[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50352.1

[Show Plain Result]


## Summary of Sequence Search
    1::243
   67::187     5e-04  25%  208 aa  KTHY_ASFM2 RecName: Full=Truncated thymidylate kinase;
    1::243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGLCFLPK
KTHY_ASFM2      --------------------------------------------------------------SGLAYAQA


                         .         .         *         .         .         .         .:140
query           EGTALNLKFLETIKSFVAGKVQTAQISFSTQEKEKDLENSLKPEVAQALKEVPYEVLLPADLTGQYNLEK
KTHY_ASFM2      DGITIETKFKPDYTFFLSSNKPLKEKPFNIQREEKDKQEIIFNNFITIMNDVPKNCIIPAHLNKEYNIVL


                         +         .         .         .         .         *         .:210
query           AMTQKVGDSTKVMLFLKTTNSELVNISEINIIGDFNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KTHY_ASFM2      TKTLKVFDNNSCLKYIKMYDDKYLNVQDLNLI-DFD----------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KTHY_ASFM2      ---------------------------------