[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50573.1

[Show Plain Result]


## Summary of Sequence Search
    1::446
    3::434     e-150  61%  446 aa  SRP54_BACSU RecName: Full=Signal recognition particle
    3::430     e-128  54%  516 aa  SRP54_STRMU RecName: Full=Signal recognition particle
    1::425     e-124  52%  453 aa  SRP54_ECOLI RecName: Full=Signal recognition particle
    1::425     e-124  52%  453 aa  SRP54_ECOL6 RecName: Full=Signal recognition particle
    1::425     e-124  52%  453 aa  SRP54_ECO57 RecName: Full=Signal recognition particle
    1::422     e-122  52%  462 aa  SRP54_HAEIN RecName: Full=Signal recognition particle
    1::416     e-114  52%  430 aa  SRP54_THEAQ RecName: Full=Signal recognition particle
    1::434     e-112  50%  525 aa  SRP54_MYCTU RecName: Full=Signal recognition particle
    1::434     e-112  50%  525 aa  SRP54_MYCBO RecName: Full=Signal recognition particle
    1::419     e-110  49%  482 aa  SRP54_SYNY3 RecName: Full=Signal recognition particle
    1::407     e-109  49%  485 aa  SRP54_SYNE7 RecName: Full=Signal sequence-binding protein;
    1::434     e-108  46%  449 aa  SRP54_RICPR RecName: Full=Signal recognition particle
   77::505     e-108  48%  564 aa  SR54C_ARATH RecName: Full=Signal recognition particle 54 kDa
    1::434     e-107  46%  449 aa  SRP54_RICFE RecName: Full=Signal recognition particle
    1::434     e-107  46%  449 aa  SRP54_RICBR RecName: Full=Signal recognition particle
    1::434     e-106  45%  449 aa  SRP54_RICCN RecName: Full=Signal recognition particle
    1::434     e-105  48%  521 aa  SRP54_MYCLE RecName: Full=Signal recognition particle
    1::421     e-103  49%  450 aa  SRP54_BUCAP RecName: Full=Signal recognition particle
    1::431     e-103  45%  451 aa  SRP54_BUCAI RecName: Full=Signal recognition particle
    1::434     e-102  44%  449 aa  SRP54_RICTY RecName: Full=Signal recognition particle
    1::405     e-100  46%  454 aa  SRP54_AQUAE RecName: Full=Signal recognition particle
    1::420     9e-98  44%  450 aa  SRP54_BUCBP RecName: Full=Signal recognition particle
    7::431     1e-92  43%  447 aa  SRP54_MYCMY RecName: Full=Signal recognition particle
    3::425     2e-91  39%  448 aa  SRP54_HELPJ RecName: Full=Signal recognition particle
    3::425     2e-90  39%  448 aa  SRP54_HELPY RecName: Full=Signal recognition particle
    6::429     6e-83  39%  448 aa  SRP54_THEON RecName: Full=Signal recognition 54 kDa
    6::429     8e-83  40%  448 aa  SRP54_THEGJ RecName: Full=Signal recognition 54 kDa
    6::430     9e-82  40%  448 aa  SRP54_PYRKO RecName: Full=Signal recognition 54 kDa
    1::421     1e-81  39%  450 aa  SRP54_METM7 RecName: Full=Signal recognition 54 kDa
    1::421     3e-81  38%  450 aa  SRP54_METMP RecName: Full=Signal recognition 54 kDa
    1::425     4e-81  38%  445 aa  SRP54_METS3 RecName: Full=Signal recognition 54 kDa
    1::421     6e-81  38%  450 aa  SRP54_METM5 RecName: Full=Signal recognition 54 kDa
   23::431     7e-81  41%  450 aa  SRP54_MYCPN RecName: Full=Signal recognition particle
    1::421     7e-81  38%  450 aa  SRP54_METVS RecName: Full=Signal recognition 54 kDa
    6::430     1e-80  39%  443 aa  SRP54_PYRAB RecName: Full=Signal recognition 54 kDa
    6::430     1e-80  39%  443 aa  SRP54_PYRFU RecName: Full=Signal recognition 54 kDa
    1::421     3e-80  39%  450 aa  SRP54_METM6 RecName: Full=Signal recognition 54 kDa
    1::424     1e-79  37%  444 aa  SRP54_METST RecName: Full=Signal recognition 54 kDa
   19::429     2e-78  40%  444 aa  SRP54_SULAC RecName: Full=Signal recognition 54 kDa
   22::429     3e-77  40%  445 aa  SRP54_SULTO RecName: Full=Signal recognition 54 kDa
    6::430     5e-77  39%  443 aa  SRP54_PYRHO RecName: Full=Signal recognition 54 kDa
   20::431     1e-76  41%  447 aa  SRP54_SULIY RecName: Full=Signal recognition 54 kDa
   20::431     1e-76  41%  447 aa  SRP54_SULIN RecName: Full=Signal recognition 54 kDa
   20::431     2e-76  41%  447 aa  SRP54_SULIM RecName: Full=Signal recognition 54 kDa
   20::431     2e-76  41%  447 aa  SRP54_SULIL RecName: Full=Signal recognition 54 kDa
   20::431     2e-76  41%  447 aa  SRP54_SULIK RecName: Full=Signal recognition 54 kDa
   20::431     2e-76  41%  447 aa  SRP54_SULIA RecName: Full=Signal recognition 54 kDa
    6::421     7e-76  38%  440 aa  SRP54_METAC RecName: Full=Signal recognition 54 kDa
    3::431     7e-76  38%  447 aa  SRP54_HYPBU RecName: Full=Signal recognition 54 kDa
   23::437     4e-74  38%  446 aa  SRP54_MYCGE RecName: Full=Signal recognition particle
   14::425     7e-74  39%  441 aa  SRP54_STAMF RecName: Full=Signal recognition 54 kDa
    6::424     9e-74  39%  443 aa  SRP54_METBF RecName: Full=Signal recognition 54 kDa
    1::422     2e-73  37%  442 aa  SRP54_METTH RecName: Full=Signal recognition 54 kDa
    6::419     4e-73  37%  446 aa  SRP54_METLZ RecName: Full=Signal recognition 54 kDa
    6::424     4e-72  38%  443 aa  SRP54_METMA RecName: Full=Signal recognition 54 kDa
    6::421     3e-71  36%  439 aa  SRP54_METBU RecName: Full=Signal recognition 54 kDa
   23::432     1e-69  38%  446 aa  SRP54_METS5 RecName: Full=Signal recognition 54 kDa
    6::418     2e-69  40%  444 aa  SRP54_METTP RecName: Full=Signal recognition 54 kDa
    2::423     2e-69  37%  433 aa  SRP54_PYRIL RecName: Full=Signal recognition 54 kDa
    9::424     7e-69  37%  441 aa  SRP54_AERPE RecName: Full=Signal recognition 54 kDa
   27::427     1e-68  36%  451 aa  SRP54_METJA RecName: Full=Signal recognition 54 kDa
    6::434     2e-68  36%  469 aa  SRP54_HALMA RecName: Full=Signal recognition 54 kDa
    6::411     7e-68  36%  444 aa  SRP54_UNCMA RecName: Full=Signal recognition 54 kDa
    2::423     1e-67  37%  433 aa  SRP54_PYRAR RecName: Full=Signal recognition 54 kDa
   10::419     2e-67  37%  456 aa  SRP54_THEAC RecName: Full=Signal recognition 54 kDa
    6::433     2e-67  37%  466 aa  SRP54_HALWD RecName: Full=Signal recognition 54 kDa
    3::427     2e-67  37%  447 aa  SRP54_METKA RecName: Full=Signal recognition 54 kDa
    1::421     2e-67  35%  450 aa  SRP54_META3 RecName: Full=Signal recognition 54 kDa
    2::426     4e-67  35%  455 aa  SRP54_THEVO RecName: Full=Signal recognition 54 kDa
   20::435     5e-67  40%  447 aa  SRP54_SULSO RecName: Full=Signal recognition 54 kDa
    6::437     1e-65  34%  504 aa  SRP54_RAT RecName: Full=Signal recognition particle 54 kDa protein;
    6::437     2e-65  34%  504 aa  SRP54_MOUSE RecName: Full=Signal recognition particle 54 kDa
    6::437     2e-65  34%  504 aa  SRP54_PONAB RecName: Full=Signal recognition particle 54 kDa
    6::437     2e-65  34%  504 aa  SRP54_MACFA RecName: Full=Signal recognition particle 54 kDa
    6::437     2e-65  34%  504 aa  SRP54_HUMAN RecName: Full=Signal recognition particle 54 kDa
    6::433     2e-65  36%  465 aa  SRP54_HALVO RecName: Full=Signal recognition 54 kDa
    6::437     2e-65  34%  504 aa  SRP54_CANFA RecName: Full=Signal recognition particle 54 kDa
    6::437     2e-65  34%  504 aa  SRP54_BOVIN RecName: Full=Signal recognition particle 54 kDa
    9::434     2e-65  37%  451 aa  SRP54_ACIAM RecName: Full=Signal recognition 54 kDa
    4::405     8e-65  36%  433 aa  SRP54_ARCFU RecName: Full=Signal recognition 54 kDa
    6::433     1e-64  36%  464 aa  SRP54_HALLT RecName: Full=Signal recognition 54 kDa
    6::419     1e-63  36%  460 aa  SRP54_HALSA RecName: Full=Signal recognition 54 kDa
    6::419     1e-63  36%  460 aa  SRP54_HALS3 RecName: Full=Signal recognition 54 kDa
    6::424     3e-62  36%  466 aa  SRP54_NATPD RecName: Full=Signal recognition 54 kDa
    2::423     5e-62  34%  433 aa  SRP54_PYRAE RecName: Full=Signal recognition 54 kDa
   21::427     2e-61  35%  541 aa  SRP54_YEAST RecName: Full=Signal recognition particle subunit
    6::440     6e-60  36%  556 aa  SRP54_CANAL RecName: Full=Signal recognition particle 54 kDa
    3::413     1e-59  33%  431 aa  SRP54_PYRCJ RecName: Full=Signal recognition 54 kDa
    2::419     2e-58  33%  522 aa  SRP54_SCHPO RecName: Full=Signal recognition particle 54 kDa
    6::435     5e-58  30%  495 aa  SR542_ARATH RecName: Full=Signal recognition particle 54 kDa
   22::436     9e-58  32%  499 aa  SRP54_GEOCY RecName: Full=Signal recognition particle 54 kDa
    6::435     2e-57  29%  495 aa  SR543_ARATH RecName: Full=Signal recognition particle 54 kDa
    2::423     4e-57  33%  433 aa  SRP54_THENV RecName: Full=Signal recognition 54 kDa
    6::435     1e-56  30%  499 aa  SR542_SOLLC RecName: Full=Signal recognition particle 54 kDa
    6::435     4e-56  31%  496 aa  SR541_SOLLC RecName: Full=Signal recognition particle 54 kDa
    2::430     2e-55  34%  536 aa  SRP54_YARLI RecName: Full=Signal recognition particle 54 kDa
    6::420     2e-55  30%  487 aa  SRP54_ENTHI RecName: Full=Signal recognition particle 54 kDa
    2::434     4e-55  33%  534 aa  SRP54_ASPNG RecName: Full=Signal recognition particle 54 kDa
   24::427     4e-55  31%  493 aa  SR543_HORVU RecName: Full=Signal recognition particle 54 kDa
    6::415     1e-52  32%  542 aa  SRP54_DICDI RecName: Full=Signal recognition particle 54 kDa
    6::431     2e-49  29%  479 aa  SR541_ARATH RecName: Full=Signal recognition particle 54 kDa
  238::497     4e-46  38%  497 aa  FTSY_ECOLI RecName: Full=Cell division protein ftsY;
    6::435     2e-45  27%  497 aa  SR541_HORVU RecName: Full=Signal recognition particle 54 kDa
    6::435     3e-45  27%  497 aa  SR542_HORVU RecName: Full=Signal recognition particle 54 kDa
  128::420     3e-45  37%  421 aa  FTSY_NEIMC RecName: Full=Cell division protein ftsY homolog;
  128::420     4e-45  37%  421 aa  FTSY_NEIMB RecName: Full=Cell division protein ftsY homolog;
  128::420     4e-45  37%  421 aa  FTSY_NEIMA RecName: Full=Cell division protein ftsY homolog;
  124::415     3e-44  37%  416 aa  FTSY_NEIGO RecName: Full=Cell division protein ftsY homolog;
   76::366     7e-44  33%  369 aa  DOCK_SULAC RecName: Full=Probable signal recognition particle
  174::399     4e-40  39%  414 aa  FTSY_HAEIN RecName: Full=Cell division protein ftsY homolog;
   86::286     6e-38  44%  293 aa  FTSY_HELPY RecName: Full=Cell division protein ftsY homolog;
   86::286     8e-38  44%  293 aa  FTSY_HELPJ RecName: Full=Cell division protein ftsY homolog;
   60::313     8e-38  35%  329 aa  FTSY_BACSU RecName: Full=Cell division protein ftsY homolog;
  250::460     1e-37  38%  461 aa  FTSY_AQUAE RecName: Full=Cell division protein ftsY homolog;
   37::303     5e-37  32%  303 aa  FTSY_RICTY RecName: Full=Cell division protein ftsY homolog;
   87::336     5e-37  34%  351 aa  FTSY_MYCHO RecName: Full=Cell division protein ftsY homolog;
   45::303     7e-37  34%  303 aa  FTSY_RICCN RecName: Full=Cell division protein ftsY homolog;
   67::339     1e-36  33%  351 aa  FTSY_BUCAP RecName: Full=Cell division protein ftsY homolog;
   45::303     4e-36  33%  303 aa  FTSY_RICFE RecName: Full=Cell division protein ftsY homolog;
  257::502     6e-36  37%  504 aa  FTSY_SYNY3 RecName: Full=Cell division protein ftsY homolog;
  202::395     1e-35  38%  409 aa  Y291_METJA RecName: Full=Probable signal recognition particle
   43::302     1e-35  37%  304 aa  FTSY_THEAQ RecName: Full=Cell division protein ftsY;
   70::303     1e-34  34%  303 aa  FTSY_RICPR RecName: Full=Cell division protein ftsY homolog;
   45::303     2e-33  33%  303 aa  FTSY_RICBR RecName: Full=Cell division protein ftsY homolog;
   94::376     6e-32  32%  378 aa  FTSY_BUCAI RecName: Full=Cell division protein ftsY homolog;
   87::341     5e-30  34%  348 aa  FTSY_MYCPN RecName: Full=Cell division protein ftsY homolog;
  131::326     4e-29  38%  346 aa  FTSY_MYCGE RecName: Full=Cell division protein ftsY homolog;
  123::391     7e-29  28%  397 aa  FTSY_BUCBP RecName: Full=Cell division protein ftsY homolog;
  156::429     2e-27  31%  430 aa  FTSY_MYCLE RecName: Full=Cell division protein ftsY homolog;
  314::602     4e-27  31%  615 aa  SRPR_DICDI RecName: Full=Signal recognition particle receptor
  291::595     3e-25  32%  614 aa  SRPR_DROME RecName: Full=Signal recognition particle receptor
  289::422     3e-25  44%  422 aa  FTSY_MYCTU RecName: Full=Cell division protein ftsY homolog;
  289::422     3e-25  44%  422 aa  FTSY_MYCBO RecName: Full=Cell division protein ftsY homolog;
  256::546     1e-22  28%  547 aa  SRPR_SCHPO RecName: Full=Signal recognition particle receptor
  324::619     6e-22  29%  639 aa  SRPR_BOVIN RecName: Full=Signal recognition particle receptor
  323::618     2e-21  29%  638 aa  SRPR_HUMAN RecName: Full=Signal recognition particle receptor
  321::616     2e-21  29%  636 aa  SRPR_MOUSE RecName: Full=Signal recognition particle receptor
  298::602     2e-20  31%  621 aa  SRPR_YEAST RecName: Full=Signal recognition particle receptor
  323::618     3e-20  28%  638 aa  SRPR_CANFA RecName: Full=Signal recognition particle receptor
  220::392     7e-12  32%  437 aa  FLHF_PSEPU RecName: Full=Flagellar biosynthesis protein
  237::431     1e-10  28%  459 aa  FLHF_HELPY RecName: Full=Flagellar biosynthesis protein
  233::427     1e-10  28%  455 aa  FLHF_HELPJ RecName: Full=Flagellar biosynthesis protein
  171::343     2e-10  27%  373 aa  FLHF_AQUAE RecName: Full=Flagellar biosynthesis protein
  154::397     4e-10  25%  437 aa  FLHF_TREPA RecName: Full=Flagellar biosynthesis protein
  280::474     1e-09  29%  484 aa  FLHF_CAMJE RecName: Full=Flagellar biosynthesis protein
   93::334     3e-09  27%  388 aa  FLHF_BORBU RecName: Full=Flagellar biosynthesis protein
  222::383     2e-08  30%  429 aa  FLHF_PSEAE RecName: Full=Flagellar biosynthesis protein
   14::64      3e-05  37%  196 aa  CYSC_AERS4 RecName: Full=Adenylyl-sulfate kinase;       
  359::427     7e-05  45%  682 aa  SYM_HAEI8 RecName: Full=Methionyl-tRNA synthetase;       
   43::395     7e-05  24%  462 aa  MNME_LACC3 RecName: Full=tRNA modification GTPase mnmE;       
  133::294     9e-05  28%  374 aa  Y158_METJA RecName: Full=UPF0425 pyridoxal phosphate-dependent
  359::427     9e-05  45%  684 aa  SYM_HAEPS RecName: Full=Methionyl-tRNA synthetase;       
  359::427     9e-05  45%  682 aa  SYM_HAEIN RecName: Full=Methionyl-tRNA synthetase;       
  359::427     9e-05  45%  682 aa  SYM_HAEIE RecName: Full=Methionyl-tRNA synthetase;       
   24::72      9e-05  37%  207 aa  CYSC_VIBVY RecName: Full=Adenylyl-sulfate kinase;       
   24::72      9e-05  37%  207 aa  CYSC_VIBVU RecName: Full=Adenylyl-sulfate kinase;       
   15::71      1e-04  35%  205 aa  CYSC_SHESM RecName: Full=Adenylyl-sulfate kinase;       
   15::71      1e-04  35%  205 aa  CYSC_SHESA RecName: Full=Adenylyl-sulfate kinase;       
   15::71      1e-04  35%  205 aa  CYSC_SHEON RecName: Full=Adenylyl-sulfate kinase;       
   12::47      1e-04  50%  183 aa  CYSC_AERPE RecName: Full=Probable adenylyl-sulfate kinase;       
   14::64      1e-04  35%  197 aa  CYSC_AERHH RecName: Full=Adenylyl-sulfate kinase;       
    8::53      2e-04  33%  373 aa  GPN1_BOVIN RecName: Full=GPN-loop GTPase 1;AltName:
    2::93      3e-04  33%  208 aa  KTHY_JANSC RecName: Full=Thymidylate kinase;       
   22::72      3e-04  35%  205 aa  CYSC_VIBPA RecName: Full=Adenylyl-sulfate kinase;       
    8::161     3e-04  26%  240 aa  YCF27_PORAE RecName: Full=Probable transcriptional regulator
  403::486     3e-04  29%  620 aa  NODQ_AZOBR RecName: Full=Bifunctional enzyme nodQ;AltName:
   41::140     3e-04  30%  327 aa  LPXK_METEP RecName: Full=Tetraacyldisaccharide 4'-kinase;       
 1071::1131    3e-04  28% 1522 aa  DNA2_YEAST RecName: Full=DNA replication ATP-dependent helicase DNA2;
  547::641     3e-04  34%  890 aa  CLPB_YEREN RecName: Full=Chaperone protein clpB;
   33::209     3e-04  29%  317 aa  CFXQ_XANFL RecName: Full=Protein cfxQ;
   61::161     4e-04  33%  343 aa  RECA_RICCN RecName: Full=Protein recA;AltName: Full=Recombinase A;
   61::161     4e-04  33%  343 aa  RECA_RICAE RecName: Full=Protein recA;AltName: Full=Recombinase A;
  451::500     4e-04  34%  633 aa  NODQ_RHISB RecName: Full=Bifunctional enzyme nodQ;AltName:
   40::140     4e-04  30%  327 aa  LPXK_METC4 RecName: Full=Tetraacyldisaccharide 4'-kinase;       
    3::95      4e-04  32%  207 aa  KTHY_DINSH RecName: Full=Thymidylate kinase;       
  460::500     6e-04  37%  641 aa  NODQ_RHIME RecName: Full=Bifunctional enzyme nodQ;AltName:
  284::426     6e-04  27%  609 aa  MPA_MYCLE RecName: Full=Proteasome-associated ATPase;AltName:
  359::427     7e-04  42%  682 aa  SYM_HAEIG RecName: Full=Methionyl-tRNA synthetase;       
   24::71      7e-04  38%  205 aa  CYSC_SHESW RecName: Full=Adenylyl-sulfate kinase;       
   16::71      7e-04  34%  205 aa  CYSC_SHESR RecName: Full=Adenylyl-sulfate kinase;       
   24::71      7e-04  38%  205 aa  CYSC_SHEPC RecName: Full=Adenylyl-sulfate kinase;       
   24::71      7e-04  38%  205 aa  CYSC_SHEB9 RecName: Full=Adenylyl-sulfate kinase;       
   24::71      7e-04  38%  205 aa  CYSC_SHEB8 RecName: Full=Adenylyl-sulfate kinase;       
   24::71      7e-04  38%  205 aa  CYSC_SHEB5 RecName: Full=Adenylyl-sulfate kinase;       
   24::71      7e-04  38%  205 aa  CYSC_SHEB2 RecName: Full=Adenylyl-sulfate kinase;       
   27::100     7e-04  28%  197 aa  CYSC_BACA2 RecName: Full=Adenylyl-sulfate kinase;       
   23::95      7e-04  39%  309 aa  CBBX_RHOSH RecName: Full=Protein cbbX;
  270::405     0.001  30%  578 aa  YBHF_SHIFL RecName: Full=Uncharacterized ABC transporter
  270::405     0.001  30%  578 aa  YBHF_ECOLI RecName: Full=Uncharacterized ABC transporter
  253::359     0.001  32%  573 aa  Y1704_LACJO RecName: Full=Putative ABC transporter ATP-binding
   18::64      0.001  50%  232 aa  RL1_LACBA RecName: Full=50S ribosomal protein L1;
  510::619     0.001  26% 1879 aa  POLG_SMSV1 RecName: Full=Genome polyprotein;Contains:  RecName:
  450::499     0.001  36%  632 aa  NODQ_RHITR RecName: Full=Bifunctional enzyme nodQ;AltName:
    4::121     0.001  26%  192 aa  KAD_CAMHC RecName: Full=Adenylate kinase;         Short=AK;        
    6::285     0.001  20%  467 aa  HSLU_LACS1 RecName: Full=ATP-dependent hsl protease ATP-binding
  359::400     0.001  40%  822 aa  FTSH7_ORYSJ RecName: Full=Cell division protease ftsH homolog 7,
    1::446

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAVGQDVLESLSP
SRP54_BACSU     -FEGLADRLQQTISKIRGKGKVSEQDVKEMMREVRLALLEAXXXXXXXXXXXXXXSERAVGQDVMKSLTP
SRP54_STRMU     -FESLTERLQGVFKNLRGKRKLSEKDVQEVTKEIRLALLEADVALPVVKEFIKRVRKRAVGHEVIDTLDP
SRP54_ECOLI     MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
SRP54_ECOL6     MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
SRP54_ECO57     MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTP
SRP54_HAEIN     MFENLSDRLSKTLRNITGKGRLTEDNIKETLREVRMALLEADVALPVVREFIAKVKESALGEEVNKSLTP
SRP54_THEAQ     MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
SRP54_MYCTU     MFESLSDRLTAALQGLRGKGRLTDADIDATTREIRLALLEADVSLPVVRAFIHRIKERARGAEVSSALNP
SRP54_MYCBO     MFESLSDRLTAALQGLRGKGRLTDADIDATTREIRLALLEADVSLPVVRAFIHRIKERARGAEVSSALNP
SRP54_SYNY3     MFDALADRLEDAWKKLRGQDKISESNIKEALQEVRRALLAADVNLQVVKGFIKDVEQKALGADVISGVNP
SRP54_SYNE7     MFDALAERLEQAWTKLRGQDKISESNVQEALKEVRRALLEADVNLGVVKEFIAQVQEKAVGTQVISGIRP
SRP54_RICPR     MFKTLTQNLTKIFDKLVNSGILTENQIDTAMRDVRVALLESDVALPVIKGFIEEVKQKALGQEVIKSVSP
SR54C_ARATH     MFGQLTGGLEAAWSKLKGEEVLTKDNIAEPMRDIRRALLEADVSLPVVRRFVQSVSDQAVGMGVIRGVKP
SRP54_RICFE     MFKTLTQNLTKIFDKLVSSGILTEAQIDAAMRDIRVALLESDVALPVIKDFIAEVKQKALGQEVIKSVSP
SRP54_RICBR     MFKTLTQNLMKIFDRLVSSGLLTEEQIDAALRDIRVALLESDVALPVIKNFVAEVKQKALGQEVIKSVSP
SRP54_RICCN     MFKTLTQNLTKIFDKLVSSGILTEAQIDAAMRDIRVALLESDVALPVIKDFIAEVKQKALGQEVIKSVSP
SRP54_MYCLE     MFESLSNRLTGVIQGLRGKGRLTDADIEATTREIRLALFEADVSLPVVRAFVHRIKERARGTEVSAALNP
SRP54_BUCAP     MFNNLTERLSQSLRKIINKGRLTEENIKDTIREVRKALLEADVTLSVIKKFIQNVSKKAIGHEINKSLTP
SRP54_BUCAI     MFNNLTQRLSDSLKKILNKGRLTEENIKETIREVRKALLEADVALSVIKKFIENVKKKSIGHEINKSLTP
SRP54_RICTY     MFKTLTQNLTKIFDRLVNSGILTENQIDTAMRDVRVALLESDVALPVIKGFIAEVKQKALGQEVIKSVSP
SRP54_AQUAE     MLELLTEKFSHALEKLTNARKITEKNINQTLREIRLALLEADVDYQVAKDFIKRIREKVVGKEVPKNLSP
SRP54_BUCBP     MFNNLTQRFLKIIKKISNKGRLTEKNIKETLREIRIALLEADVALPVVKNFIPSIQKSVIGNQVNKSLTP
SRP54_MYCMY     ----LSKRMQKSIEKNMKNSTLNEENIKETLKEIRLSLLEADVNIEAAKEIINNVKQKALGGYISEGASA
SRP54_HELPJ     ------QALSDGFKNALNKIRFQDDELDRALDELKKTLLKNDVHHKVARELLKKVESQTKAGGIGK----
SRP54_HELPY     ------QALSDGFKNALNKIRFQDDELDRALDELKKTLLKNDVHHKVARELLKKVES----QTKLNGIGK
SRP54_THEON     ----LGKALNNALRKLARSSTVDEATIKEVVRDIQRALIQADVNVRLVLDLTKRIEKRALEEEPPTGVSK
SRP54_THEGJ     ----LGKALNSALRKLARSSTVDEALIREVVRDIQRALIQSDVNVRLVLQLTKRIQERALNEKPPAGVSP
SRP54_PYRKO     ----LGQALNSALKKLARSSTVDEATIKEIVRDIQRALLQADVNVKLVLQLTKQIQKRALEEEPPAGVSK
SRP54_METM7     MLDKLGQNLSEALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGLSK
SRP54_METMP     MLDKLGQNLSDALNKLKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIDEAPPKGLSK
SRP54_METS3     MLGNLGENLTKTMKKLVGISVIDKKTIEEVVKEIQRALIQSDVNIALVLDLSKKIKKRALEEEPPKGITP
SRP54_METM5     MLDKLGQNLSDALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGLSK
SRP54_MYCPN     ---------------------ISETDVQAVLKEIRIXXXXXXXXXXXXKNFIKAIREQTVGQTVEPGQDL
SRP54_METVS     MLDKLGQNLSEALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGFSK
SRP54_PYRAB     ----LGKALSNALKKIARAGSVDEALVKEVVRDIQRALIQADVNVRLVLKLTKEIQRRALEEKPPAGISK
SRP54_PYRFU     ----LGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
SRP54_METM6     MLDKLGQNLSEALNKIKNATFVDKKLVKEVIKDIQKALIQSDVNVKLVFNMSKEIERKAIEEAPPKGLSK
SRP54_METST     MLEGLSESLTQTMKKLAGMSIIDKKTLKDVTKDIQRALIQSDVNVKVVFGLTKKIEKRALEEELPKGLSP
SRP54_SULAC     -----------------------EKAVNEFIKELQIILIKADVNVRLVKDLTDRIKKRITEEKPPSAIEK
SRP54_SULTO     --------------------------VNDFIKELQISLIKSDVNVKLVSNLTQKIKDRLEKEKPPTAIER
SRP54_PYRHO     ----LGRALSNALKKIARAGSVDEALVKEVVRDIQRALLQADVNVRLVLKLTKEIQRRALEEKPPAGISK
SRP54_SULIY     -----------------------EKAVDEFIKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIN     -----------------------EKAVDEFIKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIM     -----------------------EKAVDEFVKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIL     -----------------------EKAVDEFIKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIK     -----------------------EKAVDEFVKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_SULIA     -----------------------EKAVDEFVKELQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_METAC     ----LGDSLQGALKKLIGAGRIDERTVNEVVKDIQRALLQADVNVKLVMGMSQRIKERAMKEEPPAGMNP
SRP54_HYPBU     ---GLDDIRRAVSKLLKRSGPY-ENIVNEFIRDLQRALISADVNVRLVFNLTKRIRERALKEQPPPGLSR
SRP54_MYCGE     ---------------------ITEKDVELVLKEIRIXXXXXXXXXXXXKNFIKAIRDKTVGQTIEPGQDL
SRP54_STAMF     ---------------LSGKGDY-ERAVKEFIRDLQKELIKADVNVKLVLELTKKIRERALKEEPPPGITR
SRP54_METBF     ----LGDSLQGALKKLIGAGRIDERTVNEVVKDIQRALLQADVNVKLVMGMSQRIKERAMKEAPPAGMNP
SRP54_METTH     MLGNLGRSLSKTMKKLAGMTIVDEEVVREVIKDIQRALIQSDVNIKLVFNLSKSIEERALNEEPPKGITP
SRP54_METLZ     ----LSNSLKDAMKKLAGKTVIDRAAVDELVRDLQRALLSSDVNVKLVMELSKQIKARSLDEDLPKGINA
SRP54_METMA     ----LGDSLQGALKKLIGAGRIDERTVNEVVKDIQRALLQADVNVKLVMGMSQRIKERAMKEDPPAGMNP
SRP54_METBU     ----LGSSLQDALKKLVGAGRIDEKTVTEVVKDIQRALLQADVNVKLVMQMSSHIKERALKEEVPPGMNP
SRP54_METS5     --------------------------VEEFIKDIQKALISSDVQVKLVFSLTNKIKERLKKETPPSNLER
SRP54_METTP     ----LGGSLRGALKKIASATRVDKALVDDAVRDIQRALLQADVNVKLVMSLSNRIRERALNEKPPAGMNP
SRP54_PYRIL     --KALGEVFSKLVEKIRGVSYIDEATLQELSREIQRALLKADVPLDMVKTFTENAVKRMREEKPPAGIPP
SRP54_AERPE     -----------VAKFLRGGG-VYEKAVDAFVKDLQRELIKADVNVKLVLNVTRRIKERALKEEPPPGVTR
SRP54_METJA     --------------------------IKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSK
SRP54_HALMA     ----LGSSLRGTLDDLRGKSRLSEEDIEDIVKEIQRSLLQADVDVGLVQDLSNSIETRALDEEPPAGTTP
SRP54_UNCMA     ----LGTSLKDALRKIANSGKIDKEVIDEVVKDIQRAMIQADVNVKLVMKLSSTIKNRALTEAPPAGMNS
SRP54_PYRAR     --KALTELFSKLVEKIRDVEYIDEATLQEIAREIQRTLLKADVPLDLVKTFTDNAVKRIREEKPPAGIPP
SRP54_THEAC     --------LRETIRKITGSSYIDKETVKEISKDLQRILLKADVNVKTVLQVTKEMERRALEEKPPAGMAH
SRP54_HALWD     ----LGSSLRGSLDKLQGKSRLXXXXXXXXXXXXQRSLLSADXXXXXXXXXXXXIEDRATGEEPPAGTSA
SRP54_METKA     ---GFADRLAEITKKIKGASIIDEDFVKEVVRDVQRALLEADVDVKLVLELSKRIEKRALEEEPPAGVPK
SRP54_META3     MLDKLGSNINNALSKIKNATFVDKKLVKEVIKDIQKALIQADVNVKLVFAMSKEIERKAIYESAPKGLSK
SRP54_THEVO     VLESLSSSLRETIRKITGSTYIDKNTVKEISKDLQRILLKADVNVQTVLNITKEMERRALEEKPPVGMAH
SRP54_SULSO     -----------------------EKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLER
SRP54_RAT       ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_MOUSE     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_PONAB     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_MACFA     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_HUMAN     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_HALVO     ----LGSSLRGSLDKLRGKSRLDEDDVQEIVKEIQRXXXXXXXXXXXXXXXXXXIKTRALEEEPPGGTSA
SRP54_CANFA     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_BOVIN     ----LGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
SRP54_ACIAM     ---------DAVRKFLTGSSSY-DKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
SRP54_ARCFU     ------ESLKEVARKIAGSSSIDKKFVEEMVKEIQRALIKADVNVRQVKEISDAIKKRALSEDVLPALNA
SRP54_HALLT     ----LGTSLRSSLDKLQGKSRLSESDVEEIVKEIQRSLLSADVDVSLVMELSDSIKTRALEEEPPGGTTA
SRP54_HALSA     ----LGSSLRGTLDTLRGKSRISEEDVDKVVKEIQRSLLQADVDVDLVMDLSESITERSLEEEPPGGTSA
SRP54_HALS3     ----LGSSLRGTLDTLRGKSRISEEDVDKVVKEIQRSLLQADVDVDLVMDLSESITERSLEEEPPGGTSA
SRP54_NATPD     ----LGSSLRGTLDKLQGKTTLSEDDVEEIVKEIQRXXXXXXXXXXXXXXXXXXIRERALDEEPPAGTTA
SRP54_PYRAE     --KALTEIFGKLLEKIRGVDYIDEATLQELSREIQRTLLKADVPLDLVKSFTENAVKRIKEEKPPAGIPP
SRP54_YEAST     ----------------------TQDDVDVMLKGIVTALLESDVNIALVSKLRNNIRSQLLSENRSEKSTT
SRP54_CANAL     ----LGSRLRGALSSVESG---SDDEIQQMIKDICSALLESDVNVKLVAKLRGNIKNKIDESNVSKAMNK
SRP54_PYRCJ     ----LSEVFSKLIEKIRGVDYIDEAVLQELSREIQRSLLKADVPLELVKAFTDSAVKRIREEKPPAGIPP
SRP54_SCHPO     VFADLGRRLNSALGDFSKATSVNEELVDTLLKNICTALLETDVNVRLVQELRSNIKKKINVSTLPQGING
SR542_ARATH     ----LGGRIMSAIQKMNNVTIIDEKALNDCLNEITRALLQSDVSFPLVKEMQTNIKKIVNLEDLAAGHNK
SRP54_GEOCY     ---------------------INEEVLQAMLKEICTALLEADVNVKLVGKLRQNVRAAIDFEDMGAGLSK
SR543_ARATH     ----LGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIVNLEDLAAGHNK
SRP54_THENV     --KALSEVFGKLVEKIRGVSYIDEATLQDLSREIQRALLKADVPLDMVKAFTDAAVKRIKEEKPPAGIPP
SR542_SOLLC     ----LGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMTTNIKKIVNLDDLAAGHNK
SR541_SOLLC     ----LGGSISRALQQMSNATIIDEKVLNECLNEITRALLQADVQFKLVRDMSTNIKKIVNLEDLAAGHNK
SRP54_YARLI     VLEDLGKRINGAFANLS-KGGDIDEALDAMLKEVCSALLESDVNIKLVSQLRQKVKNSVKATP--NGASK
SRP54_ENTHI     ----LGSSLVTALRKMTSSTVVDEEVINTLLKEIETSLLGEDVNPIFIRQMVNNIKKKINSEDIPDGIDK
SRP54_ASPNG     VLQDLGRRINAAVNDLTRSNNLDEKQADDMIKEICAALLSADVNVRLVQSLRKSIKSSVNFASLPPAVNK
SR543_HORVU     -----------------------ESVLRECLNEIARALMQSDVRFKTVCDLQANIR-KTVNLEALAAGTN
SRP54_DICDI     ----LGNQLSSALRSLNETTIVNEDTINQLLKEVGNALSKSDVSMSLIIQMRKNIKDKIKLDQMAAGLNK
SR541_ARATH     ----LGGRITRAIQQMNNVTIIDEKVLNDFLNEITRALLQSDVSFGLVEKMQTNIKKIVNLDDLAAGHNK
FTSY_ECOLI      ----------------------------------------ADVGVETTRKIITNLTEGASRKQ----LRD
SR541_HORVU     ----LGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIR-KIVNLETLAAGTN
SR542_HORVU     ----LGGSISRALAQMSNATVIDEKVLGECLNEISRALLQSDVQFKMVRDMQTNIR-KIVNLETLAAGTN
FTSY_NEIMC      --QGLTKSRDKMAKSLAGVGQIDED----LYEELETVLITSDMDMEATEYLMKDVRDRVS----LKGLKD
FTSY_NEIMB      --QGLTKSRDKMAKSLAGVGQIDED----LYEELETVLITSDMGMEATEYLMKDVRDRVS----LKGLKD
FTSY_NEIMA      --QGLTKSRDKMAKSLAGVGQIDED----LYEELETVLITSDMGMEATEYLMKDVRDRVS----LKGLKD
FTSY_NEIGO      --QGLAKSRDKMAKSLAGVGQIGED----LYEELETVLITGDMGMEATEYLMKDVRGRVS----LKGLKD
DOCK_SULAC      ------ENKRSFFDFLKYK-TIKEDDLNDVIEELRFQLLDSDVSYEVTEKILEDLKNNLIGKKVSXXXXX
FTSY_HAEIN      -----------------------------------------------------------------KELQD
FTSY_HELPY      ----------------------------------------------------------------------
FTSY_HELPJ      ----------------------------------------------------------------------
FTSY_BACSU      --------------------------------------ISADVGFTTVMELIDELKKEVKRRNIQDP---
FTSY_AQUAE      ----------------------------------------------------------------------
FTSY_RICTY      ------------------------------LNELEELLISSDISITVVTHIIEKFKNVKFDKTI-DSDTV
FTSY_MYCHO      ----------------------------------------SDISIKLVQIIINECKKEVRN----ENITD
FTSY_RICCN      --------------------------------------ISSDMSVLVVTNIIEEFKKVKFDKEI-DSDTV
FTSY_BUCAP      -----GDSISRIFLSKKIDDAFFE--------ELEDTMLLSDIGVHTTDQIISKLINDATHKE----LKN
FTSY_RICFE      --------------------------------------IASDMSVSVVTNIIEEFKKVKFDKEI-DSDTV
FTSY_SYNY3      -------------------------------------------------------------QDKLEEALP
Y291_METJA      ----------------------------------------------------------------------
FTSY_THEAQ      -----------------------------------------DVGLSATEEILQEV--RASGRKDLKEAVK
FTSY_RICPR      ----------------------------------------------------------------IDSDTV
FTSY_RICBR      --------------------------------------ISTDMGSLVAAKIIEDFKSLKFDKEV-ETTEI
FTSY_BUCAI      ----LGDKIYQIFLSKK------IDEVLFEELEEKMLLADIGINTRIISNLIKDVNR--------EDLKN
FTSY_MYCPN      ---------------------------------------------KICDAIVQELKLQRVSDQLIQEIIV
FTSY_MYCGE      ----------------------------------------------------------------------
FTSY_BUCBP      ---------------------------NSLLDDIEEQLLVSDIGVRTTRELVDSL----IKVSTQHXXXX
FTSY_MYCLE      -------------------GDLDED----SWQELEDTLLVADLGPVATESVMSALRSRLLNSNV-HTESD
SRPR_DICDI      ------------FNVLTGNRVIDKQDLEPILADFKLHLTKKNVAPDVADKIVQSIGTGLEGKKLATFQGV
SRPR_DROME      --KGKRGGLLSYFKGIVGAKTMSLADLQPALEKMRDHLISKNVASEIAAKLCDSVAASLDGKQMGTFDSI
FTSY_MYCTU      ----------------------------------------------------------------------
FTSY_MYCBO      ----------------------------------------------------------------------
SRPR_SCHPO      ---------------------LKEEDLSPILKQMQEHLTKKNVANSIALELCESVKASLINKKVGSFDTV
SRPR_BOVIN      -----------MLKGLVGSKSLTREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGK-VMGTFST
SRPR_HUMAN      -----------MLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGK-VMGTFST
SRPR_MOUSE      -----------MLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGK-VMGTFST
SRPR_YEAST      -------------KHVLGNKTINESDLKSVLEKLTQQLITKNVAPEAADYLTQQVSHDLVGSKTAESLTK
SRPR_CANFA      -----------MLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGK-VMGTFST
FLHF_PSEPU      ----------------------------------------------------------------------
FLHF_HELPY      ----------------------------------------------------------------------
FLHF_HELPJ      ----------------------------------------------------------------------
FLHF_AQUAE      ----------------------------------------------------------------------
FLHF_TREPA      -----------------------------SIQRIELLLEENDFSFSFIRKSIARLKDELSYHD-LESFEK
FLHF_CAMJE      ----------------------------------------------------------------------
FLHF_BORBU      -------------KSLKTELAHKKENINHTITKIEDILRENDFSENYIKDINEFIKR----EFSLSDLDD
FLHF_PSEAE      ----------------------------------------------------------------------
CYSC_AERS4      ----------------------------------------------------------------------
SYM_HAEI8       ----------------------------------------------------------------------
MNME_LACC3      ------------------------------------------------------------GKDLSQVKSH
Y158_METJA      ----------------------------------------------------------------------
SYM_HAEPS       ----------------------------------------------------------------------
SYM_HAEIN       ----------------------------------------------------------------------
SYM_HAEIE       ----------------------------------------------------------------------
CYSC_VIBVY      ----------------------------------------------------------------------
CYSC_VIBVU      ----------------------------------------------------------------------
CYSC_SHESM      ----------------------------------------------------------------------
CYSC_SHESA      ----------------------------------------------------------------------
CYSC_SHEON      ----------------------------------------------------------------------
CYSC_AERPE      ----------------------------------------------------------------------
CYSC_AERHH      ----------------------------------------------------------------------
GPN1_BOVIN      ----------------------------------------------------------------------
KTHY_JANSC      ----------------------------------------------------------------------
CYSC_VIBPA      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
NODQ_AZOBR      ---------------------------------------------------VDRFSNRTVGAGMIRH--P
LPXK_METEP      ----------------------------------------------------------------------
DNA2_YEAST      ----------------------------------------------------------------------
CLPB_YEREN      -------------------------------------LVQAEVNATVIANIVADWTGIQVGQMLKDDIRA
CFXQ_XANFL      -----------------------------------------------VPEFLAELDEGLIG------LKP
RECA_RICCN      ----------------------------------------------------------------------
RECA_RICAE      ----------------------------------------------------------------------
NODQ_RHISB      ----------------------------------------------------------------------
LPXK_METC4      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------
NODQ_RHIME      ----------------------------------------------------------------------
MPA_MYCLE       ----------------------------------------------------------------------
SYM_HAEIG       ----------------------------------------------------------------------
CYSC_SHESW      ----------------------------------------------------------------------
CYSC_SHESR      ----------------------------------------------------------------------
CYSC_SHEPC      ----------------------------------------------------------------------
CYSC_SHEB9      ----------------------------------------------------------------------
CYSC_SHEB8      ----------------------------------------------------------------------
CYSC_SHEB5      ----------------------------------------------------------------------
CYSC_SHEB2      ----------------------------------------------------------------------
CYSC_BACA2      ----------------------------------------------------------------------
CBBX_RHOSH      -------------------------------------------------------------KEVLEELDR
YBHF_SHIFL      ------------------KKEATPDDIRHADGMPEININETTPRFE--DAFIDLLGGAGTSESPLGAITP
YBHF_ECOLI      ------------------KKEATPDDIRHADGMPEININETTPRFE--DAFIDLLGGAGTSESPLGAITP
Y1704_LACJO     ------------------------------------ALTAADVNLSSIKE-VDQISTLPVSEKISDKLAA
RL1_LACBA       ----------------------------------------------------------------------
POLG_SMSV1      -----------------------------AITELNNPTITADIDAVINLQRLAETLREEVKSHTLNPLQP
NODQ_RHITR      ----------------------------------------------------------------------
KAD_CAMHC       ----------------------------------------------------------------------
HSLU_LACS1      ---------------------------------------------KTPRQIVAELDKYVIGQD-----SA
FTSH7_ORYSJ     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKLAKLLSKQGRRPLMVAGDIYR
SRP54_BACSU     GQQVIKVVQEELTELMGGEESKIAVAKRPPTVIMMVGLQGAGKTTTSGKLANLLRKKNRKPMLVAADIYR
SRP54_STRMU     SQQIIKIVNEELTAVLGSETAEIEKSSKIPTIIMMVGLQGAGKTTFAGKLAKLVKEENARPLMIAADIYR
SRP54_ECOLI     GQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLEKHKKKVLVVSADVYR
SRP54_ECOL6     GQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLEKHKKKVLVVSADVYR
SRP54_ECO57     GQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLEKHKKKVLVVSADVYR
SRP54_HAEIN     GQEFLKIVQRELEKAMGEANESLNLATQPPAVILMAGLQGAGKTTSVGKLAKFLRERHKKKLVVSADVYR
SRP54_THEAQ     AEVILATVYEALKEALGG-EARLPVL-KDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
SRP54_MYCTU     AQQVVKIVNEELISILGGETRELAFAKTPPTVVMLAGLQGSGKTTLAGKLAARLRGQGHTPLLVACDLQR
SRP54_MYCBO     AQQVVKIVNEELISILGGETRELAFAKTPPTVVMLAGLQGSGKTTLAGKLAARLRGQGHTPLLVACDLQR
SRP54_SYNY3     GQQFIKIVYDELVNLMGESNVPLAQAEQAPTVILMXXXXXXXXXXXXXXXXXXXXXQKRSALMVATDVYR
SRP54_SYNE7     DQQFIKVVYDELVQVMGETHVPLAQAAKAPTVILMXXXXXXXXXXXXXXXXXHLRKEGRSTLLVATDVYR
SRP54_RICPR     GQMIIKIIHEEMINLLASTESKLNLNAKPPVNLLIVGLQGGGKTTASGKLALRLKNQNKKVLLVSLDTYR
SR54C_ARATH     DQQLVKIVHDELVKLMGGEVSELQFAKSGPTVILLAGLQGVGKTTVCAKLACYLKKQGKSCMLIAGDVYR
SRP54_RICFE     GQMIIKIIHEEMINLLASSESKLNLNSKPPVNFLMVGLQGSGKTTASSKLALRLKNQNKKVLLVSLDTYR
SRP54_RICBR     GQXXXXXXXXXXXXXLSSSEIKLNLNAKPPVNLLMVGLQGSGKTTASGKLALCLKNQNKKVLLVSLDTYR
SRP54_RICCN     GQMIIKIIHEEMINLLASSKSKLNLNSKPPVNFLMVGLQGSGKTTASSKLALRLRNQNKKVLLVSLDTYR
SRP54_MYCLE     AQQIVKIVNEELIGILGGETRQLAFAKTPPTVVMLAGLQGSGKTTLAGKLAVRLRRQGHTPLLVACDLQR
SRP54_BUCAP     GQEFIKIVKNELILSMGEKNHDLNLSIQPPAIILVVGLQGVGKTTTLVXXXXXXXXXXXXXILVSTDIYR
SRP54_BUCAI     GQEFIKIVKHELIFAMGEKNHSLNFSIEPPAVILVVGLQGSGKTTSLAXXXXXXXXXXXXXILITSDTYR
SRP54_RICTY     GQMIIKIIHEEMINLLASSESKLNLNSKPPVNLLMVGLQGGGKTTASGXXXXXXXXXXXXXXXXXXDTYR
SRP54_AQUAE     AEFVIKTVYEELVDILGGEKADLKKGT-----VLFVGLQXXXXXXXXXXXANLLKKGGHKVAVSSTDLRR
SRP54_BUCBP     GQELIKIVKKELTLILGKENHSLNLSVTPPAIILMIGLQGSGKTTTTAKLGQLIRTKYKKKVIVTSDIYR
SRP54_MYCMY     HQQMIKIVHEELVNILGKENAPLDINKKP-SVVMMVGLQGSGKTTTXXXXXXXXXXXXXXXXXXXXDIYR
SRP54_HELPJ     -QQFLDALEKSLLEILSAKGSSFTFAQTPPTVVLMAGLQGSGKTTTTAKLAHYLKTKNKKVLLCACDLQR
SRP54_HELPY     -QQFLDALEKSLLEILSAKGSSFTFAQTPPTVVLMAGLQGSGKTTTTAKLAHYLKTKNKKVLLCACDLQR
SRP54_THEON     KEHIIKIVYEELTKFLGTEAKPIEIKEKP-TVLLTVGIQGSGKTTSIAKLARYFQKRGYKVGLVCSDTWR
SRP54_THEGJ     REHVIKIVYEELTKLLGKEAVPLEIREKP-TILLTVGIQGSGKTTTIAKLARHLQKRGYKVGLVCTDTWR
SRP54_PYRKO     KEHIIKIVYEELTKFLG-TEAKPLEIKHKPTVILTVGIQGSGKTTSVAKLARYLQKRGYKVGVVCSDTWR
SRP54_METM7     KEHIVKIVYDELVNLLGETTQKLELDPSKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYR
SRP54_METMP     KEHIVKIVYDELVKLLGETTQKLELDPSKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYR
SRP54_METS3     REHVITIIYEEMVNLLGGEAPGLDIDVKPYKILFL-GLQGSGKTTTIGKLCRYLQKKGFNPAVVCTDTWR
SRP54_METM5     KEHIVKIVYDELVKLLGETTQKLELDPSKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYR
SRP54_MYCPN     QKWLLKVIKQELINIL--SQPNQEITSKRPLKVMVVGLQGSGKTTTCGKLAVWLKKQQQKAMLVALDIYR
SRP54_METVS     KEHIIKIVYDELVKLLGENPQKLELDPSKKSVILLVGIQGSGKTTSSAKLARYIQKKGMKPALIAADIYR
SRP54_PYRAB     KEHIIKIVYEELTKFLGTEAKPIEIKEKP-TILLMVGVQGSGKTTTVAKLARHFQKRGYKVGVVCSDTWR
SRP54_PYRFU     KEHIIKIVYEELTKFLGTEAKPIEIKEKP-TILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
SRP54_METM6     KEHIVKIVYDELVKLLGETIQKLELDASKKSVILLIGIQGSGKTTSAAKLARYIQKKGLRPGLIAADVYR
SRP54_METST     KEHVMRIVYQELVNLIGEKPEELKINRKPYKIMML-GLQGSGKTTTTAKLVKHLKKKGHTSAIVCTDTWR
SRP54_SULAC     REWFISIVYDELSRLFGGDKEPEVMPKKLPYIIMLVGVQGSGKTTTSGKLALFYKKKGYKVGLVAADIYR
SRP54_SULTO     REWFISIVYDELSKLFGGDINPEVMPKKIPYVIMLVGVQGSGKTTTAGKLALFYKKKGYKVGLVAADVYR
SRP54_PYRHO     KEHIIKIVYEELTKFLGTEAKPIEIKEKP-TVLLTVGVQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
SRP54_SULIY     KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTAGKLAYFYKRRGYKVGLVAADVYR
SRP54_SULIN     KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTAGKLAYFYKRRGYKVGLVAADVYR
SRP54_SULIM     KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTSGKLAYFYKRRGYKVGLVAADVYR
SRP54_SULIL     KEWFISIVYDELSKLFGGDKEP-NVNPRLPFIIMLVGVQGSGKTTTAGKLAYFYKRRGYKVGLVAADVYR
SRP54_SULIK     KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTSGKLAYFYKRRGYKVGLVAADVYR
SRP54_SULIA     KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTSGKLAYFYKRRGYKVGLVAADVYR
SRP54_METAC     REHVIRIVYQELMEIIG-KGAEIQLKPQT---IMMVGLQGSGKTTSAAKLARYFQRKGLKAGVVAADTFR
SRP54_HYPBU     REWLVKLTYDELVKLFGGEYEPEVKPPYTPYVIMMVGVQGSGKTTTVGKLAKFYRGMGYRVGVVAADTYR
SRP54_MYCGE     QKSLLKTIKTELINIL--SQPNQELNEKRPLKIMMVGLQGSGKTTTCGKLAYWLEKKYKQKTMLVGDIYR
SRP54_STAMF     REWFVNIVYEELSKFFGGXXXXXXXXXXXXWVMLLVGLQGSGKTTTAAKLAYYYKLEGYRVGLVAADTYR
SRP54_METBF     REHVIRIVYQELMEIIG-KGAEIQLKPQ---IIMMVGLQGSGKTTSTAKLARYFQRKGLKAGVVAADTFR
SRP54_METTH     KEHIISIVYDEMVKLLGEKSHELVIDDKPYRILFL-GLQGSGKTTTIGKLARYLRKKGFTVGVVCTDTWR
SRP54_METLZ     REHVLRIVYQELVNLVG-KEAEFSLKPQK---ILMAGLQGSGKTTTTGKLCRYFQRKGLKVGAIGADNFR
SRP54_METMA     REHVIRIVYQELMEIIG-KGADIQLKPQT---IMMVGLQGSGKTTSAAKLARYFQRKGLKAGVVAADTFR
SRP54_METBU     REHVIKIVYQELISIVGRS-ADIPLKPQT---IMMIGLQXXXXXXXXXXLSRYFQRKGLKPAVICADTFR
SRP54_METS5     REWFIKIVYDELSALFGGDKEP-EVNPKSPWVIMXXXXXXXXXXXXXXXXXYFYKKRGYKVALVGADVYR
SRP54_METTP     REHVINIVYQELINLIGGTDI-----PLKKQTIMLVGLQGSGKTTTAAKLATYFQRRGLRTAVICADTFR
SRP54_PYRIL     REYVLYILYDELVKLLGGEQPAEFXXXXXXXXXXXXGVEGSGKTTTAAKLARYLVKRGYRVGLVETDTIR
SRP54_AERPE     RDWMIKIVYEELVKLFGGDQEPQVDPPKTPWIVLLVGVQGSGKTTTAGKLAYYYVRRGYKVGLVSSDTHR
SRP54_METJA     KEHIIKIVYXXXXXXXXXXXXXXXXNPKKQNVILLVGIQGSGKTTTAAKLARYIQKRGLKPALIAADTYR
SRP54_HALMA     RDWVLRIVYEELVDLVGESTEL----PLEEQTIMLAGLYGSGKTTTAAKMAWWFSTKGLRPAIIQTDTDR
SRP54_UNCMA     KEHVLRIVYTELVNIVG----KATPVALQSQTIMMVGLQGSGKTTTSAKIARYFARKGLKPAVICADTYR
SRP54_PYRAR     REYLIYVLYEELVKLMGGEQPAEFKPTKKPYIVLLLGVEGSGKTTTSAKLARYLMKRGYKVGMVETDTIR
SRP54_THEAC     QDYMVRIIYEELLKILGEPS---NVKLKPQTI-MLVGLYGNGKTTTAGKLARFFAKKGLNSGLIAADVHR
SRP54_HALWD     RDHVLRIVYEELVDLVGDST---DLPLKSQTIL-LAGLQGSGKTTSAAKMAWWFSTKGLRPAVIQTDTFR
SRP54_METKA     RDYLLRIVXXXXXXXXXXXXXDIDLS-RDVNVIMLVGLYGMGKTTTAAKLARYLQRKGYRVGLVGADPYR
SRP54_META3     KDHIIKIVYDXXXXXXXXXXXXXXXDPKNKNIILLVGIQGSGKTTSAAKLARTLQKRGFKPALIAADVYR
SRP54_THEVO     QDYMVKIIYEELLKILGEPS---NVELKPQTI-MLVGLYGHGKTTSAGKLSRFFMKKGLSAGLIAADVHR
SRP54_SULSO     KEWFISIVYDELSKLFGGDKEP-NVNPKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYR
SRP54_RAT       RKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYFYQRKGWKTCLICADTFR
SRP54_MOUSE     RKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFR
SRP54_PONAB     RKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFR
SRP54_MACFA     RKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFR
SRP54_HUMAN     RKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFR
SRP54_HALVO     RDHVLKIVYEELVDLIGESTE----IPLESQTIMLAGLQGSGKTTTSAKMAWWFSKKGLRPAVIQTDTFR
SRP54_CANFA     RKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFR
SRP54_BOVIN     RKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFR
SRP54_ACIAM     REWFIKIVYDELSNLFGGDKEPKVIPDKIPYVIMXXXXXXXXXXXXXXXXXYFYKKKGFKVGLVGADVYR
SRP54_ARCFU     KEQILKIVYXXXXXXXXXXXX----IPLKKAKIMLVGLQGSGKTTTTAKMAKYFKDRGMKVAVVAADTWR
SRP54_HALLT     KDHVLKIVYEEMVELVGDSTEL----PLENQTILLAGLQGSGKTTSAAKMAWWFSKKGLRPAVIQTDTFR
SRP54_HALSA     RDHVLRIVYEELVGLVGDSTP----IPLEEQTIMLAGLQGSGKTTTAAKMAWWFSKKGLRPAIVQTDTFR
SRP54_HALS3     RDHVLRIVYEELVGLVGDSTP----IPLEEQTIMLAGLQGSGKTTTAAKMAWWFSKKGLRPAIVQTDTFR
SRP54_NATPD     RDHVLKIVYEEMVELVGESTAL----PLEEQTIVLAGLQGSGKTTTAAKMAWWFSKKGLRPAVIQTDTFR
SRP54_PYRAE     REYLIYVLYEELVKLLGGEQPAEFKPTKKPYIVLLLGVEGSGXXXXXXXXXXXXXXRGYKVGLVETDTIR
SRP54_YEAST     NAQTKKLIQDELCKLVTGSEEKAFVPKKRKTIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFR
SRP54_CANAL     RKKLQKIIFDELCALVDSNVEKVRLSKESSHVIMFVGLQGAGKTTSCTKLAVYYKKRGFKVGLVCADTFR
SRP54_PYRCJ     RXXXXXXXXXXXXKLLGGEQPAEFKPTKKPYVVLLLGVEGSGXXXXXXXXXXXXXXRGYKVGLVETDTIR
SRP54_SCHPO     KRIVQKAVFDELCSLVDPKVDAFTPKKGRPSVIMMVGLQGSGKTTTCSKLALHYQRRGLKSCLVAADTFR
SR542_ARATH     RRIIEQAIFSELCKMLDPGKSAFAPKKAKPRVVMFVGLQGSGKTTTCTKYAYYHQKKGYKPALVCADTFR
SRP54_GEOCY     RRIIQTSVFNELCKLLDPGVPVWHPTKGHSNVIMFVGLQGSGKTTTCTKLAYHYQKKGWKTCLVCADTFR
SR543_ARATH     RRIIEQAIFSELCKMLDPGXXXXXXXXXXXSVVMFVGLQGAGKTTTCTKYAYYHQKKGYKPALVCADTFR
SRP54_THENV     RXXXXXXXXXXXXXXXGGEQPPEFKPTKKPYVVLLLGVEGSGXXXXXXXXXXXXVKRGYKVGLVETDTVR
SR542_SOLLC     RRIIQQAVFNELCKILDPGKPSFTPKKGKPSIVMFVGLQGSGKTTTCTKYAYYHQKKGWKPALVCADTFR
SR541_SOLLC     RRIIQQAVYNELCKILDPGKPAFTLKKGKPSVVMFVGLQGSGKTTTCTKYAYHHQKRGWKPALVCADTFR
SRP54_YARLI     KKVIQKALFDELVNLVGASAAKFKPQKGKSNVVMFVGLQGSGKTTSCTKLAVYYQRRGFKVGLVCADTFR
SRP54_ENTHI     RKLIKDSVFEELINLVDPKTEAFKPKKGKTCVLMMVGLQGAGKTTTITKLALYYKNRGYKPAVVGADTFR
SRP54_ASPNG     KRLIQKAVFDELVSLVDPHAEPFRPKKGRSNVIMFVGLQGAGKTTTCTKLARHYQMRGFKTALVCADTFR
SR543_HORVU     KRRIIETVGKELCKMLDTGKPAFVPKKGKPNVVMFVGLQGSGKTTTCTKYAHYHQRKGFKPSLVCADTFR
SRP54_DICDI     RKIIKQVVFDELIRLLDPGVPLWKPTKGKSNIVMFVGLQGAGKTTSVTKLAYFYKKKGFSTAIVCADTFR
SR541_ARATH     RLIIEQAIFKELCRMLDXXXXXXXXXXXXXSVVMFVGLQGAGKTTTCTKYAYYHQKKGYKAALVCADTFR
FTSY_ECOLI      AEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFR
SR541_HORVU     KRRIIQAVFTELCNMLDPGKPAFTTKKGKPSVVMFVGLQGSGKTTTCTKYAYYHQRKGFKPSLVCADTFR
SR542_HORVU     KRRIIQAVFTELCNMLDPGKPAFTPKKGKPSVVMFVGLQGSGKTTTCTKYAYYHQRKGFKPSLVCADTFR
FTSY_NEIMC      GNELRGALKEALYDLIKPLEKPLVLETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFR
FTSY_NEIMB      GNELRGALKEALYDLIKPLEKPLVLETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFR
FTSY_NEIMA      GNELRGALKEALYDLIKPLEKPLVLETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFR
FTSY_NEIGO      GNELRGALKEALYDLIKPLEKPLVLETKEPFVIMLAGINGAGKTTSIGKLAKYFQAQGKSVLLAAGDTFR
DOCK_SULAC      XXXXXNTLKKSITEILTKNQKKIRSSGKKPFVIIFFGVNGVGKTTTIAKVVNMLKKNNLSTIIAASDTFR
FTSY_HAEIN      AELLYQQLKVEMADILEPVAQPLEISTKKPYVILMVGVNGVGKTTTIGKLARKFQAEGKSVMLAAGDTFR
FTSY_HELPY      -----------------------------PLVHLIVGVNGAGKTTTIAKLAKLSLKQHKKALLGAGDTFR
FTSY_HELPJ      -----------------------------PLVHLIVGVNGAGKTTTIAKLAKLSLKQHKKALLGAGDTFR
FTSY_BACSU      -KEVQSVISEKLVEIYNSGDEQINIQDXXXXXXXXXXXXXXXKTTTIGKLAHKMKQEGKSVVLAAGDTFR
FTSY_AQUAE      -------------------QGELKIPEKVGAVLLFVGVNGSGKTTTIGKLAHXXXXXXXXXXXXAGDTFR
FTSY_RICTY      KEAIAKLIEQQLSK----SEIPFTLSENKLNIILICGVNGVGKTTTIGKLSALYSAQGKKVAVAACDTFR
FTSY_MYCHO      PKLINEIIADKLFTIYTSNSVTLNIKDNRLNVILVVGVNGSGKTTSISKIAKKLIDEGKKVLIAAGDTFR
FTSY_RICCN      KEALAKLIEQQLSK----SAIPFTLSENKLNVILVCGVNGAGKTTTIGKLASMYSAQGKKVAVAACDTFR
FTSY_BUCAP      PEKVYFLLKEHMYSILNRVEKPLKISNHTPFVILVVGINGTGKTTTVSKLAKKYKLAGKSVMLAAADTFR
FTSY_RICFE      KEALAELIEQQLSK----SEIPFTLNENKLNVILVCGVNGAGKTTTIGKLAAMYGMQGKKVAVAACDTFR
FTSY_SYNY3      PEQAIEFLKEILRSILDRPLLSLPSAEFAPNVWLLTGVNGAGKTTTIGKLAFMAKQSGYDCVIAAADTFR
Y291_METJA      -----------------------------PTVIVFVGINGTGKTTTIAKLAYKLKQKGYSVVLAAGDTFR
FTSY_THEAQ      EKLVGMLEPDERR----ATLRKLGFNPQKPKPVXXXXXXXXXKTTTIAKLGRYYQNLGKKVMFCAGDTFR
FTSY_RICPR      KEAIAKLIEQQLSK----SEIPFTLSENKLNIILVCGVNGVGKTTTIGKLSALYSAEGKKVAVAACDTFR
FTSY_RICBR      KETLANLIEQQLLE----SEIPFTLNENKLNVVLVCGVNGAGKTTTIGKLAAMYGMQGKKVAVAACDTFR
FTSY_BUCAI      SEKLYFLLKRKMFNILKKVEIPLEISSHSPFVILXXXXXXXXXXXXXAKLAEKYKLEGKSIMLAAADTFR
FTSY_MYCPN      DKLIVYYIQDKLFE------TDLTVEANKTNVYLFVGVNGVGKTTSLAKLADQLTKQNKRVLMVAGDTFR
FTSY_MYCGE      ------------------------VKPNFTNVYLFVGVNGVGKTTTLAKIADFFIKQNKRVLLVAGDTFR
FTSY_BUCBP      XXXXXXXXXSKMKKILNKVEGPLNINYKNLFVILVVGVNGVGKTTLIGXXXXXXXXXXXSVILAAGDTFR
FTSY_MYCLE      ARTMLRDVL--ISELQPDMDRSIRALPHAPAVLLIXXXXXXXXXXXXXXLARVLVADGRRVVLGXXXXXX
SRPR_DICDI      TSVVKQQMEDTITRILT-PKRNIDIKGKRPYSIVFSGVNGVGKSTNLAKVCYWLTANGYKCMLAACDTFR
SRPR_DROME      ASQVKEALTESLVRILS-PKRRIDINGRPYTIIFC-GVNGVGKSTNLAKICFWLIENDFNVLIAACDTFR
FTSY_MYCTU      ----------------------------------------------------------------------
FTSY_MYCBO      ----------------------------------------------------------------------
SRPR_SCHPO      KNTVNKAFRDRLTQILTPSTSSVRKNENRPYTISLIGVNGVGKSTTLAKIAYWLLSNNFRILVAACDTFR
SRPR_BOVIN      VTSTVKQALQESLVQILQPQRRVDMRHQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFR
SRPR_HUMAN      VTSTVKQALQESLVQILQPQRRVDMRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFR
SRPR_MOUSE      VTSTVKQALQESLVQILQPQRRVDMRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFR
SRPR_YEAST      ALTQILVSVDLLREIQSKRSKKDEEGKCDPYVFSIVGVNGVGKSTNLSKLAFWLLQNNFKVLIVACDTFR
SRPR_CANFA      VTSTVKQALQESLVQILQPQRRVDMRHQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFR
FLHF_PSEPU      -------------------------------VIAMVGPAGMGKTTTLAKLARYVLKYGAQNLLVSMDSFR
FLHF_HELPY      --------REVLRKMILCCPEDLNLRQK--RILMLVGPTGVGKTTTLAKLARMLAKKYKVGIITL-DNYR
FLHF_HELPJ      --------REVLRKIILCRPEDLNLRQK--RILMLVGPTGVGKTTTLAKLARMLAKKYKVGIITL-DNYR
FLHF_AQUAE      ----------------------------PPKVVALVGPTGVGKTTTXXXXXXXXXXXXXXVGIISLDCFR
FLHF_TREPA      VESIIESVHIQVPPICTGTRN-----------IVLVGPTGVGKTTTLAKLAAFYKRTGIQPKIITTDNFR
FLHF_CAMJE      ---------------------------KKQKIMMLVGPTGVGKTTTLAKLAFRYAYGDKRTGIITLDTYR
FLHF_BORBU      YERVREDVVLYIAKTIKCSGSIIDNLKK--RVFILVGPTGVGKTTTIAKLAAIYGINGESKSLITIDNYR
FLHF_PSEAE      ------------------------------------------KTTTLAKMARYVLKYGAQSLLVSMDSYR
CYSC_AERS4      -------------------QSRSELKGQKPLVIWFTGLSGAGKSTLAGALEQALAVEGKHTYLLDGDNVR
SYM_HAEI8       ----------------------------------------------------------------------
MNME_LACC3      TIHYGHIVDPESGELIDEVMVSVMLAPKTFTREDVVEINCHGGIVATNRILQLLLGEGAR-------MAE
Y158_METJA      ----------------------------------------------------------------------
SYM_HAEPS       ----------------------------------------------------------------------
SYM_HAEIN       ----------------------------------------------------------------------
SYM_HAEIE       ----------------------------------------------------------------------
CYSC_VIBVY      ---------------------RADLKQQKPAVLWFTGLSGAGKSTVAGALENRLAEQGFHTYLLDGDNVR
CYSC_VIBVU      ---------------------RADLKQQKPAVLWFTGLSGAGKSTVAGALENRLAEQGFHTYLLDGDNVR
CYSC_SHESM      --------------------ARAKLKGQNPVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_SHESA      --------------------ARAKLKGQNPVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_SHEON      --------------------ARARLKGQNPVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_AERPE      -------------------------------VVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGD---
CYSC_AERHH      -------------------QSRAEQKGQKPLVIWFTGLSGAGKSTLAGALEQALAASGKHTYLLDGDNVR
GPN1_BOVIN      ------------------TESQASGGPRPPACLLVLGMAGSGKTTFVQRLTGYLHSQGCPPYVI------
KTHY_JANSC      ----------------------------PPLFISLEGIDGSGKSTQTARLVDWLRVRGRDPLQTPGGSEG
CYSC_VIBPA      -------------------QFRAELKKQKPAVLWFTGLSGAGKSTVAGALENRLAELGYHTYLLDGDNVR
YCF27_PORAE     ----------------------------------------------------------------------
NODQ_AZOBR      LRRAANLHRQELAV---STVERAALKRQRPAVLWFTGLSGSGKSTIANRVERRLHTLGHHTMMLDGDNVR
LPXK_METEP      ----------------------------PPCPVLCVGLGGAGKTPTALSLVRLLRELGRTPALLSGRLAG
DNA2_YEAST      ---------------------------------LILGMPGTGKTTVIAEIIKILVSEGKRVLLTS---YT
CLPB_YEREN      VMELPQRLEERV---IGQPHALVQLSEKPLGVFMLVGPSGVGKTETALAIAE------------------
CFXQ_XANFL      VKRRIREIAAHL--VIGRAREKLGLTSGAPTLHMFTGNPGTGKTTVALKMAQILHRLGRRGHLVSGQYIG
RECA_RICCN      -------------------------------IIEIFGPESSGKTTTLHLIAEAQKKGGTCAFIDAEHALD
RECA_RICAE      -------------------------------IIEIFGPESSGKTTTLHLIAEAQKKGGTCAFIDAEHALD
NODQ_RHISB      --------------------ARSAMKSQRPAVLWFTGLSGSGKSTIANALDRLLHARGKHTYMLDGDNVR
LPXK_METC4      ---------------------------EPPYPVLCVGLGGAGKTPTALALVRLLRDLGRTPALLSGRLAG
KTHY_DINSH      ---------------------------QPGRLISFEGIDGSGKSTQARRLAEHLRDTGRDPLLTREPGGS
NODQ_RHIME      -----------------------------PAVLWFTGLSGSGKSTIANELDRILHAQGKHTYLLDGDNVR
MPA_MYCLE       ---------------------------RPPKGVLLYGPPGCGKTLIAKAVANSLAK---KMAEVRGDDAR
SYM_HAEIG       ----------------------------------------------------------------------
CYSC_SHESW      -----------------------------PVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_SHESR      ---------------------RAKLKGQNPVLLWFTGLSGAGKSTLAGALERALFDAGFHTYLLDGDNVR
CYSC_SHEPC      -----------------------------PVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_SHEB9      -----------------------------PVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_SHEB8      -----------------------------PVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_SHEB5      -----------------------------PVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_SHEB2      -----------------------------PVLLWFTGLSGAGKSTLAGALERALFEAGFHTYLLDGDNVR
CYSC_BACA2      ------------------------------SILWLTGLSGSGKSTIANAAARELFEQGYQVIVLDGDNIR
CBBX_RHOSH      ELIGLKPVKDRIRELVERARQKLGLAHETPTLHMFTGNPGTGKTTVALKMAGLLHRLG------------
YBHF_SHIFL      GETVIEA--KELTKKFGDFAATVNFAVKRGEIFGLLGPNGAGKSTTFKMMCGLLVPTSGQALVLGMDL-K
YBHF_ECOLI      GETVIEA--KELTKKFGDFAATVNFAVKRGEIFGLLGPNGAGKSTTFKMMCGLLVPTSGQALVLGMDL-K
Y1704_LACJO     WTKQAKITKKEVDNLVGHQYSKVSTTINQGDFISIVGQNGAGKTTLCRTICGFISNEGK-----------
RL1_LACBA       ----------------------------------------------------------------------
POLG_SMSV1      YTPILRNLMSALDNVISCCTRRKAIATKAPVAVILTGPPGCGKTTAAFALAKRLSQQ--KPSIISLDV--
NODQ_RHITR      --------------------ARSALKNQKPAVLWLTGLSGSGKSTIANALEALLHTCGKHTYLLDGDNVR
KAD_CAMHC       -------------------------------LFLIIGAPGSGKTTDAGCIAQMNQSVAH---YSTGDLLR
HSLU_LACS1      KRAIAVALRNRYRRIQLPKDMQEDISPKN---LLMIGPTGVGKTEIARRLAKIVNKVEATKFTEVGYVGR
FTSH7_ORYSJ     ---------EEIVEFLRNPERYIRLGARPPRGVLLVGLPGTGKTLLAKAVA-------------------


                         +         .         .         .         .         *         .:210
query           PAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANSTGRDLVIIDTAGRLHINEELMDELANIKSTV
SRP54_BACSU     PAAIKQLETLGKQLDMPVFSLGQVSPVEIAKQAIEKAKEEHYDYVILDTAGRLHIDHELMDELTNVKEIA
SRP54_STRMU     PAAIDQLKTLGQQINVPVFDMGTEHSVEIVSQGLAQAKENRNDYVLIDTAGRLQIDEKLMTELRDIKALA
SRP54_ECOLI     PAAIKQLETLAEQVGVDFFDVGQK-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASI
SRP54_ECOL6     PAAIKQLETLAEQVGVDFFDVGQK-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASI
SRP54_ECO57     PAAIKQLETLAEQVGVDFFDVGQK-PVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASI
SRP54_HAEIN     PAAIKQLETLAQSVGVDFFSDVKQNPVDIAKSALADAKLKFYDVLIVDTAGRLHVDTEMMDEIKQVHAAL
SRP54_THEAQ     PAAREQLRLLGEKVGVPVLEMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
SRP54_MYCTU     PAAVNQLQVVGERAGVPVFASGPGDPVXXXXXXXXXXXXKHFDVVIVDTAGRLGIDEELMAQAAAIRDAI
SRP54_MYCBO     PAAVNQLQVVGERAGVPVFASGPGDPVXXXXXXXXXXXXKHFDVVIVDTAGRLGIDEELMAQAAAIRDAI
SRP54_SYNY3     PAAIDQLKTLGQQIDVPVFDLGSDNPVEIARQGVEKAKELGVDTVLIDTAGRLQIDPQMMAELAEIKQVV
SRP54_SYNE7     PAAIDQLITLGKQIDVPVFELGSDNPVEIARQGVEKARQEGIDTVIVDTAGRLQIDTEMMEELAQVKEAI
SRP54_RICPR     PAAQEQLAIIANSVNIDSLPIVKEKPLDIVKRAIGEAQISAYDVVIYDTAGRIQIDNVMMEEALAIKKIL
SR54C_ARATH     PAAIDQLVILGEQVGVPVYTAGTDKPADIAKQGLKEAKKNNVDVVIMDTAGRLQIDKGMMDELKDVKKFL
SRP54_RICFE     PAAQEQLAILANSVQINSLPIVQEKPLDIVKRAIAEAKISAYGVVIYDTAGRTQIDKEMMEEALAIKKIV
SRP54_RICBR     PAAQEQLEILANSVKINSLPIVKEKPLDIVKRAMAEAKLSAYDIVIYDTAGRTQIDQEMMNEAIAIKKIV
SRP54_RICCN     PAAQEQLAILANSVQINSLPIVQEKPLDIVKRAIAEAKISAYDVVIYDTAGRTQIDKAMMEEALAIKKIV
SRP54_MYCLE     PAAVNQLQVVGERAGVPVFXXXXXXXVAVASAGLVEARAKHFDVVIVDTAGRLGIDDELMAQAGAIREAI
SRP54_BUCAP     AAAIKQLQILSDQVKIDFYSDTTQTPINITKEAIEHAKLKLYDLLLIDTAGRLHINTEMMNEINTIQNIS
SRP54_BUCAI     AAAIEQLKILSDQIEIDFFESDKHHPIEITKNAIKYAKLKLYDVLLIDTAGRLHIDKKMMNEIQQIQVIS
SRP54_RICTY     PAAQEQLAIIANSVNIDSLPIVQEQPLDIVKRAISEAKIFAYDVVIYDTAGRIQIDNVMMEEALAIKKIL
SRP54_AQUAE     PAAMLQLQRLAERVGVPYYEFEEGGAVEIARRAVKRAKEESVDYLLLDTAGRLHVDEELMKELQEIKEVT
SRP54_BUCBP     LAAIKQLKMLSKQAKISFFSNNTQSPKDIVQHAIQHAKLKFYDVLLIDTAGRLQIDKKMMNELLDVYNIS
SRP54_MYCMY     PGAIEQLVQLGQKTNTQVFEKGKQDPVKTAEQALEYAKENNFDVVILDTAGRLQVDQVLMKELDNLKKKT
SRP54_HELPJ     LAAVEQLKVLGEQVGVEVFHEENKSVKEIANNALKRAKEAQFDVLIVDSAGRLAIDKELMQELKEVKEVL
SRP54_HELPY     LAAVEQLKVLGEQVGVEVFYEENKSVKEIASNALKRAKEAQFDVLLVDSAGRLAIDKELMQELKEVKEIL
SRP54_THEON     PGAYQQLKQLVEPFGIEVFGDPEEDAIKLAKEGVEHFREKGVDIIIVDSAGRHKEEKSLIEEMKQISAAI
SRP54_THEGJ     PGAYYQLKQLVEPYNIEVFGPGEKDAIKLAREGVEYFKDKGVDVIIVDTAGRHKEESGLIEEMKQISEAI
SRP54_PYRKO     PGAYYQLRQLLDPFGIEVFGDPEEDAVKLAREGVEHFREKGVDVIIVDSAGRHKEEKGLIEEMRQISEAI
SRP54_METM7     PAAYQQLKQLSEKINVPLFETRTKTPVEITKEGMEKLKKV--DVIIIDTAGRHKEEEGLLAEMREMKDLT
SRP54_METMP     PAAYQQLKQLSEKINVPLFETRTKTPVEITKEGMEKLKKV--DVIIIDTAGRHKEEEGLLAEMKEMKDLT
SRP54_METS3     PAAYEQLRQLTEEMQVPLYGPDNKDALDLAQKGLKEFKN--RKVIIFDTAGRHKQEEDLIAEMDTLDDII
SRP54_METM5     PAAYQQLKQLSEKINVPLFETRTKTPVDITKEGMEKLKKV--DVIIIDTAGRHKEEESLLAEMKEMKDLT
SRP54_MYCPN     PAAIDQLATLAEQTESVFFAKGTQAPDQTTKEAVKTFKESGCQAIICDTAGRLQTNQELMDELVAIKNEL
SRP54_METVS     PAAYQQLKQLSEKINVPLFETKTKTPVEIVKEGIEKLKKS--DVLIIDTAGRHKEEESLLEEMKQMKEIT
SRP54_PYRAB     PGAYHQLKQLLDPYHIEVFGPNEKDAIKLAKEGVEHFKAKGVDLIIVDTAGRHKEEKDLIEEMRMISNEI
SRP54_PYRFU     PGAYHQLRQLLDRYHIEVFGNPQEDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVI
SRP54_METM6     PAAYQQLKQLSEKINVPLFETRTKTPVDITKEGMEKLKKV--DVIIIDTAGRHKEEEGLLAEMKEMKDLT
SRP54_METST     PAAYEQLRQLTEPLDVPVFGDPEKDAIDLAKKGLEKCGSK-YDVILVDTAGRHKEEKDLLDEMAELSQIV
SRP54_SULAC     PAAYEQLIQIGQQINIPVYEPGNKNPIEIATNGLEKFLKEKMNIVIIDTAGRHGYGEELLEEMKSMYDKI
SRP54_SULTO     PAAYDQLVQIGKQINVPVYEPNNTDAVGIAKRGVEKFLSEKYDIIIVDTAGRHGYGEELLEEMKNMYSEI
SRP54_PYRHO     PGAYHQLKQLLDPYHIEVFGPNEKDAVKLAKEGVEYFKTRDVDLIIVDTAGRHKEEKDLXXXXXXXXXXX
SRP54_SULIY     PAAYDQLLQLGNQIGVPVYEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEELLEEMKEIYEAL
SRP54_SULIN     PAAYDQLLQLGNQIGVPVYEPNNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEELLEEMKEIYEAL
SRP54_SULIM     PAAYDQLLQLGNQIGVPVYGENNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEELLEEMKEIYEAL
SRP54_SULIL     PAAYDQLLQLGNQIGVPVYGENNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEELLEEMKEIYEAL
SRP54_SULIK     PAAYDQLLQLGNQIGVPVYGENNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEELLEEMKEIYEAL
SRP54_SULIA     PAAYDQLLQLGNQIGVPVYGENNQNAIEIAKKGVDTFVKNKMDIIIVDTAGRHGYGEELLEEMKEIYEAL
SRP54_METAC     PGAYHQLKTLAEKLNVGFYGEGNPDAVEITKNGLKALEKY--DIRIVDTAGRHALEADLIEEMERIHAVA
SRP54_HYPBU     PGAYEQLKQLADRAGAMFYGEGSKDPVGIARRGVEELKQRGADIVIVDTAGRHGYGEELLDEMKRIAEAI
SRP54_MYCGE     PAAIEQLETLSQQTNSVFFAQGTQPVAKTTKAALSAFKTAKCQTIICDTAGRLQTNETLMDELVSVKNEL
SRP54_STAMF     PAAYDQLKQLGEQIGVPVYGEDNKDAVEIARRGVEYFVSRGFDIVIVDTAGRHHREEDLLREMREIAENI
SRP54_METBF     PGAYHQLKTLCEKLNVAFY--GEENAVEITRNGLKALEKY--DVKIVDTAGRHALEADLIEEMEQINAVA
SRP54_METTH     PAALEQLKQYTEGQDVSIYGDPQNDALDLAEKGL--ARFQKKDVIIFDTAGRHKEEKDLLREMEELSAIV
SRP54_METLZ     PGAYAQLETLCKKINVPSYGDPKEDAVKIVKDGLAALKDV--DVIIVDTAGRHALEDDLIDEITQVNAYL
SRP54_METMA     PGAYHQLKTLSEKLNVGFY--GEEGNPDAVEITIHGLKALEKDIKIVDTAGRHALEADLIEEMERIHAVA
SRP54_METBU     PGAYQQLKTLCDKLNVPFYGVGNPDAVGIVERGLAELGKN--DVLIVDTAGRHSLEADLIDEMEQIHEIA
SRP54_METS5     PAALEQLQQIGKQINVPVYGEGSQDAVGIAKRGVEKFLSERYELVIVDTAGRHGYGEELLEEMKDIYEKI
SRP54_METTP     AGAYDQLKALCDRQGIFFYGKGNENAPEVAKNGLEATKKY--DVRIVDTAGRHALESDLIQEMKDIHAVV
SRP54_PYRIL     PAAFDQLKQLAEKIGVPFYGRDSKDAVEIARRGVQ--NFKNMDVVIIDTAGRHKNEEALLQEVKMIYEAV
SRP54_AERPE     PGAYEQLKRLAEEAGAMFYGEREGDPAEIARRGLEDLLSRGAEIVIVDTAGRHGHGEELLDEMKAIASKV
SRP54_METJA     PAAYEQLKQLAEKIHVPIYGTRTKSPVDIVKEGMEKFKKA--DVLIIDTAGRHKEEKGLLEEMKQIKEIT
SRP54_HALMA     PGAYDQSKEMAERAEVDFYGPDEDDPVKIARDGLEATENA--DVRIVDTAGRDGLNXXXXXXXXXXXXXX
SRP54_UNCMA     PGAYDQLKQLCDKLGVGFYGAGNKDAVAIVRNGLKEMAKY--DVKIVDTAGRHALETDLIQEMKDIYGLT
SRP54_PYRAR     PAAFDQLRQLAEKIGAPFYGERDKDAVEIARRGV--ANLKGVDVLIIDTAGRHRNEEALLQEVKAIYDAV
SRP54_THEAC     YAAYDQLKQIASEVNAKFYGQSEKDPVRLIKHGLEQLKDVA--VKIIDTSGRDSMDAELFDEIRRIKEAV
SRP54_HALWD     PGAYDQAEQMCERAEVSFYGDPDDDPVKIAREGIEA--TADADIHIVDTAGRHALEADLIDEIEAIDSTV
SRP54_METKA     PAAGEQLRQLXXXXXXXXXXXXXXXXXXXXXKGVE-ALKDECDVVIVDTAGRDRLSEDLIDELREMAERI
SRP54_META3     PAAYQQLKQLSEKIHIPLHGTKTKTPMEITEEGLKQFKK--NDVIIIDTAGRHXXXXXXXXXXXXXXXXX
SRP54_THEVO     YAAYEQLQQIAESVNAKFYGDPKEDPVKIIKNGLEVLKDA--QVKIIDTSGRDSLDSDLIEEIRRIKEAV
SRP54_SULSO     PAAYDQLLQLGNQIGVQVYEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRYGXXXXXXXXXXXXYDVL
SRP54_RAT       AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAI
SRP54_MOUSE     AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVSNAI
SRP54_PONAB     AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAI
SRP54_MACFA     AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAI
SRP54_HUMAN     AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAI
SRP54_HALVO     PGAYDQAKQMCERAEVDFYGDPDDDPVQIAREGLEATEDA--DVHIVDTAGRHAXXXXXXXXXXXXXGVV
SRP54_CANFA     AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAI
SRP54_BOVIN     AGAFDQLKQNATKARIPFYSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAI
SRP54_ACIAM     PAAXXXXXXXXXXIGVPVYGEGEKDAVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEELLEEMKNIYEAI
SRP54_ARCFU     PAAYEQLRQLAEEYGITFYGKGEKDAVKIVKNALEKLKD--HDMIIIDTAGRHALEDELIDEMIKIAEVA
SRP54_HALLT     PGAYDQAKQMCERAEVDFYGPDNDDPVAIAREGLEA--TADADVHIVDTAGRHXXXXXXXXXXXXXXRAV
SRP54_HALSA     PGAYEQAAEMADRAEVDFYGEDSDDPVQIARDGL--AATADADVHIVDTAGRHXXXXXXXXXXXXXXXXX
SRP54_HALS3     PGAYEQAAEMADRAEVDFYGEDSDDPVQIARDGL--AATADADVHIVDTAGRHXXXXXXXXXXXXXXXXX
SRP54_NATPD     PGAYDQAKEMCERAEVDFYNPDSDDPVEIAERGLEE--TADADVHIVDTAGRHXXXXXXXXXXXXXXSAV
SRP54_PYRAE     PAAFDQLRQLAEKIGVPFYGERDKDAVEIAKRGVQ--NFKNMDVIIVDTAGRHRNEEALLKEVRAIYDAV
SRP54_YEAST     AGAFDQLKQNAIRARIPFYSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNVI
SRP54_CANAL     AGAFDQLKQNAIKANIPYYSYLEPDPVKIAFEGVQKFKQEKFDIIIVDTSGRHRQEEQLFTEMVQIGEAV
SRP54_PYRCJ     PAAFDQLKQLAEKIGVPFYGERDKNAVEIAVRGVQ--NFKNMDVVIIDTAGRHRNEEELLKEVKAIYDAV
SRP54_SCHPO     AGAFDQLKQNAIKARVPYFSYTETDPVVIAKEGVDKFKNDRFDVIIVDTSGRHQQEQELFAEMVEISDAI
SR542_ARATH     AGAFDQLKQNATKSKIPYYSYTGSDPVKIAVEGVDRFKKENCDLIIVDTSGRHKQQASLFEEMRQISEAT
SRP54_GEOCY     AGAFDQLKQNATKARVPFYSYTEMDPVVIAQEGVEKFKEDSFEVIIVDTSGRHKQEESLFEEMLQVSQAI
SR543_ARATH     AGAFDQLKQNATKAKIPFYSYTESDPVKIAVEGVDTFKKENCDLIIVDTSGRHKQEASLFEEMRQVAEAT
SRP54_THENV     PAAFDQLRQLAEKIGVPFYGERDKDAVEIARRGVQ--NLKNLDVVIVDTAGRHRNEEALLQEVKAIYEAV
SR542_SOLLC     AGAFDQLKQNATKAKIPFYSYTESDPVKIAVDGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVAEAT
SR541_SOLLC     AGAFDQLKQNATKAKIPFYSYTESDPVKIAVDGVETFKKENCDLIIVDTSGRHKQEAALFEEMRQVSEAQ
SRP54_YARLI     AGAFDQLKQNATKAKIPFFSYTETDPVAVAAEGVAXXXXXXXXXXXVDTSGRHRQESELFTEMVDIGAAV
SRP54_ENTHI     AGAYEQLQMNAKRAGVPFFGIKEESPVKVASEGVRTFRKEKNDIILVDTSGRHKQDKELFKEMQSVRDAI
SRP54_ASPNG     AGAFDQLKQNATKAKIPYYSLTQTDPAIVAAEGVAKFKKERFEIIIVDTSGRHKQEEELFTEMTQIQTAV
SR543_HORVU     AGAFDQLKQNATKAKIPFYSYMESDPVKIAVEGLEKFRQEKSDLIIIDTSGRHMQEAALFEEMRQVAEAT
SRP54_DICDI     AGAFDQVRHNAAKAKIHYYSETEKDPVVVARTGVDIFKKDGTEIIIVDTSGRHKQDSELFEEMKQIETAV
SR541_ARATH     AGAFDQLKQNATKAKIPFYSYTESDPVKIAVEGVDRFKKEKCDLIIVDTSGRHKQAASLFEEMRQVAEAT
FTSY_ECOLI      AAAVEQLQVWGQRNNIPVIAQHTADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVM
SR541_HORVU     AGAFDQLKQNATKAKIPFYSYMESDPVKIAVEGLERFRKENSDLIIIDTSGRHKQEAALFEEMRQVAEAT
SR542_HORVU     AGAFDQLKQNATKAKIPFYSYMESDPVKIAVEGLERFRKENSDLIIIDTSGRHKQEAALFEEMRQVAEAT
FTSY_NEIMC      AAAREQLQAWGERNNVTVISQTTGDSAAVCFDAVQAAKARGIDIVLADTAGRLPTQLHLMEEIKKVKRVL
FTSY_NEIMB      AAAREQLQAWGERNNVTVISQTTGDSAAVCFDAVQAAKARGIDIVLADTAGRLPTQLHLMEEIKKVKRVL
FTSY_NEIMA      AAAREQLQAWGERNNVTVISQTTGDSAAVCFDAVQAAKARGIDIVLADTAGRLPTQLHLMEEIKKVKRVL
FTSY_NEIGO      AAAREQLQAWGGRNNVTVISQTTGDSAAVCFDAVQAAKAR-IDIVLADTAGRLPTQLHLMEEIKKVKRVL
DOCK_SULAC      AAAQEQLAYHASKLEVQLIGKYGADPASVAFDAISFAKSRNIDVVLIDTAGRMHIDSDLVEELKRVLRIA
FTSY_HAEIN      AAAVEQLQVWGERNHIPVVAQSTSDSASVIFDAMQSAAARNIDILIADTAGRLQNKNNLMDELKKIVRVM
FTSY_HELPY      AAAVKQLQLWGEKLNIQVISAKESDPSSLAYNTIESAIAKNIDEVFIDTAGRLHNQTNLKNELSKIARTC
FTSY_HELPJ      AAAVKQLQLWGEKLNVQVISAKESDPSSLAYNTIESAIAKNIDEVFIDTAGRLHNQTNLKNELSKIAHTC
FTSY_BACSU      AGAIEQLEVWGERTGVPVIKQAGSDPAAVIYDAVHAAKARNADVLICDTAGRLQNKVNLMKELEKVKRVI
FTSY_AQUAE      AAAIEQLEVWAKRAGVDIVKKEESDPGAVVYEGMKKAKEEGYEVVLVDTAGRLHTKEPLINELRKIKKVI
FTSY_RICTY      AAAINQLSSWVDRANLLITGEVSADPASVAYRAIQESIKQNIDILFIDTAGRLHNNKNLMDELSKIVKVI
FTSY_MYCHO      AAAVEQLEIWAKRVGADIVTPNENDPAAVVYRAIDIAKSKKYDILIVDTAGRLQNKVNLMNELAKINRVL
FTSY_RICCN      AAAVNQLSTWADRANALLIT-GEESPASVAYRGMEESIKQNIDILFIDTAGRLHNKKNLMDELSKIVKVI
FTSY_BUCAP      AAGIEQLQILGKRNNIPVISQSSSDPASVAFDAVKSAISKKIDVLIIDTAGRXXXXXXXXXXXXXMVRVI
FTSY_RICFE      AAAVNQLSTWVDRANALLIT-GEESPASVAYRAMEESIKQNIDILFIDTAGRLHNKKNLMDELSKIVKVI
FTSY_SYNY3      AAAVEQVKVWGERSGVPVIANPGQNPAAVVYDGISAAQSRNVNLLLVDTAGRLQNKKNLMDELAKIRRII
Y291_METJA      AGAIEQLEQHAKNVGVKVIKHKPADSAAVIYDAIQHAKARGIDVVLADTAGRQATNVNLMEEIKKVVRVT
FTSY_THEAQ      AAGGTQLSEWGKRLSIPVIQ-GPEDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
FTSY_RICPR      AAAINQLSSWVHRANLLITGKASADPASVAYRAIEESIKQNIDILFIDTAGRLHNNKNLMDELSKIVKVI
FTSY_RICBR      AAAVNQLDSWVTRAKALLIT-GEEDPASVAYRAVEESIKQDIDILFIDTAGRLHNKKNLMDELTKIVKVI
FTSY_BUCAI      AAGIEQLQTLGKLNNIPVIAQRSSDPAAVIFDAVKSAKSKKIDVLIIDTAGRLHNKLHLIEELXXXXXXX
FTSY_MYCPN      AGAVAQLQRIGCDIVLP--NPKEETPAVIFRG-VQQGIQNEYDFVLCDTSGRLQNKTNLMNELKKIYSSA
FTSY_MYCGE      AGAIEQLNQWAKLLNCDVLPNPKEQTPAVIFRGVKKGIDDKYDFVLCDTSGRLQNKLNLMNELQKIYQII
FTSY_BUCBP      AAAIDQLKLWGEINSVSVITREGSDPASVVYDAIKIAKLKCIDILIIDTAGRLHNKNNLMEELKKIKRVI
FTSY_MYCLE      XXXXDQLQTWASRVGAEVRGVEGADPASVAFDAVDKGIGAGADVVVIDTAGRLHTKVGLMDELDKIKRVV
SRPR_DICDI      SGAIEQLKTHADRLNVHLFERGSKDAASVAQDAIAFAKDTGYDVVLIDTTGRMQNNEPLMKALSKLVNQN
SRPR_DROME      AGAVEQLRTHTRHLNVQLYEKGYKDAAGIAMEAIKFAHDTRVDVVLVDTAGRMQDNEPLMRSLSKLIKVN
FTSY_MYCTU      ------------------------DPASVAFDAVDKGIAAGADVVLIDTAGRLHTKVGLMDELDKVKRVV
FTSY_MYCBO      ------------------------DPASVAFDAVDKGIAAGADVVLIDTAGRLHTKVGLMDELDKVKRVV
SRPR_SCHPO      SGAIEQLGVHVKNLSIELFAQGYKDSSFVVKNAVEYAKQNSFDVILIDTAGRRHNDQRLMGSLEKFTKAT
SRPR_BOVIN      AGAVEQLRTHTRRLSAPPEKHGGRTMVQLFEKGYGKXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVN
SRPR_HUMAN      AGAVEQLRTHTRRLSAPPEKHGGRTMVQLFEKGYGKXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVN
SRPR_MOUSE      AGAVEQLRTHTRRLTAPPEKHGGRTMVQLFEKGYGKXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVN
SRPR_YEAST      SGAVEQLRVHVENLYVELFEAGSDLVTKIAKQAIKYSRDQNFDIVLMDTAGRRHNDPTLMSPLKSFADQA
SRPR_CANFA      AGAVEHVRTHTRRLSVQLFEKGYKDXXXXXXXXXXXXRNQGFDVVLVDTAGRMQDNAPLMTALAKLITVN
FLHF_PSEPU      IGAQEQLKTLGRILNVPVTYV---DPGQSLAAALEPL--LRKRVVLIDTAGLQASDPALRMQLETLAGRG
FLHF_HELPY      IGALEQLSWYANKMKMSIEAVIDAKDFAKEIEALEYC-----DFILVDTTGHSQYDKEKIAGLKEFIDGG
FLHF_HELPJ      IGALEQLSWYANKMKMSIEAVIDAKDFAKEIEALEYC-----DFILVDTTGHSQYDKEKIAGLKEFIDGG
FLHF_AQUAE      VGAFEQLKAFAEVLEV---------PFKLADSPIQLLEMDDRDVILVDTAGRSHYDVIRLKELETY-FKV
FLHF_TREPA      IGAAFQMERYCELMGLDLCVV--QAPVEFLTYMTLYQQET--DVVFVDTEGRSPVDGQNIERMVEYFRAV
FLHF_CAMJE      IGAVEQLFQYAKMMKLPIIDSIEP---KDLDEAIKSLNNC--EVILVDTIGNSQYDQ---SKLAKTKEFL
FLHF_BORBU      IGAKKQIQTYGDIMGIPVRAIESFKDLK-----DEITDSKDFDLILVDTIGKSPKDFMKLAEMKELLNAC
FLHF_PSEAE      IGAQEQIKTLGRILNVPV------TLVDPGQSLIQALAPLARKMVLIDTAGLPASDPALRMQLEALASPS
CYSC_AERS4      ----------------------------------------------------------------------
SYM_HAEI8       ----------------------------------------------------------------------
MNME_LACC3      PGEFTKRAFLNGRIDLSVMDLIRAKTDRAMQVAVNQLDGNLHTLIILEVLAQVEVNQTVQKAISNLLSTA
Y158_METJA      ----------------------------------EILNKIDKDTLVIITGSTMDLKVIELENFKKVINTA
SYM_HAEPS       ----------------------------------------------------------------------
SYM_HAEIN       ----------------------------------------------------------------------
SYM_HAEIE       ----------------------------------------------------------------------
CYSC_VIBVY      ----------------------------------------------------------------------
CYSC_VIBVU      ----------------------------------------------------------------------
CYSC_SHESM      HGLCKDL---------------------------------------------------------------
CYSC_SHESA      HGLCKDL---------------------------------------------------------------
CYSC_SHEON      HGLCKDL---------------------------------------------------------------
CYSC_AERPE      ----------------------------------------------------------------------
CYSC_AERHH      ----------------------------------------------------------------------
GPN1_BOVIN      ----------------------------------------------------------------------
KTHY_JANSC      AEEIRRLLVEGDETEILLFTAARRDHL---ERTIRPALASGRDVV-------------------------
CYSC_VIBPA      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------VIDDEASIRRIL
NODQ_AZOBR      ----------------------------------------------------------------------
LPXK_METEP      PLVVDPARHAAAEVGDEPLLLAQAAPTIVARDRPAGARASGADVIVMD----------------------
DNA2_YEAST      HSAVDNILIKLRNTNISIMRLGMKHKV-------------------------------------------
CLPB_YEREN      ----------------------------------------------------------------------
CFXQ_XANFL      HTAPKTKEILKKAMGGVLFLYRPENERDYGQEAIEQVMENQRDDLVVILAGYKDRMDRFFESNPGFRSRI
RECA_RICCN      PAYAKKLGVNIDELIISQPDTG-EQALEIADTLIR---SSGIDMIIIDSVAALVPKSEIEGEMGD-----
RECA_RICAE      PAYAKKLGVNIDELIISQPDTG-EQALEIADTLIR---SSGIDMIIIDSVAALVPKSEIEGEMGD-----
NODQ_RHISB      ----------------------------------------------------------------------
LPXK_METC4      PLVVDPARHAAAEVGDEPLLLAQAAPTIVARSGARLCAASGADVIVMD----------------------
KTHY_DINSH      PGAIRRLLVEGDETELLLFTAARRDHL---ERLIQPALAEGRDVI-------------------------
NODQ_RHIME      ----------------------------------------------------------------------
MPA_MYCLE       EAKSYFLNIKGPELLNKFVGETERHIRLIFQRAREKASEGTPVIVFFDEMDSI-FRTRGTGVSSDVETTV
SYM_HAEIG       ----------------------------------------------------------------------
CYSC_SHESW      HGLCKDL---------------------------------------------------------------
CYSC_SHESR      HGLCKDL---------------------------------------------------------------
CYSC_SHEPC      HGLCKDL---------------------------------------------------------------
CYSC_SHEB9      HGLCKDL---------------------------------------------------------------
CYSC_SHEB8      HGLCKDL---------------------------------------------------------------
CYSC_SHEB5      HGLCKDL---------------------------------------------------------------
CYSC_SHEB2      HGLCKDL---------------------------------------------------------------
CYSC_BACA2      HGLNKDLGFSDDDRKENIRRIGEVAKLFVQQGTI------------------------------------
CBBX_RHOSH      ----------------------------------------------------------------------
YBHF_SHIFL      ESSGKARQHLG-----------------------------------------------------------
YBHF_ECOLI      ESSGKARQHLG-----------------------------------------------------------
Y1704_LACJO     ----------------------------------------------------------------------
RL1_LACBA       ----------------------------------------------------------------------
POLG_SMSV1      ----------------------------------------------------------------------
NODQ_RHITR      ----------------------------------------------------------------------
KAD_CAMHC       AEVAKDSE-LGKKID-KIISGGNLVPLEIVINTITSAHACEKDFIIIDGYPR---SVEQMTELDKVLANE
HSLU_LACS1      -----DVESMARDLVEVAYRMEQNDAFKVRAQAAQQANKRLVKLIVPAKKKQENPNQYLFNALRDLQSGS
FTSH7_ORYSJ     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RPHEILLVVDAMTGQEAVNVADTFNQKLGLDGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDAL
SRP54_BACSU     NPEEIFLVVDSMTGQDAVNVAKSFNEQLGLTGVVLTKLDGDTRGGAALSIRAVTNTPIKFAGLGEKLDAL
SRP54_STRMU     NPNEILLVVDSMIGQEAANVAREFNQQLEVTGVILTKIDGDTRGGAALSVRQITGKPIKFTGTGEKITDI
SRP54_ECOLI     NPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEAL
SRP54_ECOL6     NPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEAL
SRP54_ECO57     NPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEAL
SRP54_HAEIN     NPIETLFTVDAMTGQDAANTAKAFNEALPLTGVILTKVDGDARGGAALSIRQITGKPIKFLGVGEKTEAL
SRP54_THEAQ     GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
SRP54_MYCTU     NPDEVLFVLDAMIGQDAVTTAAAFGEGVGFTGVALTKLDGDARGGAALSVREVTGVPILFASTGEKLEDF
SRP54_MYCBO     NPDEVLFVLDAMIGQDAVTTAAAFGEGVGFTGVALTKLDGDARGGAALSVREVTGVPILFASTGEKLEDF
SRP54_SYNY3     KPDDTLLVVDAMTGQEAANLTHTFHEQIGITGAILTKLDGDTRGGAALSVRQISGQPIKFVGVGEKVEAL
SRP54_SYNE7     APHEVLLVVDSMIGQEAASLTRSFHERIGITGAILTKLDGDSRGGAALSIRRVSGQPIKFVGLGEKVEAL
SRP54_RICPR     NPTETLLVIDSMTGQDAVITAKTFSEKLEISGLILSRIDGDTKGGAALSVKYFTQKPIKFLSSGEKLTDL
SR54C_ARATH     NPTEVLLVVDAMTGQEAAALVTTFNVEIGITGAILTKLDGDSRGGAALSVKEVSGKPIKLVGRGERMEDL
SRP54_RICFE     EPTETLLVIDSMTGQDAVVTANSFNEKLEISGLILSRIDGDSKGGAALSVKYITKKPIKFLSSGEKLTDL
SRP54_RICBR     EPTETLLVIDSMTGQDAVVTASSFNEQLEISGLILSRIDGDSKGGAALSVKYITQRPIKFLSSGEKLTDL
SRP54_RICCN     EPTETLLVIDSMTGQDAVVTASSFNEKLAISGLILSRIDGDSKGGAALSVKYITKKPIKFLSSGENLIDL
SRP54_MYCLE     NPDEVLFVLDAMIGQDXXXXXXXXXXXXXXXXXXLTKLDGDARGGAALSVREVTGVPILFATTGEKLDDF
SRP54_BUCAP     KPIETLLIVDSMMGQDAINIAKKFSASLSISGIVITKTDSDARSGVALSIRHITGKPIKFIGTGEKLHQL
SRP54_BUCAI     KAIETLLIVDSMMGQDAINMAKIFNNDLLISGIILTKTDGDSRSGIALSMRYITGKPIKFIGTGEKIISL
SRP54_RICTY     NPTETLLVIDSMTGQDAVVTARSFSDKLEISGLILSRIDGDTKGGAALSVKYLTQKPIKFLSCGEKLTDL
SRP54_AQUAE     NPSEILYVADAMQGQTALETAKTFHERLGLTGVVITKMDGDARGGLALSVKEVLGVPIKFIGVGEKIEDI
SRP54_BUCBP     HPIETFFVADAMFGQDSINVINEFNKYLPVSSFIITKTDSDTRAGIILSIKYLTKKPIKFIGTGEKLEEL
SRP54_MYCMY     SPNEILLVVDGMSGQEIINVTNEFNDKLKLSGVVVTKLDGDARGGATLSISYLTKLPIKFIGEGEGYNAL
SRP54_HELPJ     NPHEVLYVADALSGQDGVKSANTFNEEIGVSGVVLSKFDSDSKGGIALGITYQLGLPLRFIGSGEKIPDL
SRP54_HELPY     NPHEVLYVADALSGQDGVKSANTFNEEIGVSGVVLSKFDSDSKGGIALGITYQLGLPLRFIGSGEKIPDL
SRP54_THEON     KPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGVGERIDDL
SRP54_THEGJ     KPHEVILVIDGTIGQQAYHQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGVGEKIDDL
SRP54_PYRKO     KPHEVILVIDGTIGQQAYNQAMAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGERIDDL
SRP54_METM7     NPTEIILVIDGTLGQQAKNQAKAFKESVSIGSILVTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNL
SRP54_METMP     NPNEIILVIDGTLGQQAKNQAKAFKESVSIGSILVTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNL
SRP54_METS3     QPTESILVIDGTIGQQAGEQAKAFSQATDVGSIIITKLDGSAKGGGAMSAVAETGAPIKFIGTGERIDDF
SRP54_METM5     NPNEIILVIDGTLGQQAKNQAKAFKESVSIGSILVTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNL
SRP54_MYCPN     HPDEILMVVDGLSGQEIINVAKEFHNRLKLTGFIITKLDSDARAGAALSLTSLLEVPIKLMGTSEKLTGL
SRP54_METVS     NPNEIILVIDGTLGQQAKNQAKAFKDAVSIGSILVTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNL
SRP54_PYRAB     KPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDSSAKGGGALSAVAATGAPIKFIGTGEKIDDL
SRP54_PYRFU     HPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDI
SRP54_METM6     NPNEIILVIDGTLGQQAKNQAKAFKDSVSIGSILVTKLDGSAKGGGALSAVAEINAPIKFIGTGEGVDNL
SRP54_METST     QPDEVILVIDGTIGQQARSQAETFKKTTDIGSIIVSKLDGSAKGGGALSAVAEIRAPIKFIGTGERVDDF
SRP54_SULAC     HPDEVILVIDASIGQKAYDLASRFHQASPIGSLIVSKMDGTAKGGGALSAVIATGAQIKFIGTGEKLDEL
SRP54_SULTO     KPDEVILVIDASIGQKAYDLASRFHQASPIGSIIVTKMDGTAKXXXXXXXXXXXXXXIKFIGTGEKLDEL
SRP54_PYRHO     XPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDSSAKGGGALSAVAATGAPIKFIGVGEKIDDL
SRP54_SULIY     KPDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
SRP54_SULIN     KPDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
SRP54_SULIM     KPDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
SRP54_SULIL     KPDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
SRP54_SULIK     KPDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
SRP54_SULIA     KPDDVILVIDASIGQKAYDLASRFHQASPIGSIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
SRP54_METAC     KPDHKFMVLDAGIGQQASQQAHAFNDSVGITGVIITKLDGTAKGGGALSAVSETKAPIAFIGVGETPEDF
SRP54_HYPBU     KPDEVVLVIDAAMGQKSYDLAKRFHEATPVGSIIVTKMDGTAKGGGALSAVAATGARIKFIGTGEDIDEI
SRP54_MYCGE     NPDEIIMVVDGLSGQEIINVAQTFHKRLKLTGFIISKXXXXXXXXXXXXXXXXXQVPIKLIGVSEKLDGL
SRP54_STAMF     KPDEVVLVIDAAIGQQAHDLAKKFHEATPIGSIIVTKLDGTAKGGGALSAVAVTGATIKFIGTGEKIDEL
SRP54_METBF     KPDHKFMVLDAGIGQQASQQAHAFNDSVGITGVIITKLDGTAKGGGALSAVSETKAPIAFIGVGETPEDF
SRP54_METTH     EPHEAILVIDGTIGQQAREQALAFRKATDIGSIIVTKLDGSAKGGGALSAVAEIGAPIKFIGTGERIDDL
SRP54_METLZ     NPDHRWLVIDAALGQAARDQAKRFHEAIGIDGVIVTKMDGTAKGGGAMSAVAETQSGIVFIGNGETIDDL
SRP54_METMA     KPDHKFMVLDAGIGQQASQQAHAFNDSVGITGVIITKLDGTAKGGGALSAVSETKAPIAFIGVGETPEDF
SRP54_METBU     QPDYKLLVLDGAIGQQASEQARAFNDSVGISGVVISKLDGTAKGGGALSAVSETNSAIAFIGVGETPDDL
SRP54_METS5     KPNEVILVIDASLGQKAYDLAKRFHEASNVGSIIITKMDGTAKGGGALSAVAATGAPIKFIGVGEKIDEL
SRP54_METTP     NADHKLLVMDAAIGQQASEQARAFNEAVGITGVIITKLDGTAKGGGALSAVAETKTSVAFIGVGETASDL
SRP54_PYRIL     NPDEVILVIDATVGKLAAAQAEAFMKYLPIHSVIITKMDSTARGGGALAAVIKTGARVKFIGVGEDVDEF
SRP54_AERPE     RPDEVALVIDASIGQKAMGLAERFHKSTPIGSIIVTKMDXXXXXXXXXXXXXXXXXRIKFIGTGETLGEL
SRP54_METJA     NPDEIILVIDGTIGQQAGIQAKAFKEAVGIGSIIVTKLDGSAKGGGALSAVAETKAPIKFIGIGEGIDDL
SRP54_HALMA     XPDRDLLVLDAAMGQSAKSQAADFEAAIGIDGVVITKLDGTAKGGGALAAVNETDSTIAFLGSGETVKDI
SRP54_UNCMA     KFDHKLLVLDAAIGQQASEQARAFNDAIGITGVVITKLDGTAKGGGALSAVSDTNTSIAFIGVGETPDDM
SRP54_PYRAR     NPDEVVLVVDATVGKLAAAQAEAFMKYLPIHTVIITKMDSTARGGGALAAVAKTGARVKFIGVGEDVEEL
SRP54_THEAC     APDEVLMIIDATMGQQAGPEAKAFNDAIGVTGIIITKMDGTAKGGGALSAVAEIHVPIYFIGTGEHMDDL
SRP54_HALWD     APDRSLLVLDAAIGQGAKQQAREFNNAIGIDGVVVTKLDGTAKGGGALTAVNETDSSIAFLGTGETVQDV
SRP54_METKA     EPHEVLLVLDATVGQKAGDHAEAFHEAVQLTGVVITKLDTAAKGGGALSAVARTGAPIKFVGTGERVDDL
SRP54_META3     XXXXIILVIDGTLGQQAKNQAKAFKDAVNIGSILITKMDGSAKGGGALSAVAEIGAPIKFIGTGEKVDDL
SRP54_THEVO     KPDQVLMVIDATMGQQAGPESKAINDAVGVTGIIITKMDGTAKGGGALSAVAKMRVPIYFIGTGEHMDDM
SRP54_SULSO     KPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDEL
SRP54_RAT       QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
SRP54_MOUSE     QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
SRP54_PONAB     QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
SRP54_MACFA     QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
SRP54_HUMAN     QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
SRP54_HALVO     QPDLNLLVLDAAIGQGAKEQAQQFDESIGIGGVVITKLDGTAKGGGALTAVNETDSSIAFLGMGETVQDI
SRP54_CANFA     QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
SRP54_BOVIN     QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDF
SRP54_ACIAM     KPDEVTLVIDASIGQKAYDLASKFNQASKIGTIIITKMDGTAKGGGALSAVAATGATIKFIGTGEKIDEL
SRP54_ARCFU     RPDYKLLVLDAAIGQLASKQAQAFHEAIGINGIIITKFDGTAKGGGALSAARQIGIPIAFIGTGEKVEDF
SRP54_HALLT     DPDRSLLVLDAAIGQGAKEQARQFEKSIGIEGVMITKLDGTAKGGGALTAVNETDSSIAFLGTGETVQDI
SRP54_HALSA     XPDRSLLVLDAAIGQGAKQQARQFDASIGIDGVAITKLDGTAKGGGSLTAVNETDSTIAFLGSGETVQDI
SRP54_HALS3     XPDRSLLVLDAAIGQGAKQQARQFDASIGIDGVAITKLDGTAKGGGSLTAVNETDSTIAFLGSGETVQDI
SRP54_NATPD     DPDRNLLVLDAAIGQGAKDQAERFHDAVGIDGVAITKLDGTAKGGGALAAVDQTDSSIAFLGTGEEVKDI
SRP54_PYRAE     SPDEVVLVIDATVGKMAAAQAEAFMKYLPIHSVIITKMDSTARGGGALAAVAKTGAKVKFIGVGEDVDEF
SRP54_YEAST     KPNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHARGGGAISAVAATNTPIIFIGTGEHIHDL
SRP54_CANAL     QPTQTIMVMDGSIGQAAESQARAFKESSNFGSIILTKMDGHAKGGGAISAVAATKTPIVFIGTGEHVGDL
SRP54_PYRCJ     KPDEVFLVIDATVGKLAAAQAEAFMKYLPIHSVIITKMDSTARGGGALAAVAKTGARVKFIGVGEDVDEF
SRP54_SCHPO     RPDQTIMILDASIGQAAESQSKAFKETADFGAVIITKLDGHAKGGGALSAVAATKTPIVFIGTGEHINDL
SR542_ARATH     KPDLVIFVMDSSIGQTAFEQARAFKQTVAVGAVIITKMDGHAKGGGTLSAVAATKSPVIFIGTGEHMDEF
SRP54_GEOCY     DPDNIIFVMDGTIGQACESQARAFKEKVDVASVIVTKLDGHAKGGGALSAVAATRSPIIFIGTGEHIDEM
SR543_ARATH     KPDLVIFVMDSSIGXXXXXXXXXXXXSVAVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEF
SRP54_THENV     SPDEVVLVIDATVGKLAAAQAEAFMRYLPIHSVIITKMDSTARGGGALAAVAKTGAKVKFIGVGEDVDEL
SR542_SOLLC     KPDLVIFVMDSSIGXXXXXXXXXXXXSVAVGAVIVTKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEF
SR541_SOLLC     KPDLVIFVMDSSIGXXXXXXXXXXXXSVAVGAVIVTKMDGHAKGGGALSRVAATKSPVIFIGTGEHMDEF
SRP54_YARLI     KPDSTIMVLDASIGQAAEPQSRAFKDASDFGSIILTKMDGHAKGGGAISAVAATNTPIIFIGTGEHIHDL
SRP54_ENTHI     KPDSIIFVMDGAIGQAAFGQAKAFKDAVEVGSVIITKLDGHSNGGGALSAVAATKSPIIFIGTGEKVNEI
SRP54_ASPNG     TPDQTILVLDSTIGQAAEAQSSAFKATADFGAIIITKTDXXXXXXXXXXXXXXTHTPIIYLGTGEHLMDL
SR543_HORVU     KPDLVIFVMDGSIGXXXXXXXXXXXXXXXVGAVIVTKLDGHAKGGGALSAVAATKSPVIFIGTGEHIDDF
SRP54_DICDI     KPDNCIFVMDSSIGQAAYEQATAFRSSVKVGSIIITKMDGNSMGGGAISAVAATNTPIIFIGTGEHLTDL
SR541_ARATH     EPDLVIFVMDSSIGXXXXXXXXXXKETVSVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEF
FTSY_ECOLI      KPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDL
SR541_HORVU     KPDLVIFVMDGSIGXXXXXXXXXXXXXXXVGAVIITKLDGHAKGGGALSAVAATKSPVIFIGTGEHIDEF
SR542_HORVU     KPDLVIFVMDGSIGXXXXXXXXXXXXXXXVGAVIITKLDGHAKGGGALSAVAATKSPVIFIGTGEHIDEF
FTSY_NEIMC      QPHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGILAALASDRPVPVRYIGVGEGIDDL
FTSY_NEIMB      QPHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGILAALASDRPVPVRYIGVGEGIDDL
FTSY_NEIMA      QPHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGILAALASDRPVPVRYIGVGEGIDDL
FTSY_NEIGO      QPHEIIVVLDANIGQNAVNQVKAFDDALGLTGLIVTKLDGTAKGGILAALASDRPVPVRYIGVGEGIDDL
DOCK_SULAC      KPDFRILILDSLAGSDALEQARHFENNVGYDAVILTKVDADAKGGIALSLAYELKKPVVYMGVGQNYDDL
FTSY_HAEIN      KPHEIMLTLDAGTGQNAISQAKLFNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDL
FTSY_HELPY      APFYKFLILDGTQGSSGLTQAKIFHETLALDGVIMTKLDGTSKGGAILSVLYELKLPILYLGMGEKEDDL
FTSY_HELPJ      APFYKFLILDGTQGSSGLTQAKIFHETLALDGVIMTKLDGTSKGGAILSVLYELKLPILYLGMGEKEDDL
FTSY_BACSU      EPHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELHIPVKLVGLGEKVDDL
FTSY_AQUAE      QPSETLLVIDATTGQNAIQQAKVFKEAVDITGIVVTKLDGSAKGGAVVAICRELKIPIKLVGVGEGIDDL
FTSY_RICTY      KPTHSILIIDAVTGQNTYNQIEYFNDVTNLTGLIITKLDGSAKAGVLVGAVQKFNLPIYFIGIGEQIEDL
FTSY_MYCHO      APHESLLVLDATTGQNGVIQARVFKESTPLTGIILTKMDGTSKGGIVLTIKDEIGLFVKYIGLGEKVDDL
FTSY_RICCN      KPTHSVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVIVGVVQKFNLPLYFIGIGEKIEDL
FTSY_BUCAP      KPHEIMLIIDACNGQNTIKQTEMFHKAINLTGLVITKLDGTAKGGVIFSLANQFLIPIRYIGIGEKTTDL
FTSY_RICFE      KPTHSVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVLVGVVQKFNLPVYFIGIGEKIEDL
FTSY_SYNY3      DKKESLLVLDATLGQNGLRQAEVFAEAAKLSGVVLTKLDGSAKGGVALAVAQQLNLPIRFIGAGEGIEDL
Y291_METJA      KPDLVIFVGDALTGNDAVYQAEEFNRAVNIDGIILTKVDADAKGGAALSIGYAIGKPILYLGVGQRYQDL
FTSY_THEAQ      EPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
FTSY_RICPR      KPTHSILIIDAITGQNTYNQIEYFNDVTNLTGLIVTKLDGSAKAGVLVGAVQKFNLPVYFIGIGEKIEDL
FTSY_RICBR      KPTHSVLVIDAITGQNTYNQVEHFNDATNLTGLIVTKLDGSAKAGVIVGVVQRFNLPIYFIGIGEQIEDL
FTSY_BUCAI      XPHEKLLIIDSCNGQNTIQQTEIFHKALNLTGIIITKLDGTAKGGVVFSLADQFQIPIRYIGIGEKMQDL
FTSY_MYCPN      KPQETLLVLDGTTGQSGLAQAKVFNEFTELTGIILTKMDSSSKGGIILAIKDLFNLPVKLIGFGETTADL
FTSY_MYCGE      QPSETLLVLDGTVGQTGLSQAKVFNEFSKLTGIVLTKMDGSAKGGIILAIKDMFNLPVKLIGFGEKTSDL
FTSY_BUCBP      HKQETMLVLDACIGQNSIKQVKIFHESLNVTGLVITKLDSTAKGGVIFSIAQEFLIPVRYISFGEDFEDI
FTSY_MYCLE      TRREVLLVLDATIGQNGLTQVRVFAEVVDITGAVLTKLDGTAKGGIVFRIQRELGVPVKLVGLGEGPDDL
SRPR_DICDI      NVDLVLFVGEALVGNDGVDQLTKFDKSLSLDGIILTKFDTDDKVGAAISMVYSTGHPILFLGTGQNYTDL
SRPR_DROME      NPDLVLFVGEALVGNEAVDQLVKFNQSLAIDGIVLTKFDTDDKVGAAISMTYITGQPIVFVGTGQ-----
FTSY_MYCTU      TRREVLLVLDATIGQNGLAQARVFAEVVDISGAVLTKLDGTAKGGIVFRVQQELGVPVKLVGLGEGPDDL
FTSY_MYCBO      TRREVLLVLDATIGQNGLAQARVFAEVVDISGAVLTKLDGTAKGGIVFRVQQELGVPVKLVGLGEGPDDL
SRPR_SCHPO      KLDKIFQVAEALVGTDSLAQAKHFQASLPLDGFIISKVDTVGQXXXXXXXXYAVRVPIIFVGIGQTYSDL
SRPR_BOVIN      TPDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ-----
SRPR_HUMAN      TPDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ-----
SRPR_MOUSE      TPDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ-----
SRPR_YEAST      KPDKIIMVGEALVGTDSVQQAKNFNDAFGLDFFIISKCDGEML-GTMVNMVYATGIPILFVGVGQ-----
SRPR_CANFA      TPDLVLFVGEALVGNEAVDQLVKFNRALAIDGIVLTKFDTDDKVGAAISMTYITSKPIVFVGTGQ-----
FLHF_PSEPU      IAAKNYLVLATTSQKQVLTAAYHSYKRCGLAGCILTKLDETASLGDVLSLAISHELPVAYLTDGPRI---
FLHF_HELPY      YNIDVSLVLSVTTKYEDMDIYDSFG-VLGIDTLIFTKLDESRGLGNLFSLVHESQKPISYLSVGQEV---
FLHF_HELPJ      YNIDVSLVLSVTTKYEDMDIYDSFG-VLGIDTLIFTKLDESRGLGNLFSLVHESQKPISYLSVGQEV---
FLHF_AQUAE      SDISVYLTLAANLSELVMYEAIMQFGMFSISGLIFTKLDETPYPGSMVNVAYRTQYPVVCFTMGQSI---
FLHF_TREPA      KNFELEVYLTIDAGSKANDLREVFKQYALFEALIVTKLDETTSIGNLISALSEARTPITYITTGQ-----
FLHF_CAMJE      MHSDVNLVVSANTKHEDLMEIYKNFSFLNIDTLIITKFDETKVFGNIFSLVYETNIPLSFFSIGQEVDDL
FLHF_BORBU      RDAEFHLAVSSTT--KTSDVKEIFHQPFNYKTVIFTKVDETTCVGNLISL--------------------
FLHF_PSEAE      LNVKNYLVMATTSQSQVLKSAYQTYRHCGLAGCILTKLDEAGSLGESMALAIAQRLPVAYLADGPRI---
CYSC_AERS4      ----------------------------------------------------------------------
SYM_HAEI8       ----------------------------------------------------------------------
MNME_LACC3      SQGKVLRLATAIVGRPNVGKSSLLNHMLHEDKAIVTDVAGTTRDVLEEYV-NVRGVPLKLAGIHDTTDKV
Y158_METJA      KNKEAIVFVDDASG---ARVRLLFNQKLGADLVVTSKLMEGPRGGL-LAGKKELVDKIYIEGTKFGLEAQ
SYM_HAEPS       ----------------------------------------------------------------------
SYM_HAEIN       ----------------------------------------------------------------------
SYM_HAEIE       ----------------------------------------------------------------------
CYSC_VIBVY      ----------------------------------------------------------------------
CYSC_VIBVU      ----------------------------------------------------------------------
CYSC_SHESM      ----------------------------------------------------------------------
CYSC_SHESA      ----------------------------------------------------------------------
CYSC_SHEON      ----------------------------------------------------------------------
CYSC_AERPE      ----------------------------------------------------------------------
CYSC_AERHH      ----------------------------------------------------------------------
GPN1_BOVIN      ----------------------------------------------------------------------
KTHY_JANSC      ----------------------------------------------------------------------
CYSC_VIBPA      ----------------------------------------------------------------------
YCF27_PORAE     ETRLSIIVISAADGEEALSIFKREHPNLVVLDLMMPKLDG---YGVCQELRKESDVPIALSDVSDRITGL
NODQ_AZOBR      ----------------------------------------------------------------------
LPXK_METEP      ----------------------------------------------------------------------
DNA2_YEAST      ----------------------------------------------------------------------
CLPB_YEREN      ----------------------------------------------------------------------
CFXQ_XANFL      AHH-------------------------------------------------------------------
RECA_RICCN      ----------------------------------------------------------------------
RECA_RICAE      ----------------------------------------------------------------------
NODQ_RHISB      ----------------------------------------------------------------------
LPXK_METC4      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------
NODQ_RHIME      ----------------------------------------------------------------------
MPA_MYCLE       VP-QLLSEIDGVEGLENVIVIGASNREDMIDPAIL-----------------------------------
SYM_HAEIG       ----------------------------------------------------------------------
CYSC_SHESW      ----------------------------------------------------------------------
CYSC_SHESR      ----------------------------------------------------------------------
CYSC_SHEPC      ----------------------------------------------------------------------
CYSC_SHEB9      ----------------------------------------------------------------------
CYSC_SHEB8      ----------------------------------------------------------------------
CYSC_SHEB5      ----------------------------------------------------------------------
CYSC_SHEB2      ----------------------------------------------------------------------
CYSC_BACA2      ----------------------------------------------------------------------
CBBX_RHOSH      ----------------------------------------------------------------------
YBHF_SHIFL      ----------------------------------------------------------------------
YBHF_ECOLI      ----------------------------------------------------------------------
Y1704_LACJO     ----------------------------------------------------------------------
RL1_LACBA       ----------------------------------------------------------------------
POLG_SMSV1      ----------------------------------------------------------------------
NODQ_RHITR      ----------------------------------------------------------------------
KAD_CAMHC       YDINLSAVIEVNVSEE------------------------------------------------------
HSLU_LACS1      FPNNDMEEVTEDVRNERLSVAEQLKRGLLENNEVTIQVDDPS--------TQFNNQSGMLGQMGIDLSSL
FTSH7_ORYSJ     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EPFYPDRMADRILGMGDVLTLIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGM
SRP54_BACSU     EPFHPERMASRILGMGDVLTLIEKAQASVDEDKAKELEQKMRTMSFTLDDFLEQLGQVRNMGPLDELLQM
SRP54_STRMU     ETFHPDRMSSRILGMGDLLTLIEKASQDYDEQKSAELAEKMRENSFDFNDFIEQLDQVQNMGSMEDILKM
SRP54_ECOLI     EPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDFDLNDFLEQLRQMKNMGGMASLMGK
SRP54_ECOL6     EPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDFDLNDFLEQLRQMKNMGGMASLMGK
SRP54_ECO57     EPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDFDLNDFLEQLRQMKNMGGMASLMGK
SRP54_HAEIN     EPFHPDRVASRILGMGDVLSLIEDLERSVDREKAEKMAQKFKKGDFTLDDFREQLIEMKKMGGMMSMLEK
SRP54_THEAQ     EPFYPERLAGRILGMGDVASLAEKVRAAGLEAEAPKSAKEL-----SLEDFLKQMQNLKRLGPFSEILGL
SRP54_MYCTU     DVFHPDRMASRILGMGDVLSLIXXXXXXXXXXXXXXXXXKIGAGELTLEDFLEQMLAVRKMGPIGNLLGM
SRP54_MYCBO     DVFHPDRMASRILGMGDVLSLIXXXXXXXXXXXXXXXXXKIGAGELTLEDFLEQMLAVRKMGPIGNLLGM
SRP54_SYNY3     QPFYPDRLASRILNMGDVLTLVEKAQEAIDVGDVEKLQNKILEATFDFDDFIKQMRFMKNMGSLGGLLKM
SRP54_SYNE7     QPFHPERMASRILGMGDVLTLVEKAQEEIDLADVEKMQEKILAAKFDFTDFLKQMRLLKNMGSLAGFIKL
SRP54_RICPR     EEFNAERLASRILDMGDIISFVKKAASIVDREEAEKTAIKLKSGKFDLNDYLQQMRSIKKMGGFGSILSM
SR54C_ARATH     EPFYPDRMAGRILGMGDVLSFVEKATEVMRQEDAEDLQKKIMSAKFDFNDFLKQTRAVAKMGSMTRVLGM
SRP54_RICFE     EEFDAERLASRILDMGDIISFVEKAASIVDRXXXXXXXXXXXXXXFDLNDYLQQMRSIKKMGGFGSILSM
SRP54_RICBR     EEFDAKRIASRILDMGDIISFVEKAASIVDREQAEKTAAKLKKGKFDLNDYLQQMKSIKKIGGFGSILSM
SRP54_RICCN     EEFDAERLASRILDMGDIISFVEKAASIVDRXXXXXXXXXXXXXXFDLNDYLQQMRSIKKMGGFGSILSM
SRP54_MYCLE     DVFHPDRMASRILGMGDVLSLIXXXXXXXXXXXXXXXXXKIVAGELTLEDFLEQMLAVRKMGLIGNLLGM
SRP54_BUCAP     EPFHPERIADRILGMNQVISLIKDIEEKVNQSQVKNLTKKFRKGDFNLNDFLIQLKEMKNMGNLNYFIEK
SRP54_BUCAI     EPFHPERIADRILGMNDIMSLIEDIEEKVDQSQIQKLTKKLKKGDFNLNDFLTQIKQMKKIGGLNYFANK
SRP54_RICTY     EEFDAERLASRILDMGDIISFVKKAASIVDREEAERTAIKLKSGKFDLNDYLKHMRSIKKMGGFGSILSM
SRP54_AQUAE     EPFYPDRIAQRILGLGDIQSLVEKAQEVITEDKAQVMATKVMTGEFDLEDLREMLRMIQQMGPLDKLLSM
SRP54_BUCBP     ELFYPDRIASRILGMGDMLSLIENIENKIDKKHIKKFSNTIKKYNFNFNDMLLHINQIKKIGGVNSILGK
SRP54_MYCMY     AAFYPKRMADRLMGMGDIETLFERAVENIDERSIQKTMNRMFLGQFDLEDLRNQLAQIAKMGSLNKLMKM
SRP54_HELPJ     DVFMPERIVGRLMGAGDIISLAEKTASVLNPNEAKDLSKKLKKGQFTFNDFLNQIEKVKKLGSMSSLISM
SRP54_HELPY     DVFVPERIVGRLMGAGDIVSLAEKTASVLNPNEAKDLSKKLKKGQFTFNDFLNQIEKVKKLGSMSSLISM
SRP54_THEON     EPFDPKRFVSRLLGLGDIQGXXXXXXXXXXXXXXXXXDEKFLKGKFNLKDMYAQLEAMQKMGPLKQILQM
SRP54_THEGJ     EPFDPKRFVSRLLGLGDIXXXXXXXXXXXXXXXXXXXDEKFLRGKFNLKDMYAQLEAMQKMGPLKQILQM
SRP54_PYRKO     EPFDPKRFVSRLLGLGDXXXXXXXXXXXXXXXXXXXXDEKFLRGKFNLKDMYAQLEAMQKMGPLKQILQM
SRP54_METM7     EQFDPKKFISRILGMGDLDSLLEKTEDIMD-ESTEESIDSILKGKFTLIELYAQLETISKMGPMKQILSM
SRP54_METMP     EQFDPKKFISRILGLGDLDSLLEKTEDIMD-ESTEESIDSILKGKFTLIELYAQLETISKMGPMKQILSM
SRP54_METS3     ELFDPARFISRLLGMGDIQTLIEKAEDSIDEDMAEKTMKNMMSGKFTLVDMKNQFEMMNSMGPMQQVLSM
SRP54_METM5     EQFDPKKFISRILGLGDLDSLLEKTEDIMD-ESTEESIDSILKGKFTLIELYAQLETISKMGPMKQILSM
SRP54_MYCPN     EQFHPERIASRILGLGDVMTLVEKAEEVFDKQSLTKTVSKMFLGKMDLEDLLLYMEQMNQMGSVSSIVKM
SRP54_METVS     ETFDPKKFISRLLGMGDLDSLLEKTEDVMD-ESTEESIDSILKGKFTLVELYAQLETISKMGPMKQIMGM
SRP54_PYRAB     EPFDPARFVSRLLGLGDIQXXXXXXXXXXXXXXXXXXXXRFLKGKFTLKDMYAQLEAMRKMGPLKQILRM
SRP54_PYRFU     EPFDPPRFVSRLLGLGDIQXXXXXXXXXXXXXXXXXXXXRFLRGKFTLKDMYAQLEAMRKMGPLKQILRM
SRP54_METM6     EQFDPKKFISRILGFGDLDSLLEKTEDIMD-ESAEESIDSILKGKFTLIELYAQLETISKMGPMKQILSM
SRP54_METST     EAFDPERFISRLLGMGDLDTLIEKAAEVTSEKSDKEMIDSIISGKFTLKDMENQLEMMNKMGPIQQIMKL
SRP54_SULAC     EVFNPRRFVSRLLGLGDXXXXXXXXXXVEDYENLEKRMEDVGKTKLTLRDIYKQLIALRKMGPLGKIFQM
SRP54_SULTO     EVFNPRRFVSRILGMGDIESIIEKIKGMEEYEQIQKKMEEVMKAKLTLRDIYKQLTALRKMGPLNKILQM
SRP54_PYRHO     EPFDPARFVSRLLGLGDIQGXXXXXXXXXXXXXXXXXDDRFLRGKFTLKDMYAQLEAMRKMGPLKQILRM
SRP54_SULIY     EIFNAKRYVSRILGMGDIESILEKVKG---LEEYEKIQKKMEKGKLTLRDVYAQIMALRKMGPLSKVLQH
SRP54_SULIN     EIFNAKRYVSRILGMGDIESILEKVKG---LEEYEKIQKKMEKGKLTLRDVYAQIMALRKMGPLSKVLQH
SRP54_SULIM     EIFNAKRYVSRILGMGDIESILEKVKG---LEEYEKIQKKMEKGKLTLRDVYAQIMALRKMGPLSKVLQH
SRP54_SULIL     EIFNAKRYVSRILGMGDIESILEKVKG---LEEYEKIQKKMEKGKLTLRDVYAQIMALRKMGPLSKVLQH
SRP54_SULIK     EIFNAKRYVSRILGMGDIESILEKVKG---LEEYEKIQKKMEKGKLTLRDVYAQIMALRKMGPLSKVLQH
SRP54_SULIA     EIFNAKRYVSRILGMGDIESILEKVKG---LEEYEKIQKKMEKGKLTLRDVYAQIMALRKMGPLSKVLQH
SRP54_METAC     EKFEADRFISRLLGMGDLKSLMEKAEESLSEEDVNV--EALMQGRFTLKDMYKQLEAMNKMGPLKQIMSM
SRP54_HYPBU     EVFRPKRFVARLLGMGDLESLLEKIERLRGVEEFEKTVAEMMSGKITFRTIYKQLQQVTKLGPFRKILQM
SRP54_MYCGE     EQFHPERIANRILGLGDVMSLVEKAEQVFDKKDLTKTISKMFLGKMDLEDLLIYMQQMHKMGSVSSLIKM
SRP54_STAMF     EVFRPPRFVARILGIGDLEGLIEKVR-RIKVEFTEKDVEEFLSGRLNMRLVYKQLVSLRKMGPLRKILQM
SRP54_METBF     EKFEADRFISRLLGMGDLKSLMEKAEETLSEEDVNV--EALMQGRFTLKDMYKQLEAMNKMGPLKQIMSM
SRP54_METTH     EVFDPERFISRLLGMGDLRSXXXXXXXXXXXXXXXXXXXXXXSGKFTLRDMRVQFEMMGKMGPLQQVMSM
SRP54_METLZ     ERFDPNGFISRLLGMGDLKALVEKAEESMNAED-VDVNAMLR-GKFTLNDMYKQLEAVQKMGPLKQVLSM
SRP54_METMA     EKFEADRFISRLLGMGDLKSLMEKAEESLSEEDVNV--EALMQGRFTLKDMYKQLEAMNKMGPLKQIXXX
SRP54_METBU     EKFEPDRFISRLLGMGDIKSLIEKAEETLSEEDIDM--EAMMRGRFTLKDMYSQLEAMNKMGPMKQIMQM
SRP54_METS5     EVFNPRRFVARILGMGDLEAIIEKMKAMEDYEGIQKKMGEVMKSKLTLRDMYKQIVAVRKMGPLSKILQL
SRP54_METTP     EKFEADRFISRLLGMGDIKGLIEKAQIESDVDVDAMMKGK-----FTLKDMYKQLEAMNKMGPLKQIMQM
SRP54_PYRIL     DLFNPRKFVARVLGMGDLDALVEKIKAVFEEE---KVLQEIESGRLDLLTFKKQIEGLLKLGPLSKVLQL
SRP54_AERPE     EPFAPRRFVARILGMGDLESLLERIKSLEEAGELDRAAEDVLKGRITMRTIYRQLRAMRKLGPLGKVLQM
SRP54_METJA     EPFDPKKFISRLLGMGDLESLLEKAEDMVD-EKTEESIDAIMRGKFTLNELMTQLEAIENMGSMKKILSM
SRP54_HALMA     ERFEPSGFISRLLGMGDLKQLTERVERAMEETQEGDEEEDMLEGQFTLKDMRKQMQTMNNMGPLDQVMDM
SRP54_UNCMA     ERFDPDGFISRLLGMGDLRALVERAN---EVLQKDDVNEKMMQGKFTLNDMYDQLEAINKMGPLKQIMSM
SRP54_PYRAR     EPFNPRKFVARLLGMGDLDALLEKIKAVFXXXXXXXXXXSGR---LDLLTFKKQIDSLMKLGPLSKVFQL
SRP54_THEAC     EVFDPKKFLSRLLGLGDLESLFETVQADITEEEAQESFEKLMTGKFNLKDMYDVWEKFSKPGLMKKLLAR
SRP54_HALWD     ERFEPNGFISRLLGMGDLKQLSERVERAMAETQEADDDEDIMEGSFTLKDMRKQMEAMDRMGPLDQVMDM
SRP54_METKA     EEFNPRSFVARLLGIGDI---DXXXXXXXXXXXXXXXXXXXXXXXFTLKDLYEQLEALSKMGPVDKLLQY
SRP54_META3     EPFDPKKFISRLLGMGDLDSLLXXXXXXXXXXXXXSLDAMMR-GKFTLNELYSQLEAISKMGSMKQLMAM
SRP54_THEVO     EIFDPKKFLSRLLGLGDLETLFETVEANITEEEAQKSFEKLMTGKFNLKDMYDVWEKFSRPGLMKKLVDS
SRP54_SULSO     ETFNAKRFVSRILGMGDIESILEKVKG---LEEYDKIQKKMEKGKLTLRDVYAQIIALRKMGPLSKVLQH
SRP54_RAT       EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
SRP54_MOUSE     EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
SRP54_PONAB     EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
SRP54_MACFA     EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
SRP54_HUMAN     EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
SRP54_HALVO     ERFEPNGFISRLLGMGDLKQLVERAMSETQAEDEDWDPEEMMKGNFTLKDMQKQMEAMDKMGPLDQVLDM
SRP54_CANFA     EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
SRP54_BOVIN     EPFKTQPFISKLLGMGDIEGLIDKVELKLDDNEA--LIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGM
SRP54_ACIAM     EVFNPRRFVARILGMGDIETILEKIK---EVENYDKMQKKMEEGKLTLRDVYNQLIALRKMGPLSKLFQL
SRP54_ARCFU     ERFDPAGFVSRLLGMGDIKALMEKIERIASEEELDP--EAFLKGTFTLKDIYKQIEAMNKMGPVRKIFEM
SRP54_HALLT     ERFEPSGFISRLLGMGDLKQLVERAMAEAQEEDEDWDPEDMLQGEFTLKDMKRQMDAMNRMGPLDQVMDM
SRP54_HALSA     ERFEPDSFISRLLGMGDLKQLVERAMXXXXXXXXXXXXXXLMKGEFTLHDMRKQMQAMDNMGPLDQVMDM
SRP54_HALS3     ERFEPDSFISRLLGMGDLKQLVERAMXXXXXXXXXXXXXXLMKGEFTLHDMRKQMQAMDNMGPLDQVMDM
SRP54_NATPD     ERFEPSGFISRLLGMGDLKQLSERVERAMEETQAEEDPEDLMKGEFTLKDMRNQMNAMNKMGPLDQVMDM
SRP54_PYRAE     EQFSPRKFVARVLGMGDLDTLLEKIKAVFXXXXXXXXXXSGR---LDLLTFKKQIDSLLKLGPLSKVFQL
SRP54_YEAST     EKFSPKSFISKLLGIGDIESLFEQLQTVSNKEDAKATMENIQKGKFTLLDFKKQMQTIMKMGPLSNIAQM
SRP54_CANAL     EIFKPTTFISKLLGIGDIQGLIEHVQSNLHQDEGHKQTEHIKEGKFTLRDFQNQMNNFLKMGPLTNIASM
SRP54_PYRCJ     ELFNPRKFVARVLGMGDLDALVEKIKAVFEED---KVLEELESGRLDLLTFKKQIDSLLKLGPLSKVFQL
SRP54_SCHPO     ERFSPRSFISKXXXXXXXXXXMEHVQSDFDKK---NMVKNLEQGKFTVRDFRDQLGNIMKLGPLSKMASM
SR542_ARATH     EVFDAKPFVSRLLGNGDMSGFVNKLQEVVPKDQQPELLEMLSHGKFTLRIMYDQFQNMLNMGPLKEVFSM
SRP54_GEOCY     EPFKTKPFVSKXXXXXXXXXXXXKV-SDLKLDENEELMDKLKHGQFTLRDMYEQFQNIMKMGPFNQIIGM
SR543_ARATH     EVFDVKPFVSRLLGMGDWSGFVDKLQEVVPKDQQPELLEKLSQGNFTLRIMYDQFQNILNMGPLKEVFSM
SRP54_THENV     EMFIPRKFVARVLGMGDLDALVERIKA---XXXXXXXXXXXXSGKLDLLTFKKQIDGLLKLGPLSKVFQM
SR542_SOLLC     EVFDVKPFVSRLLGMGDWSGFMDKIHEVVPMDQQPELLQKLSEGHFTLRIMYEQFQNILKMGPIGQVFSM
SR541_SOLLC     EVFDVKPFVSRLLGMGDLSGLVNKIQDVVPMDQQPELLQKLSEGHFTLRIMYEQFQSMLKMGPL-GVFSM
SRP54_YARLI     EAFSPKQFISKLLGIGDLQGLMETMQSNLDQK---KTMEHIQEGIFTLADLRDQMGNMLKMGSLSSIAGM
SRP54_ENTHI     EEFDAESFVRQLLGMGDLKGIAKLAKDFAENAEYKTMVKHLQEGTLTVRDWKEQLSNLQKMGQLGNIMQM
SRP54_ASPNG     ERFEPKAFIQKLLGMGDMAGLVEHVQATKDSASAKETYKHISEGIYTLRDFRENITSIMKMGPLSKLSGM
SR543_HORVU     DVFNVEPFVARLLGRGDLPGLIDKMESIVPADQQSELVAKLSEGAFTLRLLYEQFQNLLKMGPMSQIFSM
SRP54_DICDI     ELFDPSTFVSKLLGYGDMKGMLEKIKEVIPEDSTSL--KEIAQGKFTLRSXXXXXXXXXXLGPIDKLVQM
SR541_ARATH     EVFDVKPFVSRLLGKGDWSGLVDKLQEVVPKDLQNELVENLSQGNFTLRSMYDQFQCSLRI-PLNQLFSM
FTSY_ECOLI      RPFKADDFIEALFARED-----------------------------------------------------
SR541_HORVU     EIFDVKPFVSRXXXXXXXXXXXXKIQDVMPADQQPELLAKLAEGTFTLRLLYEQFQNLLKMGPIGQVFSM
SR542_HORVU     EIFDVKPFVSRXXXXXXXXXXXXKIQDVMPADQQPELLAKLAEGTFTLRLLYEQFQNLLKMGPIGQVFSM
FTSY_NEIMC      RPFDARAFVDALL---------------------------------------------------------
FTSY_NEIMB      RPFDARAFVDALL---------------------------------------------------------
FTSY_NEIMA      RPFDARAFVDALL---------------------------------------------------------
FTSY_NEIGO      RPFDARAFVDRLL---------------------------------------------------------
DOCK_SULAC      IPFSPDWFVERI----------------------------------------------------------
FTSY_HAEIN      REF-------------------------------------------------------------------
FTSY_HELPY      IAFDEERFIEDLV---------------------------------------------------------
FTSY_HELPJ      IAFDEERFIEDLV---------------------------------------------------------
FTSY_BACSU      QEFDPE----------------------------------------------------------------
FTSY_AQUAE      QPFDADAYVEALL---------------------------------------------------------
FTSY_RICTY      KIFNRHDFSRSLVGL-------------------------------------------------------
FTSY_MYCHO      AEF-------------------------------------------------------------------
FTSY_RICCN      KIFNQHDFARNLVGL-------------------------------------------------------
FTSY_BUCAP      VVF-------------------------------------------------------------------
FTSY_RICFE      KIFNRHDFAKSLVGL-------------------------------------------------------
FTSY_SYNY3      RPFSSYEFVEALL---------------------------------------------------------
Y291_METJA      IEFDADWMVRKL----------------------------------------------------------
FTSY_THEAQ      QPFDPEAFVEALL---------------------------------------------------------
FTSY_RICPR      KIFNRHDFSRSLVGL-------------------------------------------------------
FTSY_RICBR      KIFNRHDFAKSLVGL-------------------------------------------------------
FTSY_BUCAI      GHFNSQEFIESI----------------------------------------------------------
FTSY_MYCPN      AAF---DLEQYVLGLTKNLSL-------------------------------------------------
FTSY_MYCGE      AIF-------------------------------------------------------------------
FTSY_BUCBP      QVFNSNIFVNAIL---------------------------------------------------------
FTSY_MYCLE      APFEPAVFVDALL---------------------------------------------------------
SRPR_DICDI      K---------------------------------------------------------------------
SRPR_DROME      ----------------------------------------------------------------------
FTSY_MYCTU      APFEPAAFVDALLG--------------------------------------------------------
FTSY_MYCBO      APFEPAAFVDALLG--------------------------------------------------------
SRPR_SCHPO      RTLSVDWVVDQLM---------------------------------------------------------
SRPR_BOVIN      ----------------------------------------------------------------------
SRPR_HUMAN      ----------------------------------------------------------------------
SRPR_MOUSE      ----------------------------------------------------------------------
SRPR_YEAST      ----------------------------------------------------------------------
SRPR_CANFA      ----------------------------------------------------------------------
FLHF_PSEPU      ----------------------------------------------------------------------
FLHF_HELPY      ----------------------------------------------------------------------
FLHF_HELPJ      ----------------------------------------------------------------------
FLHF_AQUAE      ----------------------------------------------------------------------
FLHF_TREPA      ----------------------------------------------------------------------
FLHF_CAMJE      EVANSDFLVHCIL---------------------------------------------------------
FLHF_BORBU      ----------------------------------------------------------------------
FLHF_PSEAE      ----------------------------------------------------------------------
CYSC_AERS4      ----------------------------------------------------------------------
SYM_HAEI8       ---------------------------------AAKLNDRIEDLDFNLEDFVQRVNTVNKLVNLSRNAGF
MNME_LACC3      EKIGVERSRQAITQADLILLVLDQSEPLTDEDEQATANKK-RIIVLNKQDLPAQLDTLKLVSPDEIIKTA
Y158_METJA      PPLLAGYRALKNFNLERIRKAFERAK-NFDLSKIEKLNKELKAIDDNINIVYER----------------
SYM_HAEPS       ---------------------------------AAKLNDRIEDLDFNLEDFVQRVNSVNKLVNLSRTAGF
SYM_HAEIN       ---------------------------------AAKLNDRIEDLDFNLEDFVQRVNTVNKLVNLSRNAGF
SYM_HAEIE       ---------------------------------AAKLNDRIEDLDFNLEDFVQRVNTVNKLVNLSRNAGF
CYSC_VIBVY      ----------------------------------------------------------------------
CYSC_VIBVU      ----------------------------------------------------------------------
CYSC_SHESM      ----------------------------------------------------------------------
CYSC_SHESA      ----------------------------------------------------------------------
CYSC_SHEON      ----------------------------------------------------------------------
CYSC_AERPE      ----------------------------------------------------------------------
CYSC_AERHH      ----------------------------------------------------------------------
GPN1_BOVIN      ----------------------------------------------------------------------
KTHY_JANSC      ----------------------------------------------------------------------
CYSC_VIBPA      ----------------------------------------------------------------------
YCF27_PORAE     EPFSPKELEARI---RSVLRRVDKASSNNNLPNSGIINIGFLKIDVNKHQVYKNNERVRLTG--------
NODQ_AZOBR      ----------------------------------------------------------------------
LPXK_METEP      ----------------------------------------------------------------------
DNA2_YEAST      ----------------------------------------------------------------------
CLPB_YEREN      ----------------------------------------------------------------------
CFXQ_XANFL      ----------------------------------------------------------------------
RECA_RICCN      ----------------------------------------------------------------------
RECA_RICAE      ----------------------------------------------------------------------
NODQ_RHISB      ----------------------------------------------------------------------
LPXK_METC4      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------
NODQ_RHIME      ----------------------------------------------------------------------
MPA_MYCLE       ----------------------------------------------------------------------
SYM_HAEIG       ---------------------------------AAKLNDRIEDLDFNLDDFVQRVNTVNKLVNLSRNAGF
CYSC_SHESW      ----------------------------------------------------------------------
CYSC_SHESR      ----------------------------------------------------------------------
CYSC_SHEPC      ----------------------------------------------------------------------
CYSC_SHEB9      ----------------------------------------------------------------------
CYSC_SHEB8      ----------------------------------------------------------------------
CYSC_SHEB5      ----------------------------------------------------------------------
CYSC_SHEB2      ----------------------------------------------------------------------
CYSC_BACA2      ----------------------------------------------------------------------
CBBX_RHOSH      ----------------------------------------------------------------------
YBHF_SHIFL      ----------------------------------------------------------------------
YBHF_ECOLI      ----------------------------------------------------------------------
Y1704_LACJO     ----------------------------------------------------------------------
RL1_LACBA       --------ADKVYGMGDAIDLVKKIDAKFDAEVAFKLNVDTKQADQQLRGAL------------------
POLG_SMSV1      ----------------------------------------------------------------------
NODQ_RHITR      ----------------------------------------------------------------------
KAD_CAMHC       ----------------------------------------------------------------------
HSLU_LACS1      SSMMPTKKVERTMTVAEAREILIKEESEKLVNSADLADAAIKRAENTGIIFIDEIDKI------------
FTSH7_ORYSJ     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IPGMGKLTKQLKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
SRP54_BACSU     MPGAGKM-KGLKNIQVDEKQLNHVEAIIKSMTVLEKEQPDIINASRRKRIAKGSGTSVQEVNRLLKQFDE
SRP54_STRMU     IPGMAN-NPALANVKVDEGEIARKRAIVSSMTPEERENPDLLTPSRRRRIASGSGNTFVNVNKFIKDFNQ
SRP54_ECOLI     LPGMGQIPDNVK-SQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDD
SRP54_ECOL6     LPGMGQIPDNVK-SQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDD
SRP54_ECO57     LPGMGQIPDNVK-SQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQFDD
SRP54_HAEIN     LPGAKNLSEHVKN-QVDDKMFVKMEAIINSMTLKERANPDIIKGSRRRRIALGSGTQVQDVNKLLKQFDE
SRP54_THEAQ     LPGVPQGLK------VDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEE
SRP54_MYCTU     LPGAAQMKDAL--AEVDDKQLDRVQAIIRGMTPQERADPKIINASRRLRIANGSGVTVSEVNQLVERFFE
SRP54_MYCBO     LPGAAQMKDAL--AEVDDKQLDRVQAIIRGMTPQERADPKIINASRRLRIANGSGVTVSEVNQLVERFFE
SRP54_SYNY3     IPGMNKLSS--GDIEKGEKELKRTEAMISSMTTEERKNPDLLSPSRRRRIAQGSGHSETDVSKLITNF--
SRP54_SYNE7     IPGLG---GKINDEQLGERQLKRVEAMINSMTPQERRDPDLLSNSRRHRIAKGCG---------------
SRP54_RICPR     LPGSGKIFDQIDQSKLNSKIIEHQEAIILSMTLKERKNPDIINASRRKRIAAGAGMTVQKVNILLKQYKQ
SR54C_ARATH     IPGMGKVSAQIREAE---KNLLVMEAMIEVMTXXXXXXXXXXXXXXXKRIAKDSGKTEQQVSALVAQIFQ
SRP54_RICFE     LPGSGKIMDQIDQSKLNSKIIEHQEAIILSMTLKERENPDIINASRRKRIAAGAGTTVQKVNILLKQYKQ
SRP54_RICBR     LPGSGKIMDQIDQSKLNSKIIEHQEAIILSMTPKERRNPDIINASRRKRIALGAGTTVQKVNILLKQFKQ
SRP54_RICCN     LPGSGKIMDQIDQSKLNSKIIEHQEAIILSMTPKERKNPDIINASRRKRIAVGAGTTVQKVNILLKQYKQ
SRP54_MYCLE     LPGAGQVKEVL--EQVDDKQLDRLQAIIRGMTPQERADPKIINASRRLRIANGSGVTVSEVNQLVDRFFE
SRP54_BUCAP     F----SKNKILSNNPLLGENLNRIEAIIYSMTHKERMHPIIIKGSRKRRIALGSGTKIQDVNKLLKNFD-
SRP54_BUCAI     FSINHQLSNNISLLNTDKNTLKKIEAMICSMTPKERIKPIIIKGSRKRRIALGSGTQIQDVNKLLKNFDD
SRP54_RICTY     LPGSGKIIDQIDQSKLDSRIIEHQEAIILSMTLKERKNPDIINASRRKRIAAGAGMTVQKVNILLKQYKQ
SRP54_AQUAE     IPG---VAPQLKHLKVDEKQFKKIEAIINSMTPEERRNPKIINMSRKKRIARGSGTTVSDVN--------
SRP54_BUCBP     LPKTQTIFNSFQN-NIDENILLKMKTIINSMTISERHQPELIKGSRKRRISLGSGIPIPEINQLLKQF--
SRP54_MYCMY     LPINKVSESQIQEAQ---RKLAVFSILMDSMTLKERRDPRVLKASRKNRIIKGSGRSEKEFNELINSFEK
SRP54_HELPJ     IPGLGNMASALKDTDLESSEVKKIKAMVNSMTKKERENPEILNGSRRKRIALGSGLEVSEINRIIKRFDQ
SRP54_HELPY     IPGLGNMASALKDTDLESSEVKKIKAMVNSMTKKEQENPEILNGSRRKRIALGSGLEVSEINRIIKRFDQ
SRP54_THEON     IPGMG---YSLPDDRVGEERLKKFKVIMDSMTEEELEHPEIINYSRIKRIARGSGTSIQEVRELLHQYNQ
SRP54_THEGJ     IPGLG---YSLPDERVGEEKLRRYRIIMDSMTEEELENPDIINYSRIKRIARGSGTSTREVRELLAQYNQ
SRP54_PYRKO     IPGLGYSLPE--DAVRVGEELKRYKVIMDSMTEEELENPEIINYSRIKRIARGSGATTAEVRELLNQYNQ
SRP54_METM7     IPGMGNLPKEA--AQLTEDKLKRYKIMMDSMTMEEKENPELIKASRLQRIAKGAGVKQEEIKDLLKYYST
SRP54_METMP     IPGMGNMPKEA--AQLTEAKLKRYKIMMDSMTMEEKENPELIKTSRLQRIAKGAGVKQEEIKDLLKYYST
SRP54_METS3     IPGLGKEASKMTEDKIDG-----YKVIMSSMTKKEMENPKLIKQSRIRRIAMGAGVEESEVRDLLKYYNN
SRP54_METM5     IPGMGNLPKEA--AQLTEDKLKRYKIMMDSMTLEEKENPELIKTSRLQRIAKGAGVKQDEIKDLLKYYST
SRP54_MYCPN     LP--GNLT--VSDDHVESIE-AKVKVLINSMTREERRHPKLIDPSRKQRIIKGSGRKMDELNKLMKEWSK
SRP54_METVS     IPGFGNMPKEA--AQLTEQKLKRYKIMMDSMTMEEKENPELIKTSRLQRIAKGAGVKQDEIKDLLKYYAT
SRP54_PYRAB     IPGLG---YSLPDEVISGEELRKFKVIMDSMTEEELMNPDIINYSRIKRIARGSGTSVKDVKELLNQYNQ
SRP54_PYRFU     IPGLG---YSLPDDVISGEELKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQ
SRP54_METM6     IPGMGNMPKEA--AQLTEDKLKRYKIMMDSMTMEEKENPELIKTSRLQRIARGAGVKPEEIKDLLKYYST
SRP54_METST     IPGLGN-QLPANASKVTEEKLGMYKILMNSMTTYELENPEVIKKSRINRISRGAGLTNDDVKDLLKYYNV
SRP54_SULAC     LPGAGILSQVPEEQKLGEEKIRTFMAIMNSMTYKELDNPSIIDKARMRRIAKGAGVTVEEVKELLKQYQM
SRP54_SULTO     LPGFGVFSQIPEEQKLGEEKIKKFLVIMNSMTYKELDNPSIIDKSRIRRIAKGSGTSPEEVKELLKQYQV
SRP54_PYRHO     IPGLG---YSLPDELISGEELRKFKVIMDSMTEEELMNPEIINYSRIKRIARGSGTSIKDVKELLTQYNQ
SRP54_SULIY     IPGLGVMLPTPSEDQLKGEEIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNN
SRP54_SULIN     IPGLGVMLPTPSEDQLKGEEIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNN
SRP54_SULIM     IPGLGVMLPTPSEDQLKGEEIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNN
SRP54_SULIL     IPGLGVMLPTPSEDQLKGEEIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNN
SRP54_SULIK     IPGLGVMLPTPSEDQLKGEEIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNN
SRP54_SULIA     IPGLGVMLPTPSEDQLKGEEIRRWLAALNSMTYKELENPSIIDKSRMRRIAEGSGLEVEDVRELLEWYNN
SRP54_METAC     LPGMGGMKFSDEMFQATSDKMKNYKVIMDSMTEEEMTDPRVIGGSRIKRISKGSGCSSEDVRELLKYHKT
SRP54_HYPBU     IPGISTMLESLDEARLSEEKVKKWLTIMNSMTYEELDNPNLLERSRVKRIAVGAGVEPSEVRELYNYYKS
SRP54_MYCGE     LPANFSVSEE--NAELIENKIELWKVLINSMTREERRHPKLIDPNRKQRIIKGSGRKMDELNKLMKEWNK
SRP54_STAMF     IPGLSLKIPLXXXXXXXXXXXXXWLAIINSMTYEELDKPEXXXXXXXXXXAYGAGVKPEDVRELLKQYEM
SRP54_METBF     LPXXXXXXVKLSDEQATSDKMKNYKTIMDSMTEEEMTDPKLIGGSRIKRISRGSGCSPEEVRELLKYHKT
SRP54_METTH     LPGAGKLPKDA--SRMTEETIRKYLIIMDSMTEEELEKPDIIKHSRIRRIARGSGTRNEDVKELLKYYRV
SRP54_METLZ     LP-MGNMNVPSDALEGTADKMKKFRIIMDSMTPQELDEPALINTSRMIRVAKGSGSSVEEVRDLIKYYKM
SRP54_METMA     XXXXXXXXXKLSDEQATSDKMKNYKVIMDSMTEDEMADPKLIGGSRIKRISRGSGCSPEDVRELLKYHKT
SRP54_METBU     LP-LGGMGAKLSDDKVTEDKMKGYRVLMDSMTEEELLNPRLLGSSRIKRISLGSGSSPDAVRELLKYYKM
SRP54_METS5     IPGMNMMGDIPEDQVKVGEQMQRWLSIMNSMTYQELDNPSIIDKQRMRRIAMGSGTEVEEVRELIEHFQR
SRP54_METTP     LPGIG-IELSDKEYQVTKERLEAYRFIMDSMTDEELEDPKIINASRIKRIARGSGTRPELVKELLKSHAA
SRP54_PYRIL     LPG-GFAAKISEEQELSQKNLKKWYAILSSMTIEELKNPDILNASRIRRIALGAGVTPKDVKEMLTVYEN
SRP54_AERPE     LPGASMLASIDEGAKLGEEKMKRWMAIIESMTYEELDRPEIIDKRRMRRIAIGSGTSVDDVRELLVYYKN
SRP54_METJA     IPGFGAMPKEL--SHLTEAKIKKYKVIISSMTKEERENPXXXXXXXXXXXXXXXXTTENDVREVLRYYET
SRP54_HALMA     IPGLGGLMDQLPDDAMDQERMQDFDVIMDSMTEEELENPRVVGQSRTKRICRGSGKPEERVRELLQQHKQ
SRP54_UNCMA     LP-LGGLGGNITDDKMTQDKLKGYKVIMDSMTAAERDDPKLIGSSRIARVAHGSGKSPEEVRELLK----
SRP54_PYRAR     LPG-GLAAKISEEQELSQKNLKKWRAILSSMTMEELKNPDILNASRIRRIALGAGVTPKDVKEMLTVYEN
SRP54_THEAC     IPGSQKIDDS-KIQSAEDK-LRMYRIIMDSMTFEELENPEIINAKRITRIARGAGVREEDVRMLLKEFK-
SRP54_HALWD     IPGLGGLKDQLPDDAMDQNRMRDFDVIMDSMTEAELEDPRSVGASRVRRIARGSGTDEETVRELLQQHKM
SRP54_METKA     VPGMGGGRNVRKISQITEERLKKYKVIMDSMTEKELENPEILNKSRIRRIAIGSGTSERDVIELLNHYRM
SRP54_META3     IPGMGNLPKGAAD--ITEHKLKKYKIIMDSMTSTEKENPDIIKTSRMKRIAKGAGVKQEEIKELLKYYST
SRP54_THEVO     LP-LAKLSQKINDDQIAEQKLQRYRIIMDSMTFQELENPEIINAKRITRIARGAGVREEDVRMLLKEFKA
SRP54_SULSO     IPGLGMLPTPSEDQLKIGEEIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGXXYNNMNRLLKMVKR
SRP54_RAT       IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
SRP54_MOUSE     IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
SRP54_PONAB     IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
SRP54_MACFA     IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
SRP54_HUMAN     IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
SRP54_HALVO     IPGFGGIKDQLPDDAMDKDRMRSFEVIMDSMTEEELENPRKVGASRVRRIAQGSGQDEETIQELLEQHRM
SRP54_CANFA     IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
SRP54_BOVIN     IPGFG------TDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTRIQRVARGSGVSTRDVQELLTQYTK
SRP54_ACIAM     LPGIGMLGQIPEDQLKVGEEMRKWLAIMNSMTYEELDNPSIIDKSRMRRIALGSGTEIEDVKELIEHYQR
SRP54_ARCFU     LPGLG-LKVDNDVMEMTQEKMKKFRVIMDSMTEEELLNPKXXXXXXXXXXXXXXGTSPQEVKELL-----
SRP54_HALLT     IPXXXXXXDQLPDDAMDVTQMRRFERIMDSMTDEELEQPRVVGQSRTERIARGSGTDEETVRQLLEQHSM
SRP54_HALSA     IPGMGGLMDELPDDAMDQERMRGFEVIMDSMTEAEMADPRSVGASQIRRIARGSGQPEDRVRELLDQ---
SRP54_HALS3     IPGMGGLMDELPDDAMDQERMRGFEVIMDSMTEAEMADPRSVGASQIRRIARGSGQPEDRVRELLDQ---
SRP54_NATPD     IPGLGGIKDQLPDDAMDQERLRDFEVIMDSMSEAELENPRAIGQSQIERIARGSGTDEDTVRELLEQ---
SRP54_PYRAE     LP--GNLAAKISEEQLSQRNLKKWRAILSSMTLEELKNPEILNASRIRRIALGAGVAPKDVKEMLTVYEN
SRP54_YEAST     IPGMSNMMNQVGEEETSQK-MKKMVYVLDSMTKEELESDGRMEPTRMVRVAKGSGTSVFEVEMIL-----
SRP54_CANAL     IPGLSNIMSQVGDEE-TSKKIKNMIYIMDSMTTKELECDGRIEPSRIVRVARGSGCAVVEVEMILQQ---
SRP54_PYRCJ     LPSNFAIKVSEEQIELSQKNLRKWKAILSSMTMEELKHPEVLNASRIRRIAMGAGVTPKDVKEMLTVFE-
SRP54_SCHPO     IPGMSNMMNGMNDEE-GSLRMKRMLYIVDSMTEQELDSDGLLQPSRVLRVARGSGTSVLEVEETISQ---
SR542_ARATH     LPGMRAEMMPEGHEKESQAEIKRYMTMMDSMTNEESSNPKVFNESRIMRIARGSGRIVREVMEMLEEYKR
SRP54_GEOCY     IPGFSPDFMSKGNERESMAKLKRLMTMMDSMNDGELDHPNSKQPGRAARVARGSGTSVREVNELLKQYSN
SR543_ARATH     LPGISAEMMPKGHEKESQAKIKRYMTMMDSMTELDSSNPKVFNESRMMRIARGSGRQVREVMEMLEEYKR
SRP54_THENV     LPG-GLAAKISEEQELSQKNLKKWRAILSSMTVEELKNPELLNASRIRRIALGAGVTPRDVKEMLTVYEN
SR542_SOLLC     LPGFAELMPKGRENESQAK-IKRYMTMMDSMTNEESSNPKLMTDSRIMRIARGSGRQVHEVMDMMEEYKR
SR541_SOLLC     LPGFAEMMPQGREKESQAK-FKRYMTMMDSMTDEESTNPKILTESRIMRIARGSGRLVHEVMEMLEEYKR
SRP54_YARLI     IPGLSGMASSISDEE-GTRRIKRMIYILDSMNQKELDSDGSIVPSRITRVARGSGTSIREVEEVLQQ---
SRP54_ENTHI     I---GLNHPMFQGGNIE-KKFKVFMVILDSMTDRELDGSAKTDESRIRRLARGSGRDIREVNELFEQIK-
SRP54_ASPNG     IPGLSNLTAGLDDE--DGSKLRRMIYIFDSMTAAELDGDGKMQPSRMVRIACGSGTTVREVEDLLSQHRM
SR543_HORVU     LPGFSSELMPKGQEKQSKEKFKRYMTIMDSMTPAESTNPKLMTESRIIRVARGSGRKVKDVMEMLEEYKR
SRP54_DICDI     IPGMNQL-PQLQGNE-GGLKLKAYINILDSLSEKELDGKKPITQKRIITIAQGSGRHPNEVVELLEQ---
SR541_ARATH     LPGISAEMMPKGHGEESRVKMKRYMTMMDSMTNKESPNPKIFNESRIMRIARGSGRLVREVMEMLEEYKR
FTSY_ECOLI      ----------------------------------------------------------------------
SR541_HORVU     LPGFSSELMPKGHEKEGQAKIKRYMTIMDSMTAAESTNPKLMTEXXXXXXXXXXXXXXXDVTDMLEEYKR
SR542_HORVU     LPGFSSELMPKGHEKEGQAKIKRYMTIMDSMTAAESTNPKLMTEXXXXXXXXXXXXXXXDVTDMLEEYKR
FTSY_NEIMC      ----------------------------------------------------------------------
FTSY_NEIMB      ----------------------------------------------------------------------
FTSY_NEIMA      ----------------------------------------------------------------------
FTSY_NEIGO      ----------------------------------------------------------------------
DOCK_SULAC      ----------------------------------------------------------------------
FTSY_HAEIN      ----------------------------------------------------------------------
FTSY_HELPY      ----------------------------------------------------------------------
FTSY_HELPJ      ----------------------------------------------------------------------
FTSY_BACSU      ----------------------------------------------------------------------
FTSY_AQUAE      ----------------------------------------------------------------------
FTSY_RICTY      ----------------------------------------------------------------------
FTSY_MYCHO      ----------------------------------------------------------------------
FTSY_RICCN      ----------------------------------------------------------------------
FTSY_BUCAP      ----------------------------------------------------------------------
FTSY_RICFE      ----------------------------------------------------------------------
FTSY_SYNY3      ----------------------------------------------------------------------
Y291_METJA      ----------------------------------------------------------------------
FTSY_THEAQ      ----------------------------------------------------------------------
FTSY_RICPR      ----------------------------------------------------------------------
FTSY_RICBR      ----------------------------------------------------------------------
FTSY_BUCAI      ----------------------------------------------------------------------
FTSY_MYCPN      ----------------------------------------------------------------------
FTSY_MYCGE      ----------------------------------------------------------------------
FTSY_BUCBP      ----------------------------------------------------------------------
FTSY_MYCLE      ----------------------------------------------------------------------
SRPR_DICDI      ----------------------------------------------------------------------
SRPR_DROME      ----------------------------------------------------------------------
FTSY_MYCTU      ----------------------------------------------------------------------
FTSY_MYCBO      ----------------------------------------------------------------------
SRPR_SCHPO      ----------------------------------------------------------------------
SRPR_BOVIN      ----------------------------------------------------------------------
SRPR_HUMAN      ----------------------------------------------------------------------
SRPR_MOUSE      ----------------------------------------------------------------------
SRPR_YEAST      ----------------------------------------------------------------------
SRPR_CANFA      ----------------------------------------------------------------------
FLHF_PSEPU      ----------------------------------------------------------------------
FLHF_HELPY      ----------------------------------------------------------------------
FLHF_HELPJ      ----------------------------------------------------------------------
FLHF_AQUAE      ----------------------------------------------------------------------
FLHF_TREPA      ----------------------------------------------------------------------
FLHF_CAMJE      ----------------------------------------------------------------------
FLHF_BORBU      ----------------------------------------------------------------------
FLHF_PSEAE      ----------------------------------------------------------------------
CYSC_AERS4      ----------------------------------------------------------------------
SYM_HAEI8       IAKRGKLSDKLEDEALFAEFTAQAEQI-------------------------------------------
MNME_LACC3      IPGMDALDERIAKLFFGGIENSQTTVMV------------------------------------------
Y158_METJA      ----------------------------------------------------------------------
SYM_HAEPS       ITKRGKLASTLENQALFDEFVAQSEQI-------------------------------------------
SYM_HAEIN       IAKRGKLADKLEDKSLFAEFTAQAEQI-------------------------------------------
SYM_HAEIE       IAKRGKLADKLEDEALFAEFTAQAEQI-------------------------------------------
CYSC_VIBVY      ----------------------------------------------------------------------
CYSC_VIBVU      ----------------------------------------------------------------------
CYSC_SHESM      ----------------------------------------------------------------------
CYSC_SHESA      ----------------------------------------------------------------------
CYSC_SHEON      ----------------------------------------------------------------------
CYSC_AERPE      ----------------------------------------------------------------------
CYSC_AERHH      ----------------------------------------------------------------------
GPN1_BOVIN      ----------------------------------------------------------------------
KTHY_JANSC      ----------------------------------------------------------------------
CYSC_VIBPA      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
NODQ_AZOBR      ----------------------------------------------------------------------
LPXK_METEP      ----------------------------------------------------------------------
DNA2_YEAST      ----------------------------------------------------------------------
CLPB_YEREN      ----------------------------------------------------------------------
CFXQ_XANFL      ----------------------------------------------------------------------
RECA_RICCN      ----------------------------------------------------------------------
RECA_RICAE      ----------------------------------------------------------------------
NODQ_RHISB      ----------------------------------------------------------------------
LPXK_METC4      ----------------------------------------------------------------------
KTHY_DINSH      ----------------------------------------------------------------------
NODQ_RHIME      ----------------------------------------------------------------------
MPA_MYCLE       ----------------------------------------------------------------------
SYM_HAEIG       IAKRSKLADKLEDESLFAEFTAQAEQI-------------------------------------------
CYSC_SHESW      ----------------------------------------------------------------------
CYSC_SHESR      ----------------------------------------------------------------------
CYSC_SHEPC      ----------------------------------------------------------------------
CYSC_SHEB9      ----------------------------------------------------------------------
CYSC_SHEB8      ----------------------------------------------------------------------
CYSC_SHEB5      ----------------------------------------------------------------------
CYSC_SHEB2      ----------------------------------------------------------------------
CYSC_BACA2      ----------------------------------------------------------------------
CBBX_RHOSH      ----------------------------------------------------------------------
YBHF_SHIFL      ----------------------------------------------------------------------
YBHF_ECOLI      ----------------------------------------------------------------------
Y1704_LACJO     ----------------------------------------------------------------------
RL1_LACBA       ----------------------------------------------------------------------
POLG_SMSV1      ----------------------------------------------------------------------
NODQ_RHITR      ----------------------------------------------------------------------
KAD_CAMHC       ----------------------------------------------------------------------
HSLU_LACS1      ----------------------------------------------------------------------
FTSH7_ORYSJ     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TRKMMKQISNMTxxxxxxxxxxxxxx
SRP54_BACSU     MKKMMKQMTNMS--------------
SRP54_STRMU     AKKMMQGV------------------
SRP54_ECOLI     MQR-----------------------
SRP54_ECOL6     MQR-----------------------
SRP54_ECO57     MQR-----------------------
SRP54_HAEIN     --------------------------
SRP54_THEAQ     MKALMKSL------------------
SRP54_MYCTU     ARKMMSSM------------------
SRP54_MYCBO     ARKMMSSM------------------
SRP54_SYNY3     --------------------------
SRP54_SYNE7     --------------------------
SRP54_RICPR     ISAVMKKTSKM---------------
SR54C_ARATH     MRVKMKNL------------------
SRP54_RICFE     ISEMMKKASKM---------------
SRP54_RICBR     ISDMMKKASNM---------------
SRP54_RICCN     ISEIMKKVSKM---------------
SRP54_MYCLE     ARKMMSSV------------------
SRP54_BUCAP     --------------------------
SRP54_BUCAI     IRRIMKKI------------------
SRP54_RICTY     ISAVMKKASKM---------------
SRP54_AQUAE     --------------------------
SRP54_BUCBP     --------------------------
SRP54_MYCMY     GKKQVLEITKM---------------
SRP54_HELPJ     ASKMAKRLTN----------------
SRP54_HELPY     ASKMAKRLTN----------------
SRP54_THEON     MKKMFKSM------------------
SRP54_THEGJ     MRKMFKNL------------------
SRP54_PYRKO     MKKMFKSLN-----------------
SRP54_METM7     TK------------------------
SRP54_METMP     TK------------------------
SRP54_METS3     TKKTMKGI------------------
SRP54_METM5     TK------------------------
SRP54_MYCPN     LQTKTAEMGRM---------------
SRP54_METVS     TK------------------------
SRP54_PYRAB     MKKFFKSMN-----------------
SRP54_PYRFU     MKKLFKSMN-----------------
SRP54_METM6     TK------------------------
SRP54_METST     TKKALK--------------------
SRP54_SULAC     TNNLLKMV------------------
SRP54_SULTO     TNNLLKMV------------------
SRP54_PYRHO     MKKFFKSMN-----------------
SRP54_SULIY     MNKLLKMV------------------
SRP54_SULIN     MNKLLKMV------------------
SRP54_SULIM     MNKLLKMV------------------
SRP54_SULIL     MNKLLKMV------------------
SRP54_SULIK     MNKLLKMV------------------
SRP54_SULIA     MNKLLKMV------------------
SRP54_METAC     MQTALK--------------------
SRP54_HYPBU     VKKMMRQL------------------
SRP54_MYCGE     MQKLLKTGSN----------------
SRP54_STAMF     MKKLSKQL------------------
SRP54_METBF     MQTALK--------------------
SRP54_METTH     TKKAMK--------------------
SRP54_METLZ     MQKTLK--------------------
SRP54_METMA     MQTALK--------------------
SRP54_METBU     MQNAMK--------------------
SRP54_METS5     TLKMLKR-------------------
SRP54_METTP     MQK-----------------------
SRP54_PYRIL     LKKMSKTL------------------
SRP54_AERPE     LKTMM---------------------
SRP54_METJA     TKNAIDKL------------------
SRP54_HALMA     MEQMLKQFQGM---------------
SRP54_UNCMA     --------------------------
SRP54_PYRAR     LKKMSKTL------------------
SRP54_THEAC     --------------------------
SRP54_HALWD     MERTIKQFQGM---------------
SRP54_METKA     MKDVIEDIQS----------------
SRP54_META3     TK------------------------
SRP54_THEVO     MKNNMK--------------------
SRP54_SULSO     RR------------------------
SRP54_RAT       FAQMVKKMGGI---------------
SRP54_MOUSE     FAQMVKKMGGI---------------
SRP54_PONAB     FAQMVKKMGGI---------------
SRP54_MACFA     FAQMVKKMGGI---------------
SRP54_HUMAN     FAQMVKKMGGI---------------
SRP54_HALVO     MEQTIKQFQNM---------------
SRP54_CANFA     FAQMVKKMGGI---------------
SRP54_BOVIN     FAQMVKKMGGI---------------
SRP54_ACIAM     TIKMLKR-------------------
SRP54_ARCFU     --------------------------
SRP54_HALLT     MEQTISQFQGM---------------
SRP54_HALSA     --------------------------
SRP54_HALS3     --------------------------
SRP54_NATPD     -HKMMSR-------------------
SRP54_PYRAE     LRKMSKTL------------------
SRP54_YEAST     --------------------------
SRP54_CANAL     --------------------------
SRP54_PYRCJ     --------------------------
SRP54_SCHPO     --------------------------
SR542_ARATH     LTTMWGKVKGL---------------
SRP54_GEOCY     FSATVKKMGGI---------------
SR543_ARATH     LAKIWSKMKGL---------------
SRP54_THENV     LKRMSKTL------------------
SR542_SOLLC     LAKIWSKMKGL---------------
SR541_SOLLC     LAKIFSKMKGL---------------
SRP54_YARLI     -QKMMASMAS----------------
SRP54_ENTHI     --------------------------
SRP54_ASPNG     MAGMAKRV------------------
SR543_HORVU     LAKM----------------------
SRP54_DICDI     --------------------------
SR541_ARATH     IAKTMKGI------------------
FTSY_ECOLI      --------------------------
SR541_HORVU     LAKMWSKMKGL---------------
SR542_HORVU     LAKMWSKMKGL---------------
FTSY_NEIMC      --------------------------
FTSY_NEIMB      --------------------------
FTSY_NEIMA      --------------------------
FTSY_NEIGO      --------------------------
DOCK_SULAC      --------------------------
FTSY_HAEIN      --------------------------
FTSY_HELPY      --------------------------
FTSY_HELPJ      --------------------------
FTSY_BACSU      --------------------------
FTSY_AQUAE      --------------------------
FTSY_RICTY      --------------------------
FTSY_MYCHO      --------------------------
FTSY_RICCN      --------------------------
FTSY_BUCAP      --------------------------
FTSY_RICFE      --------------------------
FTSY_SYNY3      --------------------------
Y291_METJA      --------------------------
FTSY_THEAQ      --------------------------
FTSY_RICPR      --------------------------
FTSY_RICBR      --------------------------
FTSY_BUCAI      --------------------------
FTSY_MYCPN      --------------------------
FTSY_MYCGE      --------------------------
FTSY_BUCBP      --------------------------
FTSY_MYCLE      --------------------------
SRPR_DICDI      --------------------------
SRPR_DROME      --------------------------
FTSY_MYCTU      --------------------------
FTSY_MYCBO      --------------------------
SRPR_SCHPO      --------------------------
SRPR_BOVIN      --------------------------
SRPR_HUMAN      --------------------------
SRPR_MOUSE      --------------------------
SRPR_YEAST      --------------------------
SRPR_CANFA      --------------------------
FLHF_PSEPU      --------------------------
FLHF_HELPY      --------------------------
FLHF_HELPJ      --------------------------
FLHF_AQUAE      --------------------------
FLHF_TREPA      --------------------------
FLHF_CAMJE      --------------------------
FLHF_BORBU      --------------------------
FLHF_PSEAE      --------------------------
CYSC_AERS4      --------------------------
SYM_HAEI8       --------------------------
MNME_LACC3      --------------------------
Y158_METJA      --------------------------
SYM_HAEPS       --------------------------
SYM_HAEIN       --------------------------
SYM_HAEIE       --------------------------
CYSC_VIBVY      --------------------------
CYSC_VIBVU      --------------------------
CYSC_SHESM      --------------------------
CYSC_SHESA      --------------------------
CYSC_SHEON      --------------------------
CYSC_AERPE      --------------------------
CYSC_AERHH      --------------------------
GPN1_BOVIN      --------------------------
KTHY_JANSC      --------------------------
CYSC_VIBPA      --------------------------
YCF27_PORAE     --------------------------
NODQ_AZOBR      --------------------------
LPXK_METEP      --------------------------
DNA2_YEAST      --------------------------
CLPB_YEREN      --------------------------
CFXQ_XANFL      --------------------------
RECA_RICCN      --------------------------
RECA_RICAE      --------------------------
NODQ_RHISB      --------------------------
LPXK_METC4      --------------------------
KTHY_DINSH      --------------------------
NODQ_RHIME      --------------------------
MPA_MYCLE       --------------------------
SYM_HAEIG       --------------------------
CYSC_SHESW      --------------------------
CYSC_SHESR      --------------------------
CYSC_SHEPC      --------------------------
CYSC_SHEB9      --------------------------
CYSC_SHEB8      --------------------------
CYSC_SHEB5      --------------------------
CYSC_SHEB2      --------------------------
CYSC_BACA2      --------------------------
CBBX_RHOSH      --------------------------
YBHF_SHIFL      --------------------------
YBHF_ECOLI      --------------------------
Y1704_LACJO     --------------------------
RL1_LACBA       --------------------------
POLG_SMSV1      --------------------------
NODQ_RHITR      --------------------------
KAD_CAMHC       --------------------------
HSLU_LACS1      --------------------------
FTSH7_ORYSJ     --------------------------