[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50272.1

[Show Plain Result]


## Summary of Sequence Search
    1::198
   10::130     2e-07  35%  299 aa  MOAA_META3 RecName: Full=Probable molybdenum cofactor biosynthesis
   13::130     4e-06  32%  305 aa  MOAA_METTH RecName: Full=Probable molybdenum cofactor biosynthesis
   10::93      6e-06  35%  308 aa  MOAA_SULIY RecName: Full=Probable molybdenum cofactor biosynthesis
   10::93      6e-06  35%  308 aa  MOAA_SULIM RecName: Full=Probable molybdenum cofactor biosynthesis
   10::93      6e-06  35%  308 aa  MOAA_SULIL RecName: Full=Probable molybdenum cofactor biosynthesis
   10::93      6e-06  35%  308 aa  MOAA_SULIK RecName: Full=Probable molybdenum cofactor biosynthesis
   10::93      6e-06  35%  308 aa  MOAA_SULIA RecName: Full=Probable molybdenum cofactor biosynthesis
   11::134     6e-06  31%  298 aa  MOAA_METJA RecName: Full=Probable molybdenum cofactor biosynthesis
  103::215     1e-05  34%  343 aa  RLMN_GEOUR RecName: Full=Ribosomal RNA large subunit
   14::173     2e-05  31%  320 aa  MOAA_ALKMQ RecName: Full=Molybdenum cofactor biosynthesis protein
  113::252     3e-05  37%  340 aa  RLMN_CYAP8 RecName: Full=Ribosomal RNA large subunit
  113::225     3e-05  41%  343 aa  RLMN_CYAA5 RecName: Full=Ribosomal RNA large subunit
  114::239     3e-05  36%  355 aa  RLMN_ANASP RecName: Full=Ribosomal RNA large subunit
  118::230     3e-05  37%  351 aa  RLMN_ACAM1 RecName: Full=Ribosomal RNA large subunit
   28::188     4e-05  31%  243 aa  Y1645_METJA RecName: Full=Uncharacterized protein MJ1645;
  114::239     4e-05  34%  355 aa  RLMN_ANAVT RecName: Full=Ribosomal RNA large subunit
   44::174     5e-05  31%  286 aa  Y804_METJA RecName: Full=Uncharacterized protein MJ0804;
  108::225     5e-05  37%  337 aa  RLMN_MICAN RecName: Full=Ribosomal RNA large subunit
  142::233     5e-05  31%  357 aa  RLMN_EXIS2 RecName: Full=Ribosomal RNA large subunit
   10::126     5e-05  30%  313 aa  MOAA_SULAC RecName: Full=Probable molybdenum cofactor biosynthesis
  114::227     7e-05  34%  347 aa  RLMN_TREDE RecName: Full=Ribosomal RNA large subunit
  111::248     7e-05  31%  346 aa  RLMN_SYNP2 RecName: Full=Ribosomal RNA large subunit
  107::263     7e-05  33%  359 aa  RLMN_PROM1 RecName: Full=Ribosomal RNA large subunit
   14::174     7e-05  32%  320 aa  MOAA_ALKOO RecName: Full=Molybdenum cofactor biosynthesis protein
   96::240     9e-05  35%  363 aa  RLMN_BUCAP RecName: Full=Ribosomal RNA large subunit
   12::125     1e-04  33%  307 aa  MOAA_UNCMA RecName: Full=Probable molybdenum cofactor biosynthesis
   96::252     1e-04  33%  344 aa  RLMN_SYNPX RecName: Full=Ribosomal RNA large subunit
  113::221     3e-04  38%  350 aa  RLMN_SYNY3 RecName: Full=Ribosomal RNA large subunit
  137::242     3e-04  34%  364 aa  RLMN_NOSP7 RecName: Full=Ribosomal RNA large subunit
  116::257     3e-04  30%  376 aa  RLMN_NOCSJ RecName: Full=Ribosomal RNA large subunit
  131::252     3e-04  38%  387 aa  RLMN_HYPNA RecName: Full=Ribosomal RNA large subunit
   76::222     3e-04  29%  600 aa  MOCS1_CAEEL RecName: Full=Molybdenum cofactor biosynthesis protein
   16::173     3e-04  27%  340 aa  MOAA_STACT RecName: Full=Molybdenum cofactor biosynthesis protein
   10::135     3e-04  27%  332 aa  MOAA_LACPL RecName: Full=Molybdenum cofactor biosynthesis protein
   53::133     3e-04  32%  384 aa  COFH2_METBF RecName: Full=FO synthase subunit 2 2;       
  105::225     4e-04  34%  346 aa  RLMN_GEOMG RecName: Full=Ribosomal RNA large subunit
   92::242     4e-04  30%  348 aa  RLMN_DICTD RecName: Full=Ribosomal RNA large subunit
  111::264     4e-04  31%  369 aa  RLMN_COREF RecName: Full=Ribosomal RNA large subunit
   13::145     4e-04  33%  307 aa  MOAA_PYRKO RecName: Full=Probable molybdenum cofactor biosynthesis
   17::139     4e-04  31%  332 aa  MOAA_PSEU2 RecName: Full=Molybdenum cofactor biosynthesis protein
   58::124     4e-04  31%  375 aa  COFH1_METAC RecName: Full=FO synthase subunit 2 1;       
   88::154     6e-04  33%  345 aa  PUR5_LACAC RecName: Full=Phosphoribosylformylglycinamidine
   72::157     6e-04  36%  636 aa  MOCS1_HUMAN RecName: Full=Molybdenum cofactor biosynthesis protein
   12::174     6e-04  27%  322 aa  MOAA_THEYD RecName: Full=Molybdenum cofactor biosynthesis protein
   17::139     6e-04  31%  332 aa  MOAA_PSE14 RecName: Full=Molybdenum cofactor biosynthesis protein
   19::135     6e-04  28%  330 aa  MOAA_MARAV RecName: Full=Molybdenum cofactor biosynthesis protein
   10::135     6e-04  27%  332 aa  MOAA_LACF3 RecName: Full=Molybdenum cofactor biosynthesis protein
  101::198     7e-04  29%  340 aa  RLMN_TREPS RecName: Full=Ribosomal RNA large subunit
  101::198     7e-04  29%  340 aa  RLMN_TREPA RecName: Full=Ribosomal RNA large subunit
   99::255     7e-04  33%  351 aa  RLMN_SYNSC RecName: Full=Ribosomal RNA large subunit
  104::260     7e-04  32%  351 aa  RLMN_SYNPW RecName: Full=Ribosomal RNA large subunit
  111::217     7e-04  32%  366 aa  RLMN_CORGL RecName: Full=Ribosomal RNA large subunit
  111::217     7e-04  32%  366 aa  RLMN_CORGB RecName: Full=Ribosomal RNA large subunit
  122::239     7e-04  38%  356 aa  RLMN_CAMJJ RecName: Full=Ribosomal RNA large subunit
  112::203     7e-04  39%  359 aa  RLMN_AKKM8 RecName: Full=Ribosomal RNA large subunit
  112::233     7e-04  33%  356 aa  RLMN1_BACSK RecName: Full=Ribosomal RNA large subunit
  378::531     7e-04  23%  680 aa  OBG_BRAHW RecName: Full=GTPase obg;AltName: Full=GTP-binding
   14::165     7e-04  25%  330 aa  MOAA_DESAD RecName: Full=Molybdenum cofactor biosynthesis protein
   53::127     7e-04  34%  384 aa  COFH2_METMA RecName: Full=FO synthase subunit 2 2;       
  120::231     0.001  40%  356 aa  RLMN_PROM4 RecName: Full=Ribosomal RNA large subunit
  100::207     0.001  33%  351 aa  RLMN_NATTJ RecName: Full=Ribosomal RNA large subunit
   52::108     0.001  33%  384 aa  COFH2_METAC RecName: Full=FO synthase subunit 2 2;       
    1::198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDRQFIISYQIDETLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCG
MOAA_META3      ------------KSLRISITPQCNLNCFYCHKE-----GHNIDNNKLMTPTEIGEMVKYSLKYNKIKISG
MOAA_METTH      -------------SLRLSITGRCNVNCIYCHRDGMTSSRGEL----SAADIEKLCRVASDLGVGKIRLSG
MOAA_SULIY      ------------EDLRITLTHVCNFECFFCHMEGEEGDNYIL------SKEDILLVAKVAKNFNSVKLTG
MOAA_SULIM      ------------EDLRITLTHVCNFECFFCHMEGEEGDNYIL------SKEDILLVAKVAKNFNSVKLTG
MOAA_SULIL      ------------EDLRITLTHVCNFECFFCHMEGEEGDNYIL------SKEDILLVAKVAKNFNSVKLTG
MOAA_SULIK      ------------EDLRITLTHVCNFECFFCHMEGEEGDNYIL------SKEDILLVAKVAKNFNSVKLTG
MOAA_SULIA      ------------EDLRITLTHVCNFECFFCHMEGEEGDNYIL------SKEDILLVAKVAKNFNSVKLTG
MOAA_METJA      -------------SLRISITNKCNLQCFYCHRE-----GHDSNNDRYMTPEEIGIIAKTSTKFKKIKISG
RLMN_GEOUR      -------------TLCISSQVGCAMGCEFCLTGT-------FKLTRNLTTAEIVNAVKRQEPVRNIVFMG
MOAA_ALKMQ      ----------------ISITDLCNLRCQYCM--PEKGI-YKKTHQDILTLEEIEQIVRAENGINKVRITG
RLMN_CYAP8      ----------------------CPMACDFCA--TGKG-GYQRHLRAHEIVDQVLTVQEDFQRVSHVVFMG
RLMN_CYAA5      ----------------------CPMNCDFCA----TGKG---GYTRNLTCAEIVDQVLTVQEVSHVVFMG
RLMN_ANASP      -----------DKRLTVCVSTQCPMACDFCA--TGKG-GYKRNLERHEIVDQVLTVQEDQQRVSHVVFMG
RLMN_ACAM1      ----------------------CPMGCDFCA----TGKGYQRNLACHEIVDQVLTVQEDQQRVGNVVFMG
Y1645_METJA     ----------------------CPLNCVYCDEESK---GYFNRVEKIPEIEDIIDKLKTPDLF-AVSFTG
RLMN_ANAVT      -----------DKRLTVCVSTQCPMACDFCA--TGKG-GYKRNLERHEIVDQVLTVQEDQQRVSHVVFMG
Y804_METJA      ----------------IELTQKCNLNCIYCYSRLKT-VKRGIYGNLEEA--------------ETVTISQ
RLMN_MICAN      ----------------------CPMACDFCA--TGKG-GFTRNLKAHEIVDQVLTVQEDQQRVSHVVFMG
RLMN_EXIS2      -------------------------------------------------VQHHLDAVGKEERVSHVVVMG
MOAA_SULAC      ------------EDLRITLTHACNFTCFFCHMEGENDGDSLLSADQISLVAQI-----GMEFGIRTVKLT
RLMN_TREDE      ----------------------CPMKCAFC----KTGIGFLRNLSASEIVEQFLHLEREAGSLDNIVFMG
RLMN_SYNP2      ----------------------CAMACDFCATGKS---GFTRHLQAHEIIDQVLTVQTDQQRVSHVVFMG
RLMN_PROM1      -----------DKRLTVCVSSQCPMGCKFCA----TGKG---GLNRSLDVNEIVDQVISVRETTHVVFMG
MOAA_ALKOO      ----------------ISITDLCNLRCQYCM----PAEGICKKDHKEVTLEEITDIVKAGVGLGDKVRIT
RLMN_BUCAP      IDKQKIETIYIPETLCVSSQIGCSLKCKFCATGQQ---GFNRNLKVSEIISQILKEKKNNSTITNIVFMG
MOAA_UNCMA      -------------SLRISLTNRCNLKCIYCHNEGEEDSG------SEITVEEVAQIARICARYDKIKFSG
RLMN_SYNPX      -----------DQRLTVCVSSQCPMACRFCA----TGKG---GLQRSLRTHEIVDQVLSVREVSHIVFMG
RLMN_SYNY3      ----------------------CAMDCNFCA--TGKG-GFIRNLESHEIVDQVLTVQEEHERVSNVVFMG
RLMN_NOSP7      ----------------------CPMACDFCA--TGKG-GYKRNLARHEIIDQVLTVQEDQQRVSNVVFMG
RLMN_NOCSJ      -----LMRYPDRATMCVSSQAGCGMACPFCA--TGQG-GLQRNMSTAEIVEQVVAGARSPGRVSNVVFMG
RLMN_HYPNA      ----------------------CTLNCTFCHTGTQALVRN---LTAAEIVQQVIDALSEPSSIEEIVFMG
MOCS1_CAEEL     --------------LRISLTEKCNFRCLYCMPAEGVPLKPK---DKMLSNSEVLRLVKAAHGVDKVRLTG
MOAA_STACT      --------------LRLSVTDRCNFRCDYCMPKEIFGDDF-VFLPKDELLSERIARVYTHLGVKKIRITG
MOAA_LACPL      ---------RLHDYVRLSITDRCNLRCVYCM--PKEGLPF-FPTDRVLSQDEIVQLIENAMGVSKVRITG
COFH2_METBF     ------VSYVVNRNIY--ITNKCVGNCGFCAYRTEK--GYIL------SVEEILEKAGEARKAGAVEVCI
RLMN_GEOMG      -------------TLCISSQVGCAMACEFCLTGT-------FRLTRNLTAGEIVNAVRRDVPVRNIVFMG
RLMN_DICTD      -----LISHKNRNTVCVSVQVGCPIGCKFCA----TGIGLKRNLETHEIIGQLMDLEKKEEKISNVVYMG
RLMN_COREF      -----LMRYPDRATLCISSQAGCGMACPFCA----TGQG---GLDRNLSVGEIVDQVRNAAALSNIVFMG
MOAA_PYRKO      --------------LRISLTQECNYRCFFCHRE-----GQRFLAKNELTPEEILVRIASRLGIRKVKLTG
MOAA_PSEU2      --------------LRMSVTDRCDFRCVYCMAEEMTFLPRQQIL----SLEEILQVAERALGTRKIRLTG
COFH1_METAC     ----------------INFTSRCVGTCGFCAFRTNNG--------KVLSIEEIMEKVRDAEKANATEVCI
PUR5_LACAC      -------------------------------------------------VNDVLAQGAEPLFFLDYIACG
MOCS1_HUMAN     --------------LRISLTEKCNLRCQYCM--PEEGVPLTPKANLL-TTEEILTLARLKEGIDKIRLTG
MOAA_THEYD      --------------LRISIIDRCNLRCIYCM--PEEGITNLLPHHEILSYEEILKIVEIDLGITKIRITG
MOAA_PSE14      --------------LRMSVTDRCDFRCVYCMAEEMTFLPRQQIL----SLEEILQVAERALGTRKIRLTG
MOAA_MARAV      ----------------LSVTDRCDFRCVYCMAEDMTFLPRQQVL----TLEEIARLARNFVALTEKIRLT
MOAA_LACF3      ---------RLHDYVRISITDRCNLRCVYCM--PKEGLPF-FPTDRVLSQDEIVQLITNQLGVHKVRITG
RLMN_TREPS      ------------KTACLSCQVGCPMACAFC----QTGLGFARNLSASEIVEQFLHLERCVGTLDNVVFMG
RLMN_TREPA      ------------KTACLSCQVGCPMACAFC----QTGLGFARNLSASEIVEQFLHLERCVGTLDNVVFMG
RLMN_SYNSC      -----------DQRLTVCVSSQCPMACRFCA----TGKG---GLQRSLQTHEIVDQVLSVREASHIVFMG
RLMN_SYNPW      -----------DQRLTVCVSSQCPMACRFCA----TGKG---GLQRSLYTHEIVAQVLSVREVMEVVFMG
RLMN_CORGL      -----LMRYSDRSTLCISSQAGCGMACPFCA----TGQG---GLDRNLSIGEIVDQVRNAAALSNIVFMG
RLMN_CORGB      -----LMRYSDRSTLCISSQAGCGMACPFCA----TGQG---GLDRNLSIGEIVDQVRNAAALSNIVFMG
RLMN_CAMJJ      ----------------------CKSGCSFCLRNLSTGVGQILWIKKQ-------NNIPYERRVN-IVYMG
RLMN_AKKM8      -------------TLCVSSQVGCAFGCKFCA----SGL---LGLKRHLTTGEIIGQILSAEAINNIVFMG
RLMN1_BACSK     ----------------------CNIGCSFCASGLLTK---NRDLSSGEIVEQILDQVGKEERVSHVVVMG
OBG_BRAHW       -----VVSKRLGNSLGIDVIKTCSYNCIYCQLGSEENTKTSLYYSVDEIIYELKEALLNNKNIDYITFAG
MOAA_DESAD      --------------LRLSVTDRCNLRCMYCVTKDFKHIPHPDILR----YEEMLRLVDLAASMNKLRLTG
COFH2_METMA     ------VSYVVNRNIY--ITNKCVGNCGFCAYRTEK--GYIL------SIEEILKKAGDARKAGAVEVCV
RLMN_PROM4      ----------------------CSMGCRFCA----TGKG---GFQRSLEVHEIVDQVLSIREASHIVFMG
RLMN_NATTJ      -----IMKYDYGNTVCISSQAGCNMNCVFC---ASTTGGKERDLSPGEMIDQVLMANKGSESINNIVVMG
COFH2_METAC     -----VVSYVVNRNIY--ITNKCVGTCGFCAYRTDE--GYIL------SIEEILKQTEEAREAGAVEVCV


                         .         .         *         .         .         .         .:140
query           YGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNATVYTEICR
MOAA_META3      -GEPLLRPEIIRNI-KNLKNNQIKDISLTTNGILLEKYAQKL--KDAGL-DRVNVSLDTLDPELYKKI--
MOAA_METTH      -GEPLIRDDIVE-IVERINNIGFRDISITTNGTLLE--GYSAALSEAGL-DRVNVSFDTLNPETYRFITR
MOAA_SULIY      -GEPTLRRDLVE-IVRGLKQLGYRDVSMTTNG--------------------------------------
MOAA_SULIM      -GEPTLRRDLVE-IVRGLKQLGYRDVSMTTNG--------------------------------------
MOAA_SULIL      -GEPTLRRDLVE-IVRGLKQLGYRDVSMTTNG--------------------------------------
MOAA_SULIK      -GEPTLRRDLVE-IVRGLKQLGYRDVSMTTNG--------------------------------------
MOAA_SULIA      -GEPTLRRDLVE-IVRGLKQLGYRDVSMTTNG--------------------------------------
MOAA_METJA      -GEPLLRKDVCE-IIENIKDERIKDISLTTNGILLENLAEKL--KDAGL-NRVNVSLDTLNPELYKKITK
RLMN_GEOUR      MGEPLANLKNVVGALKILTQFSTRKVTVSTSG---------LVPEMAELGASVTVNLAVSNAT-------
MOAA_ALKMQ      -GEPLVRKGVIGLIKNISNIPGIQDIALTTNGLLIKKYGEAL--KDAGL-KRINISIDSLRPDRYKEITR
RLMN_CYAP8      MGEPLLNLEVVKSVKILNQDIGQRSLTISTVGLPQK------IIQLAHLQVTLAVSLHASNQPL-RETLI
RLMN_CYAA5      MGEPLLNLEVIKAVKILNQDIGQRSLTISTVGVPKK------ILELAQLQVTFAVSLHAANQTLREQL--
RLMN_ANASP      MGEPLLNTEVLAGLRSLNQDIGQRSLTLSTVGIRDR------ISELAHLQVTLAVSLHAPNQALREQL--
RLMN_ACAM1      MGEPLLNLEQVLAAVRSLNQIGQRSLTVSTVGQILKLAQHQ-------LQITLAVSLHASNQRIRTQL--
Y1645_METJA     -GEPLLYHKQIKEIAEILKDKGYRTF-LESNG---------MFPERIFYFDIASIDIKLKE---HFEYIK
RLMN_ANAVT      MGEPLLNTENVLAALRSLNQIGQRSLTLSTVGIRDR------ISQLAHLQVTLAVSLHAPNQALREQL--
Y804_METJA      YGEPLLDLEGVKKAIEFCKDLGLR-VDLQTNG---TLLNEEIIKELKDLLDLIMISLSSFSREKY-KLLT
RLMN_MICAN      MGEPLLNIEVVTAIHCLNKDIGQRCLTISTVGLPHK------IKQLANLQITFAVSLHASNQQVRAKLIP
RLMN_EXIS2      IGEPFDNFDNMVDFLNVIKDIGARHITVSTSGLADKIYKFADLK----LQVNLAISLHAPNNELRTQIMK
MOAA_SULAC      GGEPTLRRDLPE-IISKLKEVGIKEVSMTTNGY--------LLKELAGKLDRVNISLHSIDPVIFKEV--
RLMN_TREDE      MGEPMLNLEIDKAIHPKGRNLSKRRITISTSGLCKGIY------EMAGPEVRLAVSLTTADETLRSEL--
RLMN_SYNP2      MGEPLANLEVLKSIQSLNQDIGQRSLTVSTVGVPDQ------IRALANLQITLAVSLHAPNQALRESII-
RLMN_PROM1      MGEPLLNIQNVLDSIECLTSIGQRKITVSTVGIP------NTLSDLAKLAQTLAVSLHAPNQTL-RELII
MOAA_ALKOO      GGEPLVRNGIVEFIQMISNIDGIKDIAITTNGILLPRYAEAL--KEAGL-KRVNISIDSLNPDKYREITR
RLMN_BUCAP      MGEPLLNLNVISAIKIILDKNGKRRITLSTSG---------IVPALNKLIKSLAISLHAPNDFIRNSI--
MOAA_UNCMA      -GEPLLRRDFDE-ILRALPPM--RDVSVTTNGTLLAARAESL--KESGL-DRVNVSLDSMDRDRFTFI--
RLMN_SYNPX      MGEPLLNSQAVLDAIRCLNDIGQRRITVSTVGVP------KTLPQLAELAFTLAVSLHAPNQALREELI-
RLMN_SYNY3      MGEPLLNLQVVKAVLNQVVGIGQRALTISTVGLPGK------IRQLADLQVTFAVSLHAPNQTL------
RLMN_NOSP7      LGEPLLNTENVLAALKSLNQIGQRSLTVSTVGIRDRQFAQN------NLQITLAVSLHAPN---------
RLMN_NOCSJ      MGEPLANYKAVLGAVRRLTDMSARGVTVSTVG---------LVPRMRQLADTLALSLHAPDDELRNEL--
RLMN_HYPNA      MGEPLYNLDNVAEAIDTISDIGRRRITVSTAGVAPK------IPELGERTGAMAISLHATNNDLRNEL--
MOCS1_CAEEL     -GEPTIRKDIVHIVEGISSTPGIKEVGITTNGLVLQRF----LPQLAGL-TKINISIDSLDREKFAKMTR
MOAA_STACT      -GEPLMRRDLYKLIAALNEIEGVEDIGLTTNGLLLKKHGQKLYD--AGL-RRINVSLDAIDNELFQSINN
MOAA_LACPL      -GEPLLRTDVVEIVRRIKAVDGINDVSITTNG---LFLAKLAKPLKEAGLDRLNISLDTFKADRYKKITR
COFH2_METBF     QGGYIPELEIIESVKAEFPDL-------------------------------------------------
RLMN_GEOMG      MGEPLANLDVVKALKIILHDDGTRRVTVSTSG---------LVPEMERLTVNLAVSLNATTDEVRDRI--
RLMN_DICTD      MGEPLANYDVIKSIRIIKEEIGSKHITLSTIGIIPKIY------QLANLKIRLAISLHASNNELRSKII-
RLMN_COREF      MGEPLANYKRVVSAVRQITQISQRSVTVSTVGLA---------PAIRKLADTLAVSLHTPDDELRDELV-
MOAA_PYRKO      -GEPTVRLEIVKRIKPYVIDLS-----MTTNGSRLKELAKPLAK--AGL-DRVNVSLHSLKPEVYKRI-T
MOAA_PSEU2      -GEPLVRAGVV-GLCEKIAALGLRELCMTTNGQLDKL----AAPLFKAGVTRLNISLDSLDPQRFRELTR
COFH1_METAC     QGGPEVGLDFYQGIAEAIK---------------------------------------------------
PUR5_LACAC      HNDPERLADVVKGVAEGCKQSGSALIGGETAEMPDMYEPHEY--DLAG----------------------
MOCS1_HUMAN     -GEPLIRPDVVDIVAQLQRLEGLRTIGVTTNG--------------------------------------
MOAA_THEYD      -GEPLLRKGIVSFIERLARIEGIRDIGMTTNGVLLKKFAKDLYN--AGL-KRVNVSLDSLDENKFRAITR
MOAA_PSE14      -GEPLVRSGVV-GLCEKIAALGLRELCMTTNGQLDKL----AAPLFKAGVTRLNISLDSLDPQRFRELTR
MOAA_MARAV      GGEPLVRRDILE-LVREVGTYGLRDFAMTTNGSQLPTMAESL--RKAGL-QRLNISLDSLDADKFRAITR
MOAA_LACF3      -GEPLLRTDVV-DIVRRIKEIGIEDVSITTNG---XXXXXXXXXXXXXXXDRLNISLDTFKPEVYKEITR
RLMN_TREPS      MGEPMLNLDAVCRAIEILRDLSEKRITISTSGHCRGIY--------------------------------
RLMN_TREPA      MGEPMLNLDAVCRAIEILRDLSEKRITISTSGHCRGIY--------------------------------
RLMN_SYNSC      MGEPLLNSSAVLEAIRCLNDIGQRRITVSTVGVP------KTLPQLAELAFTLAVSLHAPNQRLREELI-
RLMN_SYNPW      MGEPLLNIEAVLDAIRCLNDIGQRRITVSTVGVP------RTLPRLAELAFTLAVSLHAPNQSLREELI-
RLMN_CORGL      MGEPLANYKRVVSAVRQITQISQRSVTVSTVGLA------------------------------------
RLMN_CORGB      MGEPLANYKRVVSAVRQITQISQRSVTVSTVGLA------------------------------------
RLMN_CAMJJ      MGEPLDNLKNVSKAVKILAQISPRRQTISTSGLAKQ------IKELGNLGVLLAISLHAVNDELRTEL--
RLMN_AKKM8      MGEPLSNLEII--TSHRGLEIGARHITISTSG--------------------------------------
RLMN1_BACSK     IGEPFDNLEIIKD--HKGLAIGARHITVSTSGLAHKIYEFADLK----LQVNLAVSLHAPNNELRSRIMK
OBG_BRAHW       SGEP-TLYKDLKKLIYEIKQITDIPVCIITNG--SLLYKQEMRSDLL-IADLVIPSLDAGNMDTFKLIDQ
MOAA_DESAD      -GEPFARKGFMDFISQVMDSHPEIDLRITTNGTLIE----PLVPELKKIVSRLNISLDTLDRETFKEV--
COFH2_METMA     QGTPEADMEFYLEVIESLK---------------------------------------------------
RLMN_PROM4      MGEPLLNIESVLESISCLNNIGQRRITVSTVGVV------NTLPQLAELAFTLALSLHAPN---------
RLMN_NATTJ      SGEPLENLKIVND--GKGLNIGMRHITVSTCGLVPEIY--------------------------------
COFH2_METAC     QG--------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQNLxxxxxxxxxxx
MOAA_META3      ----------------------------------------------------------
MOAA_METTH      ----------------------------------------------------------
MOAA_SULIY      ----------------------------------------------------------
MOAA_SULIM      ----------------------------------------------------------
MOAA_SULIL      ----------------------------------------------------------
MOAA_SULIK      ----------------------------------------------------------
MOAA_SULIA      ----------------------------------------------------------
MOAA_METJA      FGDVE-----------------------------------------------------
RLMN_GEOUR      ----------------------------------------------------------
MOAA_ALKMQ      GGDLSQVLEGIQEALR--LGMTP-VKLNVVVIGGYNEDEIEDFA--------------
RLMN_CYAP8      PSAQHYTLKNLLADCREYVNITGRRI--------------------------------
RLMN_CYAA5      ----------------------------------------------------------
RLMN_ANASP      ----------------------------------------------------------
RLMN_ACAM1      ----------------------------------------------------------
Y1645_METJA     DEDYEKLYKNELKTIKKLYNLNSDIYAKVVIMEETNIEDVKIIAKDL-----------
RLMN_ANAVT      ----------------------------------------------------------
Y804_METJA      GKDYFNRVLNNIKIASKYLHTIVRSI--------------------------------
RLMN_MICAN      SAD-------------------------------------------------------
RLMN_EXIS2      ----------------------------------------------------------
MOAA_SULAC      ----------------------------------------------------------
RLMN_TREDE      ----------------------------------------------------------
RLMN_SYNP2      PTAVHYPIEALLDECREYVAITRR----------------------------------
RLMN_PROM1      PSASSYPINSLLKDCKKYIDLTGR----------------------------------
MOAA_ALKOO      GGD----LSKVLEGINECIGLTP-VKLNVVAIGGYNDDEIEDFIQ-------------
RLMN_BUCAP      ----------------------------------------------------------
MOAA_UNCMA      ----------------------------------------------------------
RLMN_SYNPX      PTAHAYPYEALLEDCRHYLAVTGR----------------------------------
RLMN_SYNY3      ----------------------------------------------------------
RLMN_NOSP7      ----------------------------------------------------------
RLMN_NOCSJ      ----------------------------------------------------------
RLMN_HYPNA      ----------------------------------------------------------
MOCS1_CAEEL     -RDGFDKVWKAIELAR---GYYPKVKLNVV----------------------------
MOAA_STACT      RNIKADTILEQIDYA---VSIGFKVKINVVVQKGVN----------------------
MOAA_LACPL      ----------------------------------------------------------
COFH2_METBF     ----------------------------------------------------------
RLMN_GEOMG      ----------------------------------------------------------
RLMN_DICTD      PINKEYPIEELLESA-------------------------------------------
RLMN_COREF      PVNNRWSVAEVLDAAR------------------------------------------
MOAA_PYRKO      GVDGLEAVLEGIEEAVK-----------------------------------------
MOAA_PSEU2      TGD-------------------------------------------------------
COFH1_METAC     ----------------------------------------------------------
PUR5_LACAC      ----------------------------------------------------------
MOCS1_HUMAN     ----------------------------------------------------------
MOAA_THEYD      VGLIDDVFEGIDE--AKNAGLQP-VKVNVVVMKGINDDEIEKFA--------------
MOAA_PSE14      TGD-------------------------------------------------------
MOAA_MARAV      ----------------------------------------------------------
MOAA_LACF3      ----------------------------------------------------------
RLMN_TREPS      ----------------------------------------------------------
RLMN_TREPA      ----------------------------------------------------------
RLMN_SYNSC      PTAHAYPYDALLEDCRHYLDVTGR----------------------------------
RLMN_SYNPW      PTAHAYPYDALLDDCRHYLAITGR----------------------------------
RLMN_CORGL      ----------------------------------------------------------
RLMN_CORGB      ----------------------------------------------------------
RLMN_CAMJJ      ----------------------------------------------------------
RLMN_AKKM8      ----------------------------------------------------------
RLMN1_BACSK     ----------------------------------------------------------
OBG_BRAHW       PIDFDKMVNGLIEFRR------------------------------------------
MOAA_DESAD      --TGRDHLTDVLATISACLSAGIRVKVNAVAMKGIN----------------------
COFH2_METMA     ----------------------------------------------------------
RLMN_PROM4      ----------------------------------------------------------
RLMN_NATTJ      ----------------------------------------------------------
COFH2_METAC     ----------------------------------------------------------