYMAAMTFVTLPGQIGPLMGPALGGFLVQYASWH---------------------------------
YWOG_BACSU      PAKRRGEGLGYFAMSMNLAMAIGPFLGLNLMRVVSFPVFFTAFALFMVAGLLVSFLIKVPQSKDSGTTVF
TCRB_BACSU      PKENRGKAFGLIGSLVAMGEGVGPAIGGMVAHYIHW----------------------------------
SPIN_DROME      VHDMRSKMLALIPVGSGLGYI-------------------------------------------------
MDTD_YERPY      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_YERPP      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_YERPN      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_YERPG      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_YERPE      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_YERPB      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_YERPA      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_YERP3      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
YO378_YEAST     KGRRKNMVFSLFGASAPGGFFLGAVFSSMLGQLAWW----------------------------------
SPNS2_XENTR     TKNTRTLMLSVFYFAIPLGSGLGYITGSSVKQVAWWALRVSPVLGVITGTLLLIFVPTAKRGHAEQLKGS
PMRA_LACLA      PKDKSGYALGTLATAMVSGTLIGPSLG---GLLAEWF---------------------------------
MDTD_YERPS      PREQYMAAMAFVTLPGQIGPLVGPALGGFLVEFASWH---------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
BCR_HAEIN       SKDQLSKVMSTITLVFMLAPLVAPIIGGIVKFFHWHAIFYVISLVGXXXXXXVFFII--PETHKKPLRLN
TCR_STRPN       PKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHW----------------------------------
TCR_STAHY       PKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHW----------------------------------
TCR_BACSU       PKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHW----------------------------------
TCR_BACST       PKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHW----------------------------------
TCR_BACCE       PKENRGKAFGLIGSIVAMGEGVGPAIGGMIAHYIHW----------------------------------
SPNS3_MOUSE     VKDQRTCALAVIPVGSGLGYVLGSTVAELTGNWRW-----------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
TCR2_ECOLX      SASQRVKWFGWLGAS-------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
EXUT_BACSU      PPTQRASVIGVTNSGTPLGAISGPIVG-MIAVAFSWKVSFVLIMIIGLIWAVLWFKFKPQETIKEAPAIK
TCR_STRAG       PKENRGKAFGLIGSIVAMGEGVGPIVGMIAHYIHWSY---------------------------------
SPNS1_XENTR     LADQRSRMLSFFYFATPVGCGLGYIAGSKVTSTAWHWALRVTPGLGLVAVLLLIFVAKEPPR--------
SPNS1_DANRE     VKEKRTNMLSIFYFAIPVGSGMGYIVGSKVDTVA------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
BMR3_BACSU      PPEKRGKMSGMFGAVFGLSSVLGPLLGAIIDSISW-----------------------------------
YAN6_SCHPO      PLQTRPYYTGCMGVTWGLASVMGPLIGGAISQKASW----------------------------------
SPNS2_DANRE     TNNKRTVMLSV-----------------------------------------------------------
EMRB_HAEIN      PPEKRGMALAFWSMTIVVAPIFGPILGGWISDNIHW----------------------------------
YIM0_YEAST      TKVERGGYVGLVAGFQVVGTAFGALIGA--GLSSKW----------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      QPSQIIKGMGIATAGLAASQMLGLPIGGFLASFTWFFVXXXXXXXXXXXXXXVMPGIRPSEPLARPSIVN
MDTD_ECOLU      ----------------------------------------------------------------------
YWFA_BACSU      PYTYRGKVMGLIVSSWSLALIFGVPLGSFIGGVRWTFWIFALMGXXXXXXXXXEMRRHAQHKNSGKEEIE
YI32_SCHPO      PLQTRPYYTGCMGVTWGVASVMGPLIGGAISQNTTW----------------------------------
YYBF_BACSU      EPGSLGSAMGLYISGNAIGAVFGRIVSGLLSEYLNWHMAMGTIGVISLIASVIFFINLPPSRHFTPRKL-
Y450_BUCAP      RKENRIKSISIIGVSFAISVVSAPIIAENFGFFS------------------------------------
SPNS2_MOUSE     TKNTRTLMLSVFYFAIPLGSGLGYITGSSV----------------------------------------
SPNS2_HUMAN     TKNTRTLMLSVFYFAIPLGSGLGYITGSSV----------------------------------------
EMRB_ECOLI      PPAKRSIALALWSMTVIVAPICGPILGGYI----------------------------------------
EMRB_ECO57      PPAKRSIALALWSMTVIVAPICGPILGGYI----------------------------------------
YNFM_ECOLI      HPSFVAFSMGLYISGNSIGGMSGRLIGVFTDFFNWRIALAAIGCFALASALMFWKILPESRTSLRPKTL-
SPNS3_HUMAN     VRDQRTRVLAVIPVGSGLGYVLGSAVTMLTGNWRW-----------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
AQR1_YEAST      LKHERGTFVGATSGFVLLGQCFGSLIGAVL----------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
LTAA_STAS1      ----------------------------------------------------LYYFVKVRLTNYNTRPVK
Y411_BUCBP      LPHNRIKIMGLLGVSFGISFFLAVILSPII----------------------------------------
PHDK_NOCSK      PKARRAQMVSIAFAGVGVGSIIGAYLAAVIPTLGW-----------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YCXA_BACSU      FDTHKGLALAILTNANSAGLLLSPIWAA------------------------------------------
TCR7_VIBAN      EGS-RARWFGYMGACYGAGMIAGPALGGMLGGISAHAPXXXXXXXXXXXXXXXCIFLKETHHSHKPVRIK
LPLT_KLEP7      TGDKLVKANGLMESST----IAAILLGSMAGILADWH---------------------------------
LPLT_KLEP3      TGDKLVKANGLMESST----IAAILLGSMAGILADWH---------------------------------
BAIG_EUBSP      PQEETGKAFGLYMLISSGAVVVGPTCGGLIMNAAGW----------------------------------
YDHC_ECOLI      PSQKVNRIFAAIMPLVGLSPALAPLLGS------------------------------------------
SO1A1_RAT       KSENSPLYIGILE----MGKVAGPIFGLLLG---------------------------------------
YJA1_SCHPO      TPDERGKAVAVMSLAPLLGPTIGPVVSGFI----------------------------------------
YHJO_BACSU      PESRRSEVFAVINAIYSTGLTAGPLVGMLL----------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
TCR3_ECOLX      DGEDRARHFGLMSA--------------------------------------------------------
SO1A3_RAT       KSENSPLYIGILET----GKMIGPIFGLLLGSFAWWIGFLVCAGVNILISIPFFFFAKEESTEKRPRKKN
SO1A6_MOUSE     KSENSPLYIGILE----VGKMIGPILGYLMG---------------------------------------
SO1A5_RAT       KSENSPLYIGILET----GKVFGPIVGLLLG---------------------------------------
LPLT_SHIFL      TGSKLVKANGLMEAS----AIAAILLGSVAGVLADWH---------------------------------
LPLT_SHIF8      TGSKLVKANGLMEAS----AIAAILLGSVAGVLADWH---------------------------------
LPLT_CITK8      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
YQJV_BACSU      EEKTRLLVFNLRYAAINIGVVFGPVLGLYFG---------------------------------------
YN41_SCHPO      PNRYRGTAITIFAAVIFVGPLVAPIVGGFLSYLGWRWTEYITSFMGFLSIILIYLFCEETYLKTTENKVQ
Y1560_METJA     PKTRLGEYMGIFNSA-------------------------------------------------------
SO1A5_MOUSE     KSENSPLYIGILES----GKMIGPIVGLLLG---------------------------------------
LPLT_YERPY      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERPS      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERPP      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERPN      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERPG      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERPE      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERPB      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERPA      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_YERP3      SGEQLVKANGMMEAST----IAAILLGSVAGILADWH---------------------------------
LPLT_SHISS      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SHIDS      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SHIBS      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SHIB3      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOUT      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOSM      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOSE      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOLU      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOLI      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOLC      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOL6      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOL5      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOK1      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOHS      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECODH      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECOBW      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO8A      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO81      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO7I      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO5E      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO57      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO55      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO45      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO27      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_ECO24      TGSKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
SO1A1_MOUSE     KSENSPLYIGILE----MGKIVGPIIGLLLG---------------------------------------
PMRA_STRR6      PKEKSGSALGTLSTGVVAGTLTGPFIGGFI----------------------------------------
PMRA_STRPN      PKEKSGSALGTLSTGVVAGTLTGPFIGGFI----------------------------------------
MFSD9_MOUSE     TEKERPLVLGQFNTASGVGFILGPVVGGYL----------------------------------------
LPLT_SERP5      SGEKLVKANGLMEAST----IAAILIGSVAGILADWH---------------------------------
LPLT_SALTY      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALTI      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALSV      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALPK      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALPC      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALPB      TGDKLVKANGMMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALPA      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALNS      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALHS      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALG2      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALEP      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALDC      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALCH      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALA4      TGDKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
YEBQ_ECOLI      PQRFLGRGMGINSFIVAVSSAAGPTIAAAILSIASW----------------------------------
TPO4_YEAST      DVDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWIQLIAGGLILP--FIALMPETHK------
SMVA_SALTY      ----------------------------------------------------------------------
LPLT_YERE8      SGEQLVKANGMMEAST----IAAILLGSVAGVLADWH---------------------------------
LPLT_SALAR      TGNKLVKANGLMEAST----IAAILLGSVAGVLADWH---------------------------------
Y532_BUCBP      HPSVLSFSIGLYISGNTIGGFLGRFLSSLFSEYFSWALEFISFLAFTSAVLFVYLLPKSKNFCSSPLDLR
SPNS1_HUMAN     VADQRSRMLSIIPVGSGLGYIAGSKVKDMAGDWHW-----------------------------------
MMLH_RALEJ      DSRHRGKAIGFVQS--------------------------------------------------------
YJHB_ECOLI      PKNLQSKASAFLVSGFSVGNIAAQIIPQFAEVYGW-----------------------------------
Y588_BUCAI      HPNSLSFCMGLYISGNTIGGFLGRLLSSIL----------------------------------------
VACHT_DANRE     TEEERSRALGIALAFISFGSLVAPPFGGIL----------------------------------------
MFS10_MOUSE     SPPTRSQGMAVIGVAFSLAFTLGPMLGAFLSMVPWISLLFAISDM-------LFIFCFLPETLPQEKRAS
MFS10_HUMAN     SPLARSQGMAVIGVAFSLGFTLGPMLGASLPL--------------------------------------
LTAA_STAHJ      -------------------------------------------------------------TNYNTKPVS
LPLT_PHOLL      DGDRLVKANGLMEASTIIAILTGSVVGGFL----------------------------------------
LPLT_ENT38      TGDKLVKANGLMESST----IAAILLGSVAGVLADWH---------------------------------
HIAT1_HUMAN     QEHERSMAYGLVSATFAASLVTSPAIGAYLGRV-------------------------------------
YVKA_BACSU      SEKRLPKVXXXXXXXXXXXXXXXPFIGSLIDSFSW-----------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
YDIM_ECOLI      ----------------------------------------------------------------------
TUB3_AGRVI      PARRRAAVTALFMAAAPLSTVGSPISGALMGLAGWWMFLIEAAPALILGVVVLFFLTDRPEKAKWTEEER
LTAA_STAAC      ----------------------------------------------------------------------
LTAA_STAA8      ----------------------------------------------------------------------
LTAA_STAA3      ----------------------------------------------------------------------
HIAT1_MOUSE     QEHERSMAYGLVSATFAASLVTSPAIGAYLG---------------------------------------
SPNS1_BOVIN     VADQRSRMLSVIPVGSGLGYIAGSKVKDVAGDWHW-----------------------------------
LTAA_STAAW      ----------------------------------------------------------------------
LTAA_STAAS      ----------------------------------------------------------------------
LTAA_STAAR      ----------------------------------------------------------------------
LTAA_STAAN      ----------------------------------------------------------------------
LTAA_STAAM      ----------------------------------------------------------------------
LTAA_STAAB      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EYVGSIKNIFKKKSPLLLTSFFAGSAALLILFGVLFFLSDYLEKKFGLDGVIKGAALAIPVLFMSTTSYV
YITG_BACSU      QYAKGLLSVFKHEGRWLFTAYLAGATCLFTLFGILFYLSDVLEKTYDTDGVKKGLILAIPLLVMCVTSYT
BBEX_BACSU      -----------------IRSSLSGVSLCFWLFGVLFYLSDTLENKYAIDGVAKGGLLAIPLLFLSTSSFI
YMFD_BACSU      ----------------------------------------------------------------------
YFMO_BACSU      VF-DAMKALKYKGLLTMAVSAFLYNFGFFILLAYSPFVLDLDE--HGLGYVFFGWGLLLAITSVFTAPLV
BMR2_BACSU      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
YAJR_ECOLI      RESGMVKGSFSKAEPRLLKLNFGIMCLHILLMSTFVALPGQLDAGFPAAEHWKVYLATMLIAFGSVVPFI
MDTL_ECOUT      E---------------------------------------------------------------------
MDTL_ECOK1      E---------------------------------------------------------------------
MDTL_ECO45      E---------------------------------------------------------------------
MDTL_ECO27      E---------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
YVMA_BACSU      VFA-HYKSIFTNRTGVILTLSFV---LFFIYFAVIVYLPILLTEHYHIDVGIAGL-LYLPLALSTIAG--
MDTL_VIBPA      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
TCR1_ECOLX      ----------------------------------------------------------------------
BMR1_BACSU      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
YJJL_ECOLI      QAYLNAGSVNARRDPLSFASLFRNRTMWGMMLGYLAWLPGYLQTAYNLDLKSTGLMAAIPFLFMLVNGYV
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
SPNS3_DANRE     ----------------------------------------------------------------------
SPNS1_XENLA     R-------------PLTNTSWSSDMKALL-----------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
YWOG_BACSU      RF--AFSDMFEKGAGLFISFCYSTVTSYLSVFAKSVDLSD-----------ISGYFFVCFAVTMMIARPF
TCRB_BACSU      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
YO378_YEAST     ----------------------------------------------------------------------
SPNS2_XENTR     SWIRDMRGLIKNRS--------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
BCR_HAEIN       IIARNFLLLWKQKEVL------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_STAHY       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
TCR2_ECOLX      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
EXUT_BACSU      AETSPGEKIFYLKQKTVLFTAFAFFAYNYILFFFLTWFPSYLVDERGLSVESMSVITVIP----------
TCR_STRAG       ----------------------------------------------------------------------
SPNS1_XENTR     ---GALER--KSDRPLTNTSWFSDVKALL-----------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
SPNS2_DANRE     ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      PY----RELFSPKTSVILLAYFLFQTGNFASFS---FLGTWLSADYHLTVSQIGAAMLVLGLGNMLGSLI
MDTD_ECOLU      ----------------------------------------------------------------------
YWFA_BACSU      EPAGTFRDALKPRVPVYITITFCN---MIGFYGMYSFLGTYLQDVFTGGNTAAGLFIMIYGIGFS-MSVI
YI32_SCHPO      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
Y450_BUCAP      ----------------------------------------------------------------------
SPNS2_MOUSE     ----------------------------------------------------------------------
SPNS2_HUMAN     ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
YNFM_ECOLI      -FINFRLHWRDRGLPLLFAEGF-------LLMGSFVTLFNYI----GYRLMLSPWHVSQAVVGLLSLAYL
SPNS3_HUMAN     ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
LTAA_STAS1      QQLGQIVDVTKRHM-ILFPGILLQGASITALVPIL---PTYATKVVGVSTVFGGIGCAISMLFLSKIIDK
Y411_BUCBP      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YCXA_BACSU      ----------------------------------------------------------------------
TCR7_VIBAN      PFVXXXXXXXXXXXXXXFAVFFQVPAALWVIYG-----EDRFQWNTATVGLSLAAFGATHAIFQ---AFV
LPLT_KLEP7      ----------------------------------------------------------------------
LPLT_KLEP3      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
SO1A1_RAT       ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
YHJO_BACSU      ----------------------------------------------------------------------
YFKF_BACSU      ----------------------------------------------------------------------
TCR3_ECOLX      ----------------------------------------------------------------------
SO1A3_RAT       R--GITKDFFPLKSPVLQPDLHAVHPYKVLAFNIYFFLPKYLENQYG-----------------------
SO1A6_MOUSE     ----------------------------------------------------------------------
SO1A5_RAT       ----------------------------------------------------------------------
LPLT_SHIFL      ----------------------------------------------------------------------
LPLT_SHIF8      ----------------------------------------------------------------------
LPLT_CITK8      ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
YN41_SCHPO      EY--------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
SO1A5_MOUSE     ----------------------------------------------------------------------
LPLT_YERPY      ----------------------------------------------------------------------
LPLT_YERPS      ----------------------------------------------------------------------
LPLT_YERPP      ----------------------------------------------------------------------
LPLT_YERPN      ----------------------------------------------------------------------
LPLT_YERPG      ----------------------------------------------------------------------
LPLT_YERPE      ----------------------------------------------------------------------
LPLT_YERPB      ----------------------------------------------------------------------
LPLT_YERPA      ----------------------------------------------------------------------
LPLT_YERP3      ----------------------------------------------------------------------
LPLT_SHISS      ----------------------------------------------------------------------
LPLT_SHIDS      ----------------------------------------------------------------------
LPLT_SHIBS      ----------------------------------------------------------------------
LPLT_SHIB3      ----------------------------------------------------------------------
LPLT_ECOUT      ----------------------------------------------------------------------
LPLT_ECOSM      ----------------------------------------------------------------------
LPLT_ECOSE      ----------------------------------------------------------------------
LPLT_ECOLU      ----------------------------------------------------------------------
LPLT_ECOLI      ----------------------------------------------------------------------
LPLT_ECOLC      ----------------------------------------------------------------------
LPLT_ECOL6      ----------------------------------------------------------------------
LPLT_ECOL5      ----------------------------------------------------------------------
LPLT_ECOK1      ----------------------------------------------------------------------
LPLT_ECOHS      ----------------------------------------------------------------------
LPLT_ECODH      ----------------------------------------------------------------------
LPLT_ECOBW      ----------------------------------------------------------------------
LPLT_ECO8A      ----------------------------------------------------------------------
LPLT_ECO81      ----------------------------------------------------------------------
LPLT_ECO7I      ----------------------------------------------------------------------
LPLT_ECO5E      ----------------------------------------------------------------------
LPLT_ECO57      ----------------------------------------------------------------------
LPLT_ECO55      ----------------------------------------------------------------------
LPLT_ECO45      ----------------------------------------------------------------------
LPLT_ECO27      ----------------------------------------------------------------------
LPLT_ECO24      ----------------------------------------------------------------------
SO1A1_MOUSE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
MFSD9_MOUSE     ----------------------------------------------------------------------
LPLT_SERP5      ----------------------------------------------------------------------
LPLT_SALTY      ----------------------------------------------------------------------
LPLT_SALTI      ----------------------------------------------------------------------
LPLT_SALSV      ----------------------------------------------------------------------
LPLT_SALPK      ----------------------------------------------------------------------
LPLT_SALPC      ----------------------------------------------------------------------
LPLT_SALPB      ----------------------------------------------------------------------
LPLT_SALPA      ----------------------------------------------------------------------
LPLT_SALNS      ----------------------------------------------------------------------
LPLT_SALHS      ----------------------------------------------------------------------
LPLT_SALG2      ----------------------------------------------------------------------
LPLT_SALEP      ----------------------------------------------------------------------
LPLT_SALDC      ----------------------------------------------------------------------
LPLT_SALCH      ----------------------------------------------------------------------
LPLT_SALA4      ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
SMVA_SALTY      ----------------------------------------------------------------------
LPLT_YERE8      ----------------------------------------------------------------------
LPLT_SALAR      ----------------------------------------------------------------------
Y532_BUCBP      KIL--LYFIFQWRDPVLSKLFFMG----CILMGSFITLFNYV----------------------------
SPNS1_HUMAN     ----------------------------------------------------------------------
MMLH_RALEJ      ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
MFS10_MOUSE     SVTLGFHTAAHLLSPLALLRFAA-----------------------------------------------
MFS10_HUMAN     ----------------------------------------------------------------------
LTAA_STAHJ      EQLGQIVDVMKRHLVLFPGILLQGAS----ISALLPILPTYATKVVGVSTIXXXXXCAFSMLFLSKI---
LPLT_PHOLL      ----------------------------------------------------------------------
LPLT_ENT38      ----------------------------------------------------------------------
HIAT1_HUMAN     ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
YDIM_ECOLI      ----------------------------------------------------------------------
TUB3_AGRVI      NWLVKTMNAEQAGRGTASHSVMAGLADILVYFGTLGIWAPQIIKQFGLSAIEVGFINAVPGIF-AVVAMV
LTAA_STAAC      ----------------------------------------------------------------------
LTAA_STAA8      ----------------------------------------------------------------------
LTAA_STAA3      ----------------------------------------------------------------------
HIAT1_MOUSE     ----------------------------------------------------------------------
SPNS1_BOVIN     ----------------------------------------------------------------------
LTAA_STAAW      ----------------------------------------------------------------------
LTAA_STAAS      ----------------------------------------------------------------------
LTAA_STAAR      ----------------------------------------------------------------------
LTAA_STAAN      ----------------------------------------------------------------------
LTAA_STAAM      ----------------------------------------------------------------------
LTAA_STAAB      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TGAXXXXXXXXXXXXXXXGHGLIGASLVTLPLFNNVYIFFAGISVAGIGTGLVLPCLNTLITSSTNKDER
YITG_BACSU      TGSKIGQKQSLMKKLIVLGLAFMTVSYAALSFIENXXXXXXXXXXXXXXXXXXXPCVNSFITGAVGKERR
BBEX_BACSU      AGKKIGKDKGRMKFCVVTGMILLTLSFIALWWNHSFYFLFVFLSFGGIGIGMALPALDALITEGIESEQC
YMFD_BACSU      ----------------------------------------------------------------------
YFMO_BACSU      HKALGTVRSLVVLFI------AFAAILVIMGIWDHQTLIITCIVVAGAVLGMVNTIMTTAVMGSA-PVER
BMR2_BACSU      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
YAJR_ECOLI      IYAEVKRKMKQVFVFCV---GLIVAEIVLWNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYK
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
YVMA_BACSU      TFLFKRIQAKIGLHTLFIGSNVIAASIILFAVTHSVSLVLMALTLAGISMGVIPPLYSTMITNEFEHN-R
MDTL_VIBPA      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
TCR1_ECOLX      ----------------------------------------------------------------------
BMR1_BACSU      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
YJJL_ECOLI      T---------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
SPNS3_DANRE     ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
YWOG_BACSU      TGKLFDKVGPGIVIYPSILIFSVGLCMLSF-THSGLMLLLSG-AVIGLGYGSIVPCMQTLAIQKSPAHRS
TCRB_BACSU      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
YO378_YEAST     ----------------------------------------------------------------------
SPNS2_XENTR     ----------------------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_STAHY       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
TCR2_ECOLX      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
TCR_STRAG       ----------------------------------------------------------------------
SPNS1_XENTR     ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
SPNS2_DANRE     ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      --GSRVSEKLGMFKTLISGMLLMGALYFALPFFPNLFLVEAGFFLTFFTAGIIFP-LMMGVFQSIAPNAR
MDTD_ECOLU      ----------------------------------------------------------------------
YWFA_BACSU      TGKIADRIGKMRSLLIAL--GVISVLLACLPYAASMFLLIASLFIWGLMQXXXXXXXXXXXXDCSER-HR
YI32_SCHPO      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
Y450_BUCAP      ----------------------------------------------------------------------
SPNS2_MOUSE     ----------------------------------------------------------------------
SPNS2_HUMAN     ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
YNFM_ECOLI      TGTWSSPKAGTMTTRYGRGPVMLFSTGVMLTLFSSLWLIFAGMLLFSAG---------------------
SPNS3_HUMAN     ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
LTAA_STAS1      HGTLFMYWVIFG------GFVLYTLMIFALSLITNITIVWVLAVFIGLMYGILLPAWNTFMASHIHSDEQ
Y411_BUCBP      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YCXA_BACSU      ----------------------------------------------------------------------
TCR7_VIBAN      TG--PLSSRLGERRTLLFGMAADGTGFVLLAFATQGWMVFPILLLLAAG-GVGMPALQAMLSNNVSSNKQ
LPLT_KLEP7      ----------------------------------------------------------------------
LPLT_KLEP3      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
SO1A1_RAT       ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
YHJO_BACSU      ----------------------------------------------------------------------
YFKF_BACSU      ---------------------VMGGSIVILSLFGSVWVWFLLRLFIGIGDHMLHFSTQTWVTSMSSKQNR
TCR3_ECOLX      ----------------------------------------------------------------------
SO1A3_RAT       ----------------------------------------------------------------------
SO1A6_MOUSE     ----------------------------------------------------------------------
SO1A5_RAT       ----------------------------------------------------------------------
LPLT_SHIFL      ----------------------------------------------------------------------
LPLT_SHIF8      ----------------------------------------------------------------------
LPLT_CITK8      ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
SO1A5_MOUSE     ----------------------------------------------------------------------
LPLT_YERPY      ----------------------------------------------------------------------
LPLT_YERPS      ----------------------------------------------------------------------
LPLT_YERPP      ----------------------------------------------------------------------
LPLT_YERPN      ----------------------------------------------------------------------
LPLT_YERPG      ----------------------------------------------------------------------
LPLT_YERPE      ----------------------------------------------------------------------
LPLT_YERPB      ----------------------------------------------------------------------
LPLT_YERPA      ----------------------------------------------------------------------
LPLT_YERP3      ----------------------------------------------------------------------
LPLT_SHISS      ----------------------------------------------------------------------
LPLT_SHIDS      ----------------------------------------------------------------------
LPLT_SHIBS      ----------------------------------------------------------------------
LPLT_SHIB3      ----------------------------------------------------------------------
LPLT_ECOUT      ----------------------------------------------------------------------
LPLT_ECOSM      ----------------------------------------------------------------------
LPLT_ECOSE      ----------------------------------------------------------------------
LPLT_ECOLU      ----------------------------------------------------------------------
LPLT_ECOLI      ----------------------------------------------------------------------
LPLT_ECOLC      ----------------------------------------------------------------------
LPLT_ECOL6      ----------------------------------------------------------------------
LPLT_ECOL5      ----------------------------------------------------------------------
LPLT_ECOK1      ----------------------------------------------------------------------
LPLT_ECOHS      ----------------------------------------------------------------------
LPLT_ECODH      ----------------------------------------------------------------------
LPLT_ECOBW      ----------------------------------------------------------------------
LPLT_ECO8A      ----------------------------------------------------------------------
LPLT_ECO81      ----------------------------------------------------------------------
LPLT_ECO7I      ----------------------------------------------------------------------
LPLT_ECO5E      ----------------------------------------------------------------------
LPLT_ECO57      ----------------------------------------------------------------------
LPLT_ECO55      ----------------------------------------------------------------------
LPLT_ECO45      ----------------------------------------------------------------------
LPLT_ECO27      ----------------------------------------------------------------------
LPLT_ECO24      ----------------------------------------------------------------------
SO1A1_MOUSE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
MFSD9_MOUSE     ----------------------------------------------------------------------
LPLT_SERP5      ----------------------------------------------------------------------
LPLT_SALTY      ----------------------------------------------------------------------
LPLT_SALTI      ----------------------------------------------------------------------
LPLT_SALSV      ----------------------------------------------------------------------
LPLT_SALPK      ----------------------------------------------------------------------
LPLT_SALPC      ----------------------------------------------------------------------
LPLT_SALPB      ----------------------------------------------------------------------
LPLT_SALPA      ----------------------------------------------------------------------
LPLT_SALNS      ----------------------------------------------------------------------
LPLT_SALHS      ----------------------------------------------------------------------
LPLT_SALG2      ----------------------------------------------------------------------
LPLT_SALEP      ----------------------------------------------------------------------
LPLT_SALDC      ----------------------------------------------------------------------
LPLT_SALCH      ----------------------------------------------------------------------
LPLT_SALA4      ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
SMVA_SALTY      ----------------------------------------------------------------------
LPLT_YERE8      ----------------------------------------------------------------------
LPLT_SALAR      ----------------------------------------------------------------------
Y532_BUCBP      ----------------------------------------------------------------------
SPNS1_HUMAN     ----------------------------------------------------------------------
MMLH_RALEJ      ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
MFS10_MOUSE     ----------------------------------------------------------------------
MFS10_HUMAN     ----------------------------------------------------------------------
LTAA_STAHJ      ---IDKNSKGFMYAVIFTGFILFTAFIFGLSLVTNILIVWIVAIFIGLMYGILLPAWNTFMAGQIDPAEQ
LPLT_PHOLL      ----------------------------------------------------------------------
LPLT_ENT38      ----------------------------------------------------------------------
HIAT1_HUMAN     ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YUSP_BACSU      ------------------------------------------MAIIGLGMGLVMPILTLALQESFSKEEL
YDIM_ECOLI      ----------------------------------------------------------------------
TUB3_AGRVI      LWARHSDRTGERTWHVVXXXXXXXXXXXXXXXXTSVFMVLIALTIVNVGISCSKPPLWSMPTMFLSGPAA
LTAA_STAAC      --------------------------IFTLSMIVNIHILWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
LTAA_STAA8      --------------------------IFTLSMIVNIHILWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
LTAA_STAA3      --------------------------IFTLSMIVNIHILWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
HIAT1_MOUSE     ----------------------------------------------------------------------
SPNS1_BOVIN     ----------------------------------------------------------------------
LTAA_STAAW      --------------------------IFTLSMIVNIHIVWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
LTAA_STAAS      --------------------------IFTLSMIVNIHIVWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
LTAA_STAAR      --------------------------IFTLSMIVNIHIVWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
LTAA_STAAN      --------------------------IFTLSMIVNIHIVWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
LTAA_STAAM      --------------------------IFTLSMIVNIHIVWIIALAIGLMYGILLPAWNTFMARFIKSDEQ
LTAA_STAAB      --------------------------IFTLSMIVNIHIVWIIALAIGLMYGILLPAWNTFMARFIKSDEQ


                         .         .         .         .         *         .         .:420
query           GLVTSLYGSVRFLGVAAGPPLFGWLVEKGSDMMFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YITG_BACSU      GFVTSLYGSVRFLGVAIGPPIFGRLMQWSRPGMF------------------------------------
BBEX_BACSU      GTISSFYNSMRFIGVALGPPVFAALMSNANWIIF------------------------------------
YMFD_BACSU      ----------------------------------------------------------------------
YFMO_BACSU      SIASSAYSSVRFIGGALAPWIAGMLSE-------------------------------------------
BMR2_BACSU      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
MDTL_SALSV      ----------------------------------------------------------------------
MDTL_SALPK      ----------------------------------------------------------------------
MDTL_SALPA      ----------------------------------------------------------------------
MDTL_SALEP      ----------------------------------------------------------------------
MDTL_SALDC      ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
MDTL_SALTY      ----------------------------------------------------------------------
MDTL_SALPC      ----------------------------------------------------------------------
MDTL_SALPB      ----------------------------------------------------------------------
MDTL_SALNS      ----------------------------------------------------------------------
MDTL_SALHS      ----------------------------------------------------------------------
MDTL_SALCH      ----------------------------------------------------------------------
MDTL_SALA4      ----------------------------------------------------------------------
YAJR_ECOLI      GTAMGVYSTSQFLGVAIGGSLGGWI---------------------------------------------
MDTL_ECOUT      ----------------------------------------------------------------------
MDTL_ECOK1      ----------------------------------------------------------------------
MDTL_ECO45      ----------------------------------------------------------------------
MDTL_ECO27      ----------------------------------------------------------------------
QACA_STAAU      ----------------------------------------------------------------------
QACA_STAAM      ----------------------------------------------------------------------
MDTL_SHISS      ----------------------------------------------------------------------
MDTL_SHIFL      ----------------------------------------------------------------------
MDTL_SHIDS      ----------------------------------------------------------------------
MDTL_SHIBS      ----------------------------------------------------------------------
MDTL_SHIB3      ----------------------------------------------------------------------
MDTL_ESCF3      ----------------------------------------------------------------------
MDTL_ECOSM      ----------------------------------------------------------------------
MDTL_ECOSE      ----------------------------------------------------------------------
MDTL_ECOLU      ----------------------------------------------------------------------
MDTL_ECOLI      ----------------------------------------------------------------------
MDTL_ECOLC      ----------------------------------------------------------------------
MDTL_ECOL6      ----------------------------------------------------------------------
MDTL_ECOL5      ----------------------------------------------------------------------
MDTL_ECOHS      ----------------------------------------------------------------------
MDTL_ECODH      ----------------------------------------------------------------------
MDTL_ECOBW      ----------------------------------------------------------------------
MDTL_ECO8A      ----------------------------------------------------------------------
MDTL_ECO81      ----------------------------------------------------------------------
MDTL_ECO7I      ----------------------------------------------------------------------
MDTL_ECO5E      ----------------------------------------------------------------------
MDTL_ECO57      ----------------------------------------------------------------------
MDTL_ECO55      ----------------------------------------------------------------------
MDTL_ECO24      ----------------------------------------------------------------------
MDTL_SHIF8      ----------------------------------------------------------------------
YVMA_BACSU      GSAIGMFNFIRYTGMAAGPMVSAYLL--------------------------------------------
MDTL_VIBPA      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
TCR1_ECOLX      ----------------------------------------------------------------------
BMR1_BACSU      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
MDTL_SHEON      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
MDTD_PECCP      ----------------------------------------------------------------------
MDTL_KLEP3      ----------------------------------------------------------------------
MDTL_SHESA      ----------------------------------------------------------------------
HSRA_ECOLI      ----------------------------------------------------------------------
MDTL_CITK8      ----------------------------------------------------------------------
YJJL_ECOLI      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
SPNS3_DANRE     ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
YWOG_BACSU      GXXXXXXXXXXDSGIAVGSYVFGLFV--------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
SPIN_DROME      ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
YO378_YEAST     ----------------------------------------------------------------------
SPNS2_XENTR     ----------------------------------------------------------------------
PMRA_LACLA      ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
TCR_STRPN       ----------------------------------------------------------------------
TCR_STAHY       ----------------------------------------------------------------------
TCR_BACSU       ----------------------------------------------------------------------
TCR_BACST       ----------------------------------------------------------------------
TCR_BACCE       ----------------------------------------------------------------------
SPNS3_MOUSE     ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
TCR2_ECOLX      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
EXUT_BACSU      ----------------------------------------------------------------------
TCR_STRAG       ----------------------------------------------------------------------
SPNS1_XENTR     ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
SPNS2_DANRE     ----------------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YIM0_YEAST      ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
YCEJ_BACSU      GTIASLSNAAMYAGTTVGTSIAGFLYQ-------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
YWFA_BACSU      GKVMVFYSLASNLAVTLGSALMG-----------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
YYBF_BACSU      ----------------------------------------------------------------------
Y450_BUCAP      ----------------------------------------------------------------------
SPNS2_MOUSE     ----------------------------------------------------------------------
SPNS2_HUMAN     ----------------------------------------------------------------------
EMRB_ECOLI      ----------------------------------------------------------------------
EMRB_ECO57      ----------------------------------------------------------------------
YNFM_ECOLI      ----------------------------------------------------------------------
SPNS3_HUMAN     ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
LTAA_STAS1      EETWGVFNSVQGFGSMIGPLVGGLITE-------------------------------------------
Y411_BUCBP      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
YCXA_BACSU      ----------------------------------------------------------------------
TCR7_VIBAN      GALQGTLTSLTNLSSIAGP---------------------------------------------------
LPLT_KLEP7      ----------------------------------------------------------------------
LPLT_KLEP3      ----------------------------------------------------------------------
BAIG_EUBSP      ----------------------------------------------------------------------
YDHC_ECOLI      ----------------------------------------------------------------------
SO1A1_RAT       ----------------------------------------------------------------------
YJA1_SCHPO      ----------------------------------------------------------------------
YHJO_BACSU      ----------------------------------------------------------------------
YFKF_BACSU      GRNLSIYGLSFGLGFAAGP---------------------------------------------------
TCR3_ECOLX      ----------------------------------------------------------------------
SO1A3_RAT       ----------------------------------------------------------------------
SO1A6_MOUSE     ----------------------------------------------------------------------
SO1A5_RAT       ----------------------------------------------------------------------
LPLT_SHIFL      ----------------------------------------------------------------------
LPLT_SHIF8      ----------------------------------------------------------------------
LPLT_CITK8      ----------------------------------------------------------------------
EMRD_ECOLI      ----------------------------------------------------------------------
YQJV_BACSU      ----------------------------------------------------------------------
YN41_SCHPO      ----------------------------------------------------------------------
Y1560_METJA     ----------------------------------------------------------------------
SO1A5_MOUSE     ----------------------------------------------------------------------
LPLT_YERPY      ----------------------------------------------------------------------
LPLT_YERPS      ----------------------------------------------------------------------
LPLT_YERPP      ----------------------------------------------------------------------
LPLT_YERPN      ----------------------------------------------------------------------
LPLT_YERPG      ----------------------------------------------------------------------
LPLT_YERPE      ----------------------------------------------------------------------
LPLT_YERPB      ----------------------------------------------------------------------
LPLT_YERPA      ----------------------------------------------------------------------
LPLT_YERP3      ----------------------------------------------------------------------
LPLT_SHISS      ----------------------------------------------------------------------
LPLT_SHIDS      ----------------------------------------------------------------------
LPLT_SHIBS      ----------------------------------------------------------------------
LPLT_SHIB3      ----------------------------------------------------------------------
LPLT_ECOUT      ----------------------------------------------------------------------
LPLT_ECOSM      ----------------------------------------------------------------------
LPLT_ECOSE      ----------------------------------------------------------------------
LPLT_ECOLU      ----------------------------------------------------------------------
LPLT_ECOLI      ----------------------------------------------------------------------
LPLT_ECOLC      ----------------------------------------------------------------------
LPLT_ECOL6      ----------------------------------------------------------------------
LPLT_ECOL5      ----------------------------------------------------------------------
LPLT_ECOK1      ----------------------------------------------------------------------
LPLT_ECOHS      ----------------------------------------------------------------------
LPLT_ECODH      ----------------------------------------------------------------------
LPLT_ECOBW      ----------------------------------------------------------------------
LPLT_ECO8A      ----------------------------------------------------------------------
LPLT_ECO81      ----------------------------------------------------------------------
LPLT_ECO7I      ----------------------------------------------------------------------
LPLT_ECO5E      ----------------------------------------------------------------------
LPLT_ECO57      ----------------------------------------------------------------------
LPLT_ECO55      ----------------------------------------------------------------------
LPLT_ECO45      ----------------------------------------------------------------------
LPLT_ECO27      ----------------------------------------------------------------------
LPLT_ECO24      ----------------------------------------------------------------------
SO1A1_MOUSE     ----------------------------------------------------------------------
PMRA_STRR6      ----------------------------------------------------------------------
PMRA_STRPN      ----------------------------------------------------------------------
MFSD9_MOUSE     ----------------------------------------------------------------------
LPLT_SERP5      ----------------------------------------------------------------------
LPLT_SALTY      ----------------------------------------------------------------------
LPLT_SALTI      ----------------------------------------------------------------------
LPLT_SALSV      ----------------------------------------------------------------------
LPLT_SALPK      ----------------------------------------------------------------------
LPLT_SALPC      ----------------------------------------------------------------------
LPLT_SALPB      ----------------------------------------------------------------------
LPLT_SALPA      ----------------------------------------------------------------------
LPLT_SALNS      ----------------------------------------------------------------------
LPLT_SALHS      ----------------------------------------------------------------------
LPLT_SALG2      ----------------------------------------------------------------------
LPLT_SALEP      ----------------------------------------------------------------------
LPLT_SALDC      ----------------------------------------------------------------------
LPLT_SALCH      ----------------------------------------------------------------------
LPLT_SALA4      ----------------------------------------------------------------------
YEBQ_ECOLI      ----------------------------------------------------------------------
TPO4_YEAST      ----------------------------------------------------------------------
SMVA_SALTY      ----------------------------------------------------------------------
LPLT_YERE8      ----------------------------------------------------------------------
LPLT_SALAR      ----------------------------------------------------------------------
Y532_BUCBP      ----------------------------------------------------------------------
SPNS1_HUMAN     ----------------------------------------------------------------------
MMLH_RALEJ      ----------------------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
Y588_BUCAI      ----------------------------------------------------------------------
VACHT_DANRE     ----------------------------------------------------------------------
MFS10_MOUSE     ----------------------------------------------------------------------
MFS10_HUMAN     ----------------------------------------------------------------------
LTAA_STAHJ      EETWGVFNSVQGFGSMIG-PLFGGLIAQFSN---------------------------------------
LPLT_PHOLL      ----------------------------------------------------------------------
LPLT_ENT38      ----------------------------------------------------------------------
HIAT1_HUMAN     ----------------------------------------------------------------------
YVKA_BACSU      ----------------------------------------------------------------------
YUSP_BACSU      GVVTSSSQFFRSIGGTFGITMLG-----------------------------------------------
YDIM_ECOLI      ----------------------------------------------------------------------
TUB3_AGRVI      AAGIATINSIGNLGGFVGPSMIGWI---------------------------------------------
LTAA_STAAC      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
LTAA_STAA8      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
LTAA_STAA3      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
HIAT1_MOUSE     ----------------------------------------------------------------------
SPNS1_BOVIN     ----------------------------------------------------------------------
LTAA_STAAW      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
LTAA_STAAS      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
LTAA_STAAR      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
LTAA_STAAN      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
LTAA_STAAM      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------
LTAA_STAAB      EETWGVFNSIQGFGSMIG-PLFGGLI--------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YITG_BACSU      ------------------------------------------------------
BBEX_BACSU      ------------------------------------------------------
YMFD_BACSU      ------------------------------------------------------
YFMO_BACSU      ------------------------------------------------------
BMR2_BACSU      ------------------------------------------------------
MDTL_SALTI      ------------------------------------------------------
MDTL_SALSV      ------------------------------------------------------
MDTL_SALPK      ------------------------------------------------------
MDTL_SALPA      ------------------------------------------------------
MDTL_SALEP      ------------------------------------------------------
MDTL_SALDC      ------------------------------------------------------
MDTL_SALAR      ------------------------------------------------------
MDTL_SALTY      ------------------------------------------------------
MDTL_SALPC      ------------------------------------------------------
MDTL_SALPB      ------------------------------------------------------
MDTL_SALNS      ------------------------------------------------------
MDTL_SALHS      ------------------------------------------------------
MDTL_SALCH      ------------------------------------------------------
MDTL_SALA4      ------------------------------------------------------
YAJR_ECOLI      ------------------------------------------------------
MDTL_ECOUT      ------------------------------------------------------
MDTL_ECOK1      ------------------------------------------------------
MDTL_ECO45      ------------------------------------------------------
MDTL_ECO27      ------------------------------------------------------
QACA_STAAU      ------------------------------------------------------
QACA_STAAM      ------------------------------------------------------
MDTL_SHISS      ------------------------------------------------------
MDTL_SHIFL      ------------------------------------------------------
MDTL_SHIDS      ------------------------------------------------------
MDTL_SHIBS      ------------------------------------------------------
MDTL_SHIB3      ------------------------------------------------------
MDTL_ESCF3      ------------------------------------------------------
MDTL_ECOSM      ------------------------------------------------------
MDTL_ECOSE      ------------------------------------------------------
MDTL_ECOLU      ------------------------------------------------------
MDTL_ECOLI      ------------------------------------------------------
MDTL_ECOLC      ------------------------------------------------------
MDTL_ECOL6      ------------------------------------------------------
MDTL_ECOL5      ------------------------------------------------------
MDTL_ECOHS      ------------------------------------------------------
MDTL_ECODH      ------------------------------------------------------
MDTL_ECOBW      ------------------------------------------------------
MDTL_ECO8A      ------------------------------------------------------
MDTL_ECO81      ------------------------------------------------------
MDTL_ECO7I      ------------------------------------------------------
MDTL_ECO5E      ------------------------------------------------------
MDTL_ECO57      ------------------------------------------------------
MDTL_ECO55      ------------------------------------------------------
MDTL_ECO24      ------------------------------------------------------
MDTL_SHIF8      ------------------------------------------------------
YVMA_BACSU      ------------------------------------------------------
MDTL_VIBPA      ------------------------------------------------------
Y466_BUCAI      ------------------------------------------------------
TCR1_ECOLX      ------------------------------------------------------
BMR1_BACSU      ------------------------------------------------------
YFIU_BACSU      ------------------------------------------------------
MDTL_SHEON      ------------------------------------------------------
YCNB_BACSU      ------------------------------------------------------
MDTD_PECCP      ------------------------------------------------------
MDTL_KLEP3      ------------------------------------------------------
MDTL_SHESA      ------------------------------------------------------
HSRA_ECOLI      ------------------------------------------------------
MDTL_CITK8      ------------------------------------------------------
YJJL_ECOLI      ------------------------------------------------------
YHCA_BACSU      ------------------------------------------------------
MDTL_KLEP7      ------------------------------------------------------
MDTD_YERE8      ------------------------------------------------------
SPNS3_DANRE     ------------------------------------------------------
SPNS1_XENLA     ------------------------------------------------------
MDTD_SERP5      ------------------------------------------------------
YWOG_BACSU      ------------------------------------------------------
TCRB_BACSU      ------------------------------------------------------
SPIN_DROME      ------------------------------------------------------
MDTD_YERPY      ------------------------------------------------------
MDTD_YERPP      ------------------------------------------------------
MDTD_YERPN      ------------------------------------------------------
MDTD_YERPG      ------------------------------------------------------
MDTD_YERPE      ------------------------------------------------------
MDTD_YERPB      ------------------------------------------------------
MDTD_YERPA      ------------------------------------------------------
MDTD_YERP3      ------------------------------------------------------
YO378_YEAST     ------------------------------------------------------
SPNS2_XENTR     ------------------------------------------------------
PMRA_LACLA      ------------------------------------------------------
MDTD_YERPS      ------------------------------------------------------
MDTD_ERWCT      ------------------------------------------------------
BCR_HAEIN       ------------------------------------------------------
TCR_STRPN       ------------------------------------------------------
TCR_STAHY       ------------------------------------------------------
TCR_BACSU       ------------------------------------------------------
TCR_BACST       ------------------------------------------------------
TCR_BACCE       ------------------------------------------------------
SPNS3_MOUSE     ------------------------------------------------------
MDTD_KLEP3      ------------------------------------------------------
MDTD_ENTS8      ------------------------------------------------------
TCR2_ECOLX      ------------------------------------------------------
MDTD_KLEP7      ------------------------------------------------------
EXUT_BACSU      ------------------------------------------------------
TCR_STRAG       ------------------------------------------------------
SPNS1_XENTR     ------------------------------------------------------
SPNS1_DANRE     ------------------------------------------------------
MDTD_ENT38      ------------------------------------------------------
BMR3_BACSU      ------------------------------------------------------
YAN6_SCHPO      ------------------------------------------------------
SPNS2_DANRE     ------------------------------------------------------
EMRB_HAEIN      ------------------------------------------------------
YIM0_YEAST      ------------------------------------------------------
MDTD_SALTY      ------------------------------------------------------
MDTD_SALTI      ------------------------------------------------------
MDTD_SALSV      ------------------------------------------------------
MDTD_SALPK      ------------------------------------------------------
MDTD_SALPB      ------------------------------------------------------
MDTD_SALPA      ------------------------------------------------------
MDTD_SALNS      ------------------------------------------------------
MDTD_SALHS      ------------------------------------------------------
MDTD_SALEP      ------------------------------------------------------
MDTD_SALDC      ------------------------------------------------------
MDTD_SALA4      ------------------------------------------------------
YCEJ_BACSU      ------------------------------------------------------
MDTD_ECOLU      ------------------------------------------------------
YWFA_BACSU      ------------------------------------------------------
YI32_SCHPO      ------------------------------------------------------
YYBF_BACSU      ------------------------------------------------------
Y450_BUCAP      ------------------------------------------------------
SPNS2_MOUSE     ------------------------------------------------------
SPNS2_HUMAN     ------------------------------------------------------
EMRB_ECOLI      ------------------------------------------------------
EMRB_ECO57      ------------------------------------------------------
YNFM_ECOLI      ------------------------------------------------------
SPNS3_HUMAN     ------------------------------------------------------
MDTD_SHISS      ------------------------------------------------------
MDTD_SHIFL      ------------------------------------------------------
MDTD_SHIBS      ------------------------------------------------------
MDTD_SHIB3      ------------------------------------------------------
MDTD_ESCF3      ------------------------------------------------------
MDTD_ECOUT      ------------------------------------------------------
MDTD_ECOSM      ------------------------------------------------------
MDTD_ECOSE      ------------------------------------------------------
MDTD_ECOLI      ------------------------------------------------------
MDTD_ECOLC      ------------------------------------------------------
MDTD_ECOL6      ------------------------------------------------------
MDTD_ECOL5      ------------------------------------------------------
MDTD_ECOK1      ------------------------------------------------------
MDTD_ECOHS      ------------------------------------------------------
MDTD_ECODH      ------------------------------------------------------
MDTD_ECOBW      ------------------------------------------------------
MDTD_ECO8A      ------------------------------------------------------
MDTD_ECO81      ------------------------------------------------------
MDTD_ECO7I      ------------------------------------------------------
MDTD_ECO5E      ------------------------------------------------------
MDTD_ECO57      ------------------------------------------------------
MDTD_ECO55      ------------------------------------------------------
MDTD_ECO45      ------------------------------------------------------
MDTD_ECO27      ------------------------------------------------------
MDTD_ECO24      ------------------------------------------------------
AQR1_YEAST      ------------------------------------------------------
MDTD_SHIF8      ------------------------------------------------------
LTAA_STAS1      ------------------------------------------------------
Y411_BUCBP      ------------------------------------------------------
PHDK_NOCSK      ------------------------------------------------------
MDTD_CITK8      ------------------------------------------------------
YCXA_BACSU      ------------------------------------------------------
TCR7_VIBAN      ------------------------------------------------------
LPLT_KLEP7      ------------------------------------------------------
LPLT_KLEP3      ------------------------------------------------------
BAIG_EUBSP      ------------------------------------------------------
YDHC_ECOLI      ------------------------------------------------------
SO1A1_RAT       ------------------------------------------------------
YJA1_SCHPO      ------------------------------------------------------
YHJO_BACSU      ------------------------------------------------------
YFKF_BACSU      ------------------------------------------------------
TCR3_ECOLX      ------------------------------------------------------
SO1A3_RAT       ------------------------------------------------------
SO1A6_MOUSE     ------------------------------------------------------
SO1A5_RAT       ------------------------------------------------------
LPLT_SHIFL      ------------------------------------------------------
LPLT_SHIF8      ------------------------------------------------------
LPLT_CITK8      ------------------------------------------------------
EMRD_ECOLI      ------------------------------------------------------
YQJV_BACSU      ------------------------------------------------------
YN41_SCHPO      ------------------------------------------------------
Y1560_METJA     ------------------------------------------------------
SO1A5_MOUSE     ------------------------------------------------------
LPLT_YERPY      ------------------------------------------------------
LPLT_YERPS      ------------------------------------------------------
LPLT_YERPP      ------------------------------------------------------
LPLT_YERPN      ------------------------------------------------------
LPLT_YERPG      ------------------------------------------------------
LPLT_YERPE      ------------------------------------------------------
LPLT_YERPB      ------------------------------------------------------
LPLT_YERPA      ------------------------------------------------------
LPLT_YERP3      ------------------------------------------------------
LPLT_SHISS      ------------------------------------------------------
LPLT_SHIDS      ------------------------------------------------------
LPLT_SHIBS      ------------------------------------------------------
LPLT_SHIB3      ------------------------------------------------------
LPLT_ECOUT      ------------------------------------------------------
LPLT_ECOSM      ------------------------------------------------------
LPLT_ECOSE      ------------------------------------------------------
LPLT_ECOLU      ------------------------------------------------------
LPLT_ECOLI      ------------------------------------------------------
LPLT_ECOLC      ------------------------------------------------------
LPLT_ECOL6      ------------------------------------------------------
LPLT_ECOL5      ------------------------------------------------------
LPLT_ECOK1      ------------------------------------------------------
LPLT_ECOHS      ------------------------------------------------------
LPLT_ECODH      ------------------------------------------------------
LPLT_ECOBW      ------------------------------------------------------
LPLT_ECO8A      ------------------------------------------------------
LPLT_ECO81      ------------------------------------------------------
LPLT_ECO7I      ------------------------------------------------------
LPLT_ECO5E      ------------------------------------------------------
LPLT_ECO57      ------------------------------------------------------
LPLT_ECO55      ------------------------------------------------------
LPLT_ECO45      ------------------------------------------------------
LPLT_ECO27      ------------------------------------------------------
LPLT_ECO24      ------------------------------------------------------
SO1A1_MOUSE     ------------------------------------------------------
PMRA_STRR6      ------------------------------------------------------
PMRA_STRPN      ------------------------------------------------------
MFSD9_MOUSE     ------------------------------------------------------
LPLT_SERP5      ------------------------------------------------------
LPLT_SALTY      ------------------------------------------------------
LPLT_SALTI      ------------------------------------------------------
LPLT_SALSV      ------------------------------------------------------
LPLT_SALPK      ------------------------------------------------------
LPLT_SALPC      ------------------------------------------------------
LPLT_SALPB      ------------------------------------------------------
LPLT_SALPA      ------------------------------------------------------
LPLT_SALNS      ------------------------------------------------------
LPLT_SALHS      ------------------------------------------------------
LPLT_SALG2      ------------------------------------------------------
LPLT_SALEP      ------------------------------------------------------
LPLT_SALDC      ------------------------------------------------------
LPLT_SALCH      ------------------------------------------------------
LPLT_SALA4      ------------------------------------------------------
YEBQ_ECOLI      ------------------------------------------------------
TPO4_YEAST      ------------------------------------------------------
SMVA_SALTY      ------------------------------------------------------
LPLT_YERE8      ------------------------------------------------------
LPLT_SALAR      ------------------------------------------------------
Y532_BUCBP      ------------------------------------------------------
SPNS1_HUMAN     ------------------------------------------------------
MMLH_RALEJ      ------------------------------------------------------
YJHB_ECOLI      ------------------------------------------------------
Y588_BUCAI      ------------------------------------------------------
VACHT_DANRE     ------------------------------------------------------
MFS10_MOUSE     ------------------------------------------------------
MFS10_HUMAN     ------------------------------------------------------
LTAA_STAHJ      ------------------------------------------------------
LPLT_PHOLL      ------------------------------------------------------
LPLT_ENT38      ------------------------------------------------------
HIAT1_HUMAN     ------------------------------------------------------
YVKA_BACSU      ------------------------------------------------------
YUSP_BACSU      ------------------------------------------------------
YDIM_ECOLI      ------------------------------------------------------
TUB3_AGRVI      ------------------------------------------------------
LTAA_STAAC      ------------------------------------------------------
LTAA_STAA8      ------------------------------------------------------
LTAA_STAA3      ------------------------------------------------------
HIAT1_MOUSE     ------------------------------------------------------
SPNS1_BOVIN     ------------------------------------------------------
LTAA_STAAW      ------------------------------------------------------
LTAA_STAAS      ------------------------------------------------------
LTAA_STAAR      ------------------------------------------------------
LTAA_STAAN      ------------------------------------------------------
LTAA_STAAM      ------------------------------------------------------
LTAA_STAAB      ------------------------------------------------------