[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50704.1

[Show Plain Result]


## Summary of Sequence Search
    1::586
    1::563     3e-92  37%  563 aa  LUTP_BACSU RecName: Full=L-lactate permease;
   40::551     4e-85  35%  551 aa  LLDP_SALTI RecName: Full=L-lactate permease;
    4::560     7e-85  35%  560 aa  GLCA_ECOLI RecName: Full=Glycolate permease glcA;
   40::551     3e-84  34%  551 aa  LLDP_SALTY RecName: Full=L-lactate permease;
    1::514     7e-82  35%  541 aa  LCTP_BACSU RecName: Full=L-lactate permease;
   40::551     9e-77  33%  551 aa  LLDP_ECOLI RecName: Full=L-lactate permease;
   40::551     9e-77  33%  551 aa  LLDP_ECOL6 RecName: Full=L-lactate permease;
   40::551     9e-77  33%  551 aa  LLDP_ECO57 RecName: Full=L-lactate permease;
    8::495     3e-73  35%  524 aa  LCTP_BACHD RecName: Full=L-lactate permease;
   58::449     4e-47  32%  474 aa  LCTP_STRIN RecName: Full=L-lactate permease;
   69::500     5e-18  21%  532 aa  Y1218_HAEIN RecName: Full=Putative L-lactate permease;
  144::229     6e-04  32%  570 aa  PTLCB_STAAW RecName: Full=PTS system lactose-specific EIICB
  144::229     6e-04  32%  570 aa  PTLCB_STAAU RecName: Full=PTS system lactose-specific EIICB
  144::229     6e-04  32%  570 aa  PTLCB_STAAS RecName: Full=PTS system lactose-specific EIICB
  144::229     6e-04  32%  570 aa  PTLCB_STAAR RecName: Full=PTS system lactose-specific EIICB
  144::229     6e-04  32%  570 aa  PTLCB_STAAN RecName: Full=PTS system lactose-specific EIICB
  144::229     6e-04  32%  570 aa  PTLCB_STAAM RecName: Full=PTS system lactose-specific EIICB
  144::229     6e-04  32%  570 aa  PTLCB_STAAC RecName: Full=PTS system lactose-specific EIICB
    1::586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MMWEQIITPFENQYLSAFVASIPISFLFFTLYSRVRIHIAGFLTLLVTTGVAIFVYGMPFKLAAWSSFYG
LUTP_BACSU      MQWTQAYTPIGNXXXXXXXXXVPIIFFFWALIKRMKGYTAGLATLGIALIIAVLVYRMPAEKALMSATQG
LLDP_SALTI      -------------------------------------YVAASWTVVIALAVALLFYKMPVDHALASVVYG
GLCA_ECOLI      --WTQMYMPMGGLGLSALVALIPIIFFFVALVLRLKGHVAGXXXXXXXXXXXXXXFKMPIDMXXXXXXXX
LLDP_SALTY      -------------------------------------YVAASWTVVIALAVALLFYKMPVDHALASVVYG
LCTP_BACSU      -MWEQLYDPFGNEYVSALVALTPILFFLLALVLKMKGILAAFLTLAVSFFVSVWAFHMPVEKAISSVLLG
LLDP_ECOLI      -------------------------------------YVAASWTVAIALAVALLFYKMPVANALASVVYG
LLDP_ECOL6      -------------------------------------YVAASWTVAIALAVALLFYKMPVANALASVVYG
LLDP_ECO57      -------------------------------------YVAASWTVAIALAVALLFYKMPVANALASVVYG
LCTP_BACHD      --------PFQHLAVSAFVAAIPIXXXXXTVFKMQGIQ-AALLTLLVTFFIAGLVFHLPFGESIGSIVQG
LCTP_STRIN      ---------------------------------------------------------------------G
Y1218_HAEIN     ----------------------------------------------------------------------
PTLCB_STAAW     ----------------------------------------------------------------------
PTLCB_STAAU     ----------------------------------------------------------------------
PTLCB_STAAS     ----------------------------------------------------------------------
PTLCB_STAAR     ----------------------------------------------------------------------
PTLCB_STAAN     ----------------------------------------------------------------------
PTLCB_STAAM     ----------------------------------------------------------------------
PTLCB_STAAC     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GMTGMFSIGWIMLSSLFLYKLTVKTGQIHIITWSIQSITRDHRLQCLLVALCLGAFLENLAGYSTSVAIT
LUTP_BACSU      AVYGLLPIGWIIVTSVFLYKITVKTGQFDIIRSSVLSITDDRRLQALLIXXXXXXXXXXXXXXXXPVAIS
LLDP_SALTI      FFYGLWPIAWIIIAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLIVXXXXXXXXXXXXXXXXPVAIT
GLCA_ECOLI      XXXXLWPIAWIIVAAVFLYKLTVASGQFDIIRSSVISITDDQRLQVLLIXXXXXXXXXXXXXXXXPVAIT
LLDP_SALTY      FFYGLWPIAWIIIAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLIVXXXXXXXXXXXXXXXXPVAIT
LCTP_BACSU      IGSGLWPIGYIVLMAVWLYKIAVKTGKFTIIRSSIAGISPDQRLQLLLIGFCFNAFLEGAAGFGVPIAIS
LLDP_ECOLI      FFYGLWPIAWIIIAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLIVXXXXXXXXXXXXXXXXPVAIT
LLDP_ECOL6      FFYGLWPIAWIIIAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLIVXXXXXXXXXXXXXXXXPVAIT
LLDP_ECO57      FFYGLWPIAWIIIAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLIVXXXXXXXXXXXXXXXXPVAIT
LCTP_BACHD      VVQGLWPIGYIIVMAVWLYKIAVASGKFAVLRGSIIGISRDQRIQLLLIGFCFNAFLEGAAGFGVPIAIC
LCTP_STRIN      AMMGFWPIIYIIVAAVFTYNLTTASGGMTVIKRLLMTITEDKRILVLILAWGFGGFLEAIAGFGTAVAIP
Y1218_HAEIN     ----------VIFGAILFNRFSEISGATNIMRKWLGNINPNPVAQLMIIGWAFAFMIEGASGFGTPAAIA
PTLCB_STAAW     ----------------------------------------------------------------------
PTLCB_STAAU     ----------------------------------------------------------------------
PTLCB_STAAS     ----------------------------------------------------------------------
PTLCB_STAAR     ----------------------------------------------------------------------
PTLCB_STAAN     ----------------------------------------------------------------------
PTLCB_STAAM     ----------------------------------------------------------------------
PTLCB_STAAC     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SGILVALGFRPIYAAVLCLITSISFGFMGVPIITAGLTSDIDMMAVSQMVGRQLPILSFLLPFWLVFILA
LUTP_BACSU      AALLVGLGFNPLYAAGICLIANVAFGAIGIPITAVEGPTGIPAMEISQMVGRQLPFLSVFIPLYLIIIMS
LLDP_SALTI      AALLVGLGFNPLYAAGLCLIVNVAFGAMGIPILVAGQVTDLDSFEIGQMVGRQLPFLTIIVLFWIMAIMD
GLCA_ECOLI      GALLVGLGFKPLYAAGLCLIANVAFGALGVPILVAGQVTGIDPFHIGAMAGRQLPFLSVLVPFWLVAMMD
LLDP_SALTY      AALLVGLGFNPLYAAGLCLIVNVAFGAMGIPILVAGQVTGLDSFEIGQMVGRQLPFLTIIVLFWIMAIMD
LCTP_BACSU      AALLVELGFKPXXXXXXXXXXXXXFGAIGIPVITGAQIGDLSALELSRTLMWTLPMISFLIPFLLVFLLD
LLDP_ECOLI      AALLVGLGFKPLYAAGLCLIVNVAFGAMGIPILVAGQVTGIDSFEIGQMVGRQLPFMTIIVLFWIMAIMD
LLDP_ECOL6      AALLVGLGFKPLYAAGLCLIVNVAFGAMGIPILVAGQVTGIDSFEIGQMVGRQLPFMTIIVLFWIMAIMD
LLDP_ECO57      AALLVGLGFKPLYAAGLCLIVNVAFGAMGIPILVAGQVTGIDSFEIGQMVGRQLPFMTIIVLFWIMAIMD
LCTP_BACHD      AVLLVSLGFKPLQAAMLCLIASGAFGAIGIPIDTLGLEGQVTSMDVSMMTALTLPMINFTIPFLLIWLMD
LCTP_STRIN      ASILVALGMKPLRAALICLITPTAFGAIGLPVTTLAQVTGLEVKQLSVIVSLQLFILIVAIPFVLVSLTG
Y1218_HAEIN     APILVGLGFHPLKVAMLALIMNVSFGAVGTPTFGALKLSEDMILEIGSITAFXXXXXXXXXXXXXXXXXV
PTLCB_STAAW     ----------------------------------------------------------------------
PTLCB_STAAU     ----------------------------------------------------------------------
PTLCB_STAAS     ----------------------------------------------------------------------
PTLCB_STAAR     ----------------------------------------------------------------------
PTLCB_STAAN     ----------------------------------------------------------------------
PTLCB_STAAM     ----------------------------------------------------------------------
PTLCB_STAAC     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GWKGTKEVWLPILVCGISFAGVQWFAANYIFLSIVNTLAAVTTMIIMVFFLRNWQPKDVWHSQKTSSFYP
LUTP_BACSU      GFRKALEIWPAILVSGVSFAVVQYLSSNFLGPELPDXXXXXXXXXXXXXXXKWWKPKTTFREQESAASIE
LLDP_SALTI      GWRGVKETWPAVMVAGGSFAIAQYLSSNFIGPELPDIISSLVSLVCLTLFLKRWQPVRIFRASQVDQTLA
GLCA_ECOLI      GWKGVKETWPAALVAGGSFAVTQFFTSNYIGPELPDITSALVSIVSLALFLKVWRPKNISMGQSAGAMVV
LLDP_SALTY      GWRGVKETWPAVMVAGGSFAIAQYLSSNFIGPELPDIISSLVSLVCLTLFLKRWQPVRIFRASQVDQTLA
LCTP_BACSU      RMKGIKQTWPALLVVSGGYTAVQTLTMAVLGPELANILAALFSMGGLALFLRKWQPKEIYREEGAGDAGE
LLDP_ECOLI      GWRGIKETWPAVVVAGGSFAIAQYLSSNFIGPELPDIIXXXXXXXXXXXXXKRWQPVRVFRASQVDMTLA
LLDP_ECOL6      GWRGIKETWPAVVVAGGSFAIAQYLSSNFIGPELPDIIXXXXXXXXXXXXXKRWQPVRVFRASQVDMTLA
LLDP_ECO57      GWRGIKETWPAVVVAGGSFAIAQYLSSNFIGPELPDIIXXXXXXXXXXXXXKRWQPVRVFRASQVDMTLA
LCTP_BACHD      SWKGIKEILPAILVTSSVYTVSQALITIFIGPELADIIPSLLTMGLLALFLKRWQPRNTF--LLNGNGCE
LCTP_STRIN      GKRPIKGVFGITLASGLAFALPQILVSNYVGAELPSIIGSLFCILVTILFV------NLRERGKNASPVG
Y1218_HAEIN     NWDDIRKIYISVLGCVVPYFLIA--QVNYEFPSLVGGAIGL--------FISVWAANRNIGLAKVTNTLD
PTLCB_STAAW     ----------------------------------------------------------------------
PTLCB_STAAU     ----------------------------------------------------------------------
PTLCB_STAAS     ----------------------------------------------------------------------
PTLCB_STAAR     ----------------------------------------------------------------------
PTLCB_STAAN     ----------------------------------------------------------------------
PTLCB_STAAM     ----------------------------------------------------------------------
PTLCB_STAAC     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NEKISFSTVLSAWLPYIIMTIFIINWSFKPVQDFLNTFTVYVAVSTLNNTIIASGKPIEVYXXXXXXXXV
LUTP_BACSU      TARTNPAAIFKAWSPFLLLTAMISVWGIPSVKSALTKLTFSPGVPFLNNQIVADGTPIEAVYKLEVLGSA
LLDP_SALTI      RTRYTTGQIVRAWSPFLFLTATVTLWSIPPFKALLYDWVINVPVPYLDK-LVARMPPVAAVYKFDWFSAT
GLCA_ECOLI      NKEYSLGQIIRAWSPFLILTVLVTIWTMKPFKALFYSLVINFQIPHLHQPIVAQPTPMDAVFKFDPLXXX
LLDP_SALTY      RTRYTTGQIVRAWSPFLFLTATVTLWSVPPFKALLYDWVINVPVPYLDK-LVARMPPVAAVYKFDWFSAT
LCTP_BACSU      KKAYRAADIAKAWSPFYILTAAITIWSLPAFKGLLYQSTLLFKMPFLHQQIMKSAMPLDAVFKVDLLSAT
LLDP_ECOLI      HTGYTAGQVLRAWTPFLFLTATVTLWSIPPFKALLYEWVINIPVPYLDKPVVSEATAYAAVFKFDWFSAT
LLDP_ECOL6      HTGYTAGQVLRAWTPFLFLTATVTLWSIPPFKALLYEWVINIPVPYLDKPVVSEATAYAAVFKFDWFSAT
LLDP_ECO57      HTGYTAGQVLRAWTPFLFLTATVTLWSIPPFKALLYEWVINIPVPYLDKPVVSEATAYAAVFKFDWFSAT
LCTP_BACHD      SEHASLKDVIKAWSPFYLLTMFVFLWS---LPAFKGLLAEGGALEFAKWAFVVPGSSIEV-GVDFXXXXX
LCTP_STRIN      GD-VAFKEGIIRCLPFILVFFFIMLTSFPAINQLLAKVSTTVSIYTGEH-----AKPYTI----KWLTSP
Y1218_HAEIN     NNAVSAGEVVKALFPTGLLIAFLIVTRIHPFKAMMNDATIWFSTTLGSLGLFEISKGLIFSLKNIFGSNV
PTLCB_STAAW     ----------------------------------------------------------------------
PTLCB_STAAU     ----------------------------------------------------------------------
PTLCB_STAAS     ----------------------------------------------------------------------
PTLCB_STAAR     ----------------------------------------------------------------------
PTLCB_STAAN     ----------------------------------------------------------------------
PTLCB_STAAM     ----------------------------------------------------------------------
PTLCB_STAAC     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GTVIFISAIINAYIYKVCHKELITLLGQAVRNLFLPLVGISLIIGVSYLMNWSGMIASMANVIASANGLL
LUTP_BACSU      GTAILIAAVLSKFITAISWKDWGTVFKETVQELKLPILTIASVVGFAYVTNSSGMSTTLGMTLALTGSMF
LLDP_SALTI      GTAILFAALLSIVWLKMKPSAAIQTFGSTLKELALPIYSIGMVLAFAFISNYXXXXXXXXXXXXXXXXXF
GLCA_ECOLI      XXXXXXXXXXXXXXXXXXXXXXXXXXAETLISLKWPILSIGMVLAFAFVTNYSGMSTTLALVLAGTGVMF
LLDP_SALTY      GTAILFAALLSIVWLKMKPSAAIQTFGSTLKELALPIYSIGMVLAFAFISNYXXXXXXXXXXXXXXXXXF
LCTP_BACSU      GTAILAAVIVTGFSKKFSSRDAFASLKETGKELWVPIMTICFVMGFANLANFAGLSSSIGLALAKTGDLF
LLDP_ECOLI      GTAILFAALLSIVWLKMKPSDAISTFGSTLKELALPIYSIGMVLAFAFISNYSXXXXXXXXXXXXXXXXF
LLDP_ECOL6      GTAILFAALLSIVWLKMKPSDAISTFGSTLKELALPIYSIGMVLAFAFISNYSXXXXXXXXXXXXXXXXF
LLDP_ECO57      GTAILFAALLSIVWLKMKPSDAISTFGSTLKELALPIYSIGMVLAFAFISNYSXXXXXXXXXXXXXXXXF
LCTP_BACHD      XXXXXXXXXXXXXXKMIRMKESISLLKKVIVDFSXXXXXXXXXXXXXKLMTYGGLTMALGEAVATTGAFF
LCTP_STRIN      GTMIILATFIAGLIQGMSFKEIGSILAKVLNKLTKTMVTVASIVALSKVMSYSGMINTIASLVAVTGGFY
Y1218_HAEIN     SSLLYVPALIPFVIFKISSKQILVSSLQQSKNPFIALIGALVMVNLMLVGGEHSMVKIIGRTFAEISGSW
PTLCB_STAAW     ----FLSAFVTVIVYNFCVKRNITIVPPNISQVFKDLIPFSAVIIILYALDLVIRNSFKSNV---AEGIL
PTLCB_STAAU     ----FLSAFVTVIVYNFCVKRNITIVPPNISQVFKDLIPFSAVIIILYALDLVIRNSFKSNV---AEGIL
PTLCB_STAAS     ----FLSAFVTVIVYNFCVKRNITIVPPNISQVFKDLIPFSAVIIILYALDLVIRNSFKSNV---AEGIL
PTLCB_STAAR     ----FLSAFVTVIVYNFCVKRNITIVPPNISQVFKDLIPFSAVIIILYALDLVIRNSFKSNV---AEGIL
PTLCB_STAAN     ----FLSAFVTVIVYNFCVKRNITIVPPNISQVFKDLIPFSAVIIILYALDLVIRNSFKSNV---AEGIL
PTLCB_STAAM     ----FLSAFVTVIVYNFCVKRNITIVPPNISQVFKDLIPFSAVIIILYALDLVIRNSFKSNV---AEGIL
PTLCB_STAAC     ----FLSAFVTVIVYNFCVKRNITIVPPNISQVFKDLIPFSAVIIILYALDLVIRNSFKSNV---AEGIL


                         .         .         +         .         .         .         .:490
query           PMFAPILGWLGVFITGSDVSSNTLMAKLQANTAQIVGFDPVLTVAANHSGGAVAKMISPEAIGAAASATG
LUTP_BACSU      TFFSPVLGWLGVFITGSDTSANLLFGNLQKVTALSVGMDPVLSVAANSSGGVTGKMISPQSIAVACAAVG
LLDP_SALTI      TFFSPFLGWLGVFLTGSDTSSNALFASLQATAAQQIGVSDVLMVAANTTGGVTGKMISPQSIAIACAAVG
GLCA_ECOLI      PFFSPFLGWLGVFLTGSDTSSNALFGSLQSTTAQQINVSDTLLVAANTSGGVTGKMISPQSIAVACAATG
LLDP_SALTY      TFFSPFLGWLGVFLTGSDTSSNALFASLQATAAQQIGVSDVLMVAANTTGGVTGKMISPQSIAIACAAVG
LCTP_BACSU      PFVSPVLGWIGVFITGSVVSNNALFGHLQVVTGAQIGAGSDLLLAANTAGGVMAKLVSPQSIAIAAAAVG
LLDP_ECOLI      TFFSPFLGWLGVFLTGSDTSSNXXXXXXXXXXXXXIGVSDLLLVAANTTGGVTGKMISPQSIAIACAAVG
LLDP_ECOL6      TFFSPFLGWLGVFLTGSDTSSNXXXXXXXXXXXXXIGVSDLLLVAANTTGGVTGKMISPQSIAIACAAVG
LLDP_ECO57      TFFSPFLGWLGVFLTGSDTSSNXXXXXXXXXXXXXIGVSDLLLVAANTTGGVTGKMISPQSIAIACAAVG
LCTP_BACHD      PFLSPILGWIGVFMTGSVVNNNTLFAPIQTTAGAIIGTNPSLLVAANTAGGVMAKLVSPQSIAIATAAVG
LCTP_STRIN      PFIAPVIGTLGTFITGSDTSANVLFGELQVKAANNLNMNPYWMAAQYDRG--------------------
Y1218_HAEIN     TIFSSFLGAIGSFFSGSNTVSNLTFGSVQLSTAETTGISVALVLALQSVGGAMGNMVCINNIVAVSSVLN
PTLCB_STAAW     KLFEPLFGWIGVTI--------------------------------------------------------
PTLCB_STAAU     KLFEPLFGWIGVTI--------------------------------------------------------
PTLCB_STAAS     KLFEPLFGWIGVTI--------------------------------------------------------
PTLCB_STAAR     KLFEPLFGWIGVTI--------------------------------------------------------
PTLCB_STAAN     KLFEPLFGWIGVTI--------------------------------------------------------
PTLCB_STAAM     KLFEPLFGWIGVTI--------------------------------------------------------
PTLCB_STAAC     KLFEPLFGWIGVTI--------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LNGREDDIXXXXXXXXXXXXXXXXXXXXXQAYTFKWLIPSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LUTP_BACSU      LAGKESDLFRFTIKHSLFLLLLVCIITFLQHHVFSWMIP-------------------------------
LLDP_SALTI      LVGKESDLFRFTVKHSLIFTCMVGVITTLQAYVLTWMIP-------------------------------
GLCA_ECOLI      MVGRESELFRYTVKHSLIFASVIGIITLLQAYVFTGMLVS------------------------------
LLDP_SALTY      LVGKESDLFRFTVKHSLIFTCMVGVITTLQAYVLTWMIP-------------------------------
LCTP_BACSU      QTGKESKL--------------------------------------------------------------
LLDP_ECOLI      LVGKESDLFRFTVKHSLIFTCIVGVITTLQAYVLTWMIP-------------------------------
LLDP_ECOL6      LVGKESDLFRFTVKHSLIFTCMVGVITTLQAYVLTWMIP-------------------------------
LLDP_ECO57      LVGKESDLFRFTVKHSLIFTCMVGVITTLQAYVLTWMIP-------------------------------
LCTP_BACHD      ETGNE-----------------------------------------------------------------
LCTP_STRIN      ----------------------------------------------------------------------
Y1218_HAEIN     ISNQE-----------------------------------------------------------------
PTLCB_STAAW     ----------------------------------------------------------------------
PTLCB_STAAU     ----------------------------------------------------------------------
PTLCB_STAAS     ----------------------------------------------------------------------
PTLCB_STAAR     ----------------------------------------------------------------------
PTLCB_STAAN     ----------------------------------------------------------------------
PTLCB_STAAM     ----------------------------------------------------------------------
PTLCB_STAAC     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
LUTP_BACSU      --------------------------
LLDP_SALTI      --------------------------
GLCA_ECOLI      --------------------------
LLDP_SALTY      --------------------------
LCTP_BACSU      --------------------------
LLDP_ECOLI      --------------------------
LLDP_ECOL6      --------------------------
LLDP_ECO57      --------------------------
LCTP_BACHD      --------------------------
LCTP_STRIN      --------------------------
Y1218_HAEIN     --------------------------
PTLCB_STAAW     --------------------------
PTLCB_STAAU     --------------------------
PTLCB_STAAS     --------------------------
PTLCB_STAAR     --------------------------
PTLCB_STAAN     --------------------------
PTLCB_STAAM     --------------------------
PTLCB_STAAC     --------------------------