[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50378.1

[Show Plain Result]


## Summary of Sequence Search
    1::223
   34::231     2e-15  27%  235 aa  YDJZ_ECOLI RecName: Full=TVP38/TMEM64 family inner membrane protein
   16::190     1e-13  30%  207 aa  YHJE_BACSU RecName: Full=Uncharacterized membrane protein yhjE;
   26::196     5e-09  21%  208 aa  YQED_BACSU RecName: Full=Uncharacterized protein yqeD;
   37::204     4e-08  27%  294 aa  TVP38_COPC7 RecName: Full=Golgi apparatus membrane protein TVP38;
    8::151     6e-07  27%  209 aa  Y305_SYNY3 RecName: Full=TVP38/TMEM64 family membrane protein
  203::288     1e-06  34%  334 aa  TM41_DICDI RecName: Full=Transmembrane protein 41 homolog;
  120::302     2e-06  28%  319 aa  TVP38_VANPO RecName: Full=Golgi apparatus membrane protein TVP38;
  114::299     5e-06  25%  305 aa  TVP38_KLULA RecName: Full=Golgi apparatus membrane protein TVP38;
  100::278     6e-05  28%  278 aa  TM41B_XENTR RecName: Full=Transmembrane protein 41B;
   54::259     1e-04  24%  278 aa  TM41B_XENLA RecName: Full=Transmembrane protein 41B;
  113::274     2e-04  27%  291 aa  TM41B_RAT RecName: Full=Transmembrane protein 41B;
  113::274     3e-04  25%  291 aa  TM41B_MOUSE RecName: Full=Transmembrane protein 41B;
  113::272     3e-04  27%  291 aa  TM41B_HUMAN RecName: Full=Transmembrane protein 41B;
   33::252     3e-04  24%  269 aa  TM41B_CHICK RecName: Full=Transmembrane protein 41B;
  143::242     4e-04  29%  323 aa  TVP38_CANGA RecName: Full=Golgi apparatus membrane protein TVP38;
   67::278     5e-04  24%  383 aa  TVP38_DEBHA RecName: Full=Golgi apparatus membrane protein TVP38;
  132::232     5e-04  26%  307 aa  TVP38_ASHGO RecName: Full=Golgi apparatus membrane protein TVP38;
   47::204     8e-04  25%  270 aa  TVP38_SCHPO RecName: Full=Golgi apparatus membrane protein tvp38;
  231::329     8e-04  24%  350 aa  ICAC_STAAW RecName: Full=Biofilm PIA synthesis protein
  231::329     8e-04  24%  350 aa  ICAC_STAAS RecName: Full=Biofilm PIA synthesis protein
  231::329     8e-04  24%  350 aa  ICAC_STAAR RecName: Full=Biofilm PIA synthesis protein
  231::329     8e-04  24%  350 aa  ICAC_STAAN RecName: Full=Biofilm PIA synthesis protein
  231::329     8e-04  24%  350 aa  ICAC_STAA8 RecName: Full=Biofilm PIA synthesis protein
    1::223

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxILLVIFFTVCFFYLWGNEVLNIFKIVFSSDIQKAVELIRTAGSKAVLISIFINVAISLMGVMPSV
YDJZ_ECOLI      ---------------------HEFINRSVAAFAAVDQQGIEFIQSYGALAAVVSFLLMILQAIAAPLPAF
YHJE_BACSU      ----------------------------------------ELFQSYRAFGPLIAVLLPLIEAFLPFLPLI
YQED_BACSU      ---------------------------------------LDAIKAGGMFSVLFSMLLIAADVFFPIVPFA
TVP38_COPC7     ---------IWLVILFYIAFGVFVIIVTPARIAQFLYDQAKLLAATGWVALLLSIICISFPPLIGHTTLV
Y305_SYNY3      --------------------------------------ALQWIDGLGTWAAIAFMLLYTVATVVFLPGSI
TM41_DICDI      ----------------------------------------------------------------------
TVP38_VANPO     --------------------------------------------------VLVTLIFFVAFPPM--IGFS
TVP38_KLULA     ---------------------------------------------------LVLMLLILAVSFPPLIGYS
TM41B_XENTR     --------------------------------------------------VLVAYFTTIFLQTFAIPGSI
TM41B_XENLA     --------VMFLVYKYFPQLSEEELEKIKVPRDMDDAKALGKVLSKYKDTFYVEVLVAIFLQTFAIPGSI
TM41B_RAT       --------------------------------------------------VLVAYFATIFLQTFAIPGSI
TM41B_MOUSE     --------------------------------------------------VLVAYFATIFLQTFAIPGSI
TM41B_HUMAN     --------------------------------------------------VLVAYFATIFLQTFAIPGSI
TM41B_CHICK     -----LILVSIFTIAAFLMFSEEEGKCIKIPRDMDDAKALGKVLSKYKDTFYVQVLVAVFLQTFAIPGSI
TVP38_CANGA     ----------------------------------------------------------------------
TVP38_DEBHA     ---------------------NAIVVVLIMIFHKSIIQAIVVISDKGQGLLFTLVFMVGFPPLLGFSALS
TVP38_ASHGO     --------------------------------------------------------------------SM
TVP38_SCHPO     ---------------------------------------------------LIALVLIAASSLLGQDPLA
ICAC_STAAW      ----------------------------------------------------------------------
ICAC_STAAS      ----------------------------------------------------------------------
ICAC_STAAR      ----------------------------------------------------------------------
ICAC_STAAN      ----------------------------------------------------------------------
ICAC_STAA8      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FLTGANLIIFGLNKGFLVSWAGEVIGAAISFLLYRWGITSVAKLSTEQWKLFKTINSLPPLKQTYFLFIL
YDJZ_ECOLI      LITFANASLFGAFWGGLLSWTSSMAGAALCFFIARMGREVVEKLTGK--TVLDSMDGFFTRYGKHTILVC
YHJE_BACSU      VFVVANTNSFGLWEGFILSWAGSTAGSILVFLIVR---------QYGQRKLLGFIRSHPSVRKLMLMFLL
YQED_BACSU      LIAALNGAVFGTANGIWITLTGSMLGTILLFFLARYSFRDWARKKVQAYPAIQSYEASFNKNAFTAVLLG
TVP38_COPC7     TLCG---FAYGM-KGFYIAFAGSILGSALVFVVLRFLFTEKIRSWSAQNEKWQALEAVVRSKGLPLIVLI
Y305_SYNY3      LTLGAG-VVFGVILGSIYVFIGATLGATAAFLVGRYLARGVAKKIAGNQK-FKAIDEAVGKEGLKIVILT
TM41_DICDI      ------------------------LGATFSYLIYYIGRNLVRKLFPDKLKLFSDSLSQKRDNLLNYIVFL
TVP38_VANPO     LLSTTTGLIYGISKGWVILAIGAVTGSICSFALFKTILHSRAEKLIQMNRRFAAFASILQENNSYWILLL
TVP38_KLULA     FLSLSTGLIYGLSKGWFILAMSTVIGSVLSFTVFQRLLHSHAERLIRMNPKLEAVSSVLQGNDSYWMILI
TM41B_XENTR     FLSILSGFLYPFPLALFLVCLCSGLGASFSYLLYLVGRPVVYKLSDKAIKWSQQVERHRDHLINYIIF-L
TM41B_XENLA     FLSILSGFLYPFPLALFLVCLCSGLGASFCYLLYLVGRPVVYKLSDKAIKWSQQVERHRDHLINYIIF-L
TM41B_RAT       FLSILSGFLYPFPLALFLVCLCSGLGASFCYMLYLVGRPVVYKYLTE--KAVKWSQQVERHREHLYIIFL
TM41B_MOUSE     FLSILSGFLYPFPLALFLVCLCSGLGASFCYMLYLVGRPVVYKYLTE--KAVKWSQQVERHREHLYIIFL
TM41B_HUMAN     FLSILSGFLYPFPLALFLVCLCSGLGASFCYMLYLVGRPVVYKYLTE--KAVKWSQQVERHREHLYIIFL
TM41B_CHICK     FLSILSGFLYPFPLALFLVCLCSGLGASFCYMLYLVGRPVVYKYLTE--KAVKWSEQVERHREHLYIIFL
TVP38_CANGA     FLSTSTGLIYGVSHGWFVLALGSVTGSVASFYVFKNLLHSRAEKLVHMNKRFEAFASILQEDNSYLMLLL
TVP38_DEBHA     MLAG---MVYGFVHGWILLACASISGSFCSFLVFRYLLHSRAERLMNSNKKFRAFSELREDSSLFILVLL
TVP38_ASHGO     LCTSAGLVYGVSFKGWLIISLGTVLGSIAAFSVFKTVFRSYAERLIRLNDKFEALASILQDHNSYWIILL
TVP38_SCHPO     LLIGA---VWGLNVGFWTVVCGIFIGETIAFMAYRYFLEQKAQEFREHHEHYGTFVKIVEEGSYPLIWLI
ICAC_STAAW      ----------------------------------------IALANGDYWNVTSFSYSLTPYNSIMFIVIL
ICAC_STAAS      ----------------------------------------IALANGDYWNVTSFSYSLTPYNSIMFIVIL
ICAC_STAAR      ----------------------------------------IALANGDYWNVTSFSYSLTPYNSIMFIVIL
ICAC_STAAN      ----------------------------------------IALANGDYWNVTSFSYSLTPYNSIMFIVIL
ICAC_STAA8      ----------------------------------------IALANGDYWNVTSFSYSLTPYNSIMFIVIL


                         +         .         .         .         .         *         .:210
query           RMAPFIPSGLINLFGAITSVSLLNFLIATTAGKFPALLLETAFSYHLITLGRNYIYVGISILIALLLYLG
YDJZ_ECOLI      RLLPFVPFDPISYAAGLTSIRFRSFFIATGLGQLPATIV-YSWAGSMLTGGTFWFVTGLFILFALTVVIF
YHJE_BACSU      LCFPFTPSAAVNVVAGLSRIGTRPFILAAASGKLVMIFMISFIGYDLHALITQPIRTVIAVLITVLWYVG
YQED_BACSU      RLIPVIPSLVMNVICGLSQVRWHVFFFASLIGKIPNIVVVTIAGANFTSLLSISIYGTYILIIMLVIY--
TVP38_COPC7     RVSPFPPWVYANLFASIEPVKLWQF-VAATCFITPKLLL-------------------------------
Y305_SYNY3      RLSPVFPFNLLNYAYGITNVSLKDYVIG-SLGMIPGTIM--------------YVYIG------------
TM41_DICDI      RITPFLPNWFINLASPLLDVPIHTFAIGTFIGIMPATFL-------------------------------
TVP38_VANPO     RLCPFPYSLTNGAVGAVYGVSIKNFAIGNII-TTPKLLIYLFIGSRIKNMGESKIFDLVSILLTVLLYFK
TVP38_KLULA     RLCPFPYSFINGAIAGIYGISIKNFAIANII-TTPKAVIYLFVGERLKNMGENFISIGFLILTTWFLYYR
TM41B_XENTR     RITPFLPNWFINITSPVINVPLKVFFLGTFIGSFVAIKAGTTL-YQLTTAGEAVSWNSVIILMVLAV-LS
TM41B_XENLA     RITPFLPNWFINITSPVINVPLKVFFLGTFIGSFVAIKAGTTL-YQLTTAGEAVSWNSVIILMVL-----
TM41B_RAT       RITPFLPNWFINITSPVINVPLKVFFIGTFLGSFVAIKAGTTL-YQLTTAGEAVSWNSVFILMILAL---
TM41B_MOUSE     RITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPVAIKAGTTLHLTTAGEAVSWSSVFILMVLAL---
TM41B_HUMAN     RITPFLPNWFINITSPVINVPLKVFFIGTFLGSFVAIKAGTTL-YQLTTAGEAVSWNSIFILMIL-----
TM41B_CHICK     RITPFLPNWFINITSPVINVPLKVFFIGTFLGSFVAIKAGTTL-YQLTTAGEAVSWNSLFVLMILAI---
TVP38_CANGA     RLCPFPYSLTNGAIAGIYGISVKNFTIA------------------------------------------
TVP38_DEBHA     RLCP-LPYSLSNALAAIPELPATTYFLASLITS-PKLMIHIFVGHKLKELGSTHLIDILSIIISLTTYII
TVP38_ASHGO     RLCPFPYSLTNGAIAGVYGISIRNFSIA------------------------------------------
TVP38_SCHPO     RLS-FLPTHFTTVFFALPELSYIGWAIAFWLSCFKYLV--PVYAGYCIVHNKSSAANIVGIVLSIVVTLG
ICAC_STAAW      GICTHFKTMLFNTIQMISAFSFFIYLLHP-------IILDSLFAYTNIFEDNTMVFLAISLLFILGLCIG
ICAC_STAAS      GICTHFKTMLFNTIQMISAFSFFIYLLHP-------IILDSLFAYTNIFEDNTMVFLAISLLFILGLCIG
ICAC_STAAR      GICTHFKTMLFNTIQMISAFSFFIYLLHP-------IILDSLFAYTNIFEDNTMVFLAISLLFILGLCIG
ICAC_STAAN      GICTHFKTMLFNTIQMISAFSFFIYLLHP-------IILDSLFAYTNIFEDNTMVFLAISLLFILGLCIG
ICAC_STAA8      GICTHFKTMLFNTIQMISAFSFFIYLLHP-------IILDSLFAYTNIFEDNTMVFLAISLLFILGLCIG


                         .         .         .         +         .         .         .:280
query           IKKEMRRLEKQYE
YDJZ_ECOLI      MAKKI-WLERQ--
YHJE_BACSU      KKVE---------
YQED_BACSU      -------------
TVP38_COPC7     -------------
Y305_SYNY3      -------------
TM41_DICDI      -------------
TVP38_VANPO     TQKRYQQLQDQ--
TVP38_KLULA     FKKRYLELQSEQQ
TM41B_XENTR     ILPAIKKLKKKFE
TM41B_XENLA     -------------
TM41B_RAT       -------------
TM41B_MOUSE     -------------
TM41B_HUMAN     -------------
TM41B_CHICK     -------------
TVP38_CANGA     -------------
TVP38_DEBHA     YNKMQRKLE----
TVP38_ASHGO     -------------
TVP38_SCHPO     -------------
ICAC_STAAW      VGMILR-------
ICAC_STAAS      VGMILR-------
ICAC_STAAR      VGMILR-------
ICAC_STAAN      VGMILR-------
ICAC_STAA8      VGMILR-------