[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50753.1

[Show Plain Result]


## Summary of Sequence Search
    1::394
   24::365     5e-36  30%  368 aa  LIVB3_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   26::349     3e-34  30%  373 aa  BRAC_PSEAE RecName: Full=Leucine-, isoleucine-, valine-,
   24::365     1e-32  29%  368 aa  LIVB3_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   24::370     2e-32  30%  371 aa  LIVB1_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   24::370     2e-32  30%  371 aa  LIVB1_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   24::370     6e-32  30%  371 aa  LIVB2_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   24::370     7e-32  29%  371 aa  LIVB1_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   24::370     1e-31  30%  371 aa  LIVB2_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   24::370     1e-31  29%  371 aa  LIVB1_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   23::345     2e-31  30%  369 aa  LIVK_SALTY RecName: Full=Leucine-specific-binding protein;       
   23::345     2e-31  30%  369 aa  LIVK_SALTI RecName: Full=Leucine-specific-binding protein;       
   24::370     2e-30  28%  371 aa  LIVB2_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   24::370     2e-30  28%  371 aa  LIVB2_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   23::345     4e-30  27%  369 aa  LIVK_ECOLI RecName: Full=Leucine-specific-binding protein;       
   23::342     3e-27  29%  367 aa  LIVJ_CITFR RecName: Full=Leu/Ile/Val-binding protein;       
   23::343     2e-26  29%  367 aa  LIVJ_ECOLI RecName: Full=Leu/Ile/Val-binding protein;       
   23::343     2e-26  29%  367 aa  LIVJ_ECOL6 RecName: Full=Leu/Ile/Val-binding protein;       
   23::343     2e-26  29%  367 aa  LIVJ_ECO57 RecName: Full=Leu/Ile/Val-binding protein;       
   21::341     3e-26  29%  365 aa  LIVJ_SALTY RecName: Full=Leu/Ile/Val/Thr-binding protein;       
   28::384     3e-24  29%  406 aa  LIVB5_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   28::384     3e-24  29%  406 aa  LIVB5_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   28::384     3e-24  29%  406 aa  LIVB5_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   28::384     3e-24  29%  406 aa  LIVB5_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   23::383     1e-23  27%  399 aa  LIVB7_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   23::383     1e-23  27%  399 aa  LIVB7_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   23::383     2e-23  27%  399 aa  LIVB7_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   23::383     4e-23  27%  399 aa  LIVB7_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   27::387     1e-18  27%  403 aa  LIVB8_BRUME RecName: Full=Leu/Ile/Val-binding protein homolog
   27::387     4e-18  26%  403 aa  LIVB8_BRUSU RecName: Full=Leu/Ile/Val-binding protein homolog
   27::387     4e-18  26%  403 aa  LIVB8_BRUAB RecName: Full=Leu/Ile/Val-binding protein homolog
   27::387     4e-18  26%  403 aa  LIVB8_BRUA2 RecName: Full=Leu/Ile/Val-binding protein homolog
   34::389     2e-15  27%  417 aa  Y1266_METJA RecName: Full=Uncharacterized protein MJ1266;Flags:
   68::349     1e-08  23%  895 aa  GLR23_ARATH RecName: Full=Glutamate receptor 2.3;AltName:
   69::325     2e-07  23%  920 aa  GLR22_ARATH RecName: Full=Glutamate receptor 2.2;AltName:
   74::330     6e-07  26%  918 aa  GLR25_ARATH RecName: Full=Glutamate receptor 2.5;AltName:
   73::329     2e-06  26%  967 aa  GLR26_ARATH RecName: Full=Glutamate receptor 2.6;AltName:
   51::219     7e-06  27%  953 aa  GLR35_ARATH RecName: Full=Glutamate receptor 3.5;AltName:
   74::204     9e-06  29%  959 aa  GLR34_ARATH RecName: Full=Glutamate receptor 3.4;       
   74::246     8e-05  24%  901 aa  GLR21_ARATH RecName: Full=Glutamate receptor 2.1;AltName:
    1::394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKAADANEIVIGGNLELSGPVATFGTAMKNGAEMYFEEVN
LIVB3_BRUME     -------------------------------------DITIGVIAPLTGPVAAFGDQVKKGAETAVEVIN
BRAC_PSEAE      --------------------------------AADTIKIALAG--PVTGPVAQYGDMQRAGALMAIEQIN
LIVB3_BRUSU     -------------------------------------DITIGVIAPLTGPVAAFGDQVKKGAETAVEVIN
LIVB1_BRUAB     -------------------------------------DVLVGIGIPVTGPNAVYGAQIQKGAEAAIKEVN
LIVB1_BRUA2     -------------------------------------DVLVGIGIPVTGPNAVYGAQIQKGAEAAIKEVN
LIVB2_BRUME     -------------------------------------DIMVGVGAPLTGSQAAFGEQIKRGVEAAVAEAN
LIVB1_BRUSU     -------------------------------------DVLVGIGIPVTGPNAVYGAQIQKGAEAAIKEVN
LIVB2_BRUSU     -------------------------------------DIMVGVGAPLTGSQAAFGEQIKRGVEAAVAEAN
LIVB1_BRUME     -------------------------------------DVLVGIGIPVTGPNAVYGAQIQKGAEAAIKEVN
LIVK_SALTY      ---------------------------------ADDIKVAIVG--AMSGPVAQWGDMEFNGARQAIKDIN
LIVK_SALTI      ---------------------------------ADDIKVAIVG--AMSGPVAQWGDMEFNGARQAIKDIN
LIVB2_BRUAB     -------------------------------------DIMVGVGAPLTGSQAAFGEQIKRGVEAAVAEAN
LIVB2_BRUA2     -------------------------------------DIMVGVGAPLTGSQAAFGEQIKRGVEAAVAEAN
LIVK_ECOLI      --------------------------------ADDIKVAVVGA---MSGPIAQWGDMEFNGARQAIKDIN
LIVJ_CITFR      --------------------------------AKDIKVAVVGA---MSGPVAQYGDQEFTGAEQAIADIN
LIVJ_ECOLI      --------------------------------AEDIKVAVVGA---MSGPVAQYGDQEFTGAEQAVADIN
LIVJ_ECOL6      --------------------------------AEDIKVAVVGA---MSGPVAQYGDQEFTGAEQAVADIN
LIVJ_ECO57      --------------------------------AEDIKVAVVGA---MSGPVAQYGDQEFTGAEQAVADIN
LIVJ_SALTY      --------------------------------ADDIKVAVVGA---MSGPVAQYGDQEFTGAEQAIADIN
LIVB5_BRUSU     -------------------------------KAEDV--ITLGASVQLSGPVANTGRYYQDAYNITIDKIN
LIVB5_BRUME     -------------------------------KAEDV--ITLGASVQLSGPVANTGRYYQDAYNITIDKIN
LIVB5_BRUAB     -------------------------------KAEDV--ITLGASVQLSGPVANTGRYYQDAYNITIDKIN
LIVB5_BRUA2     -------------------------------KAEDV--ITLGASVQLSGPVANTGRYYQDAYNITIDKIN
LIVB7_BRUAB     -------------------------------------DIKMGSLYPFSGPLALLGDESARGLEIAVEEIN
LIVB7_BRUA2     -------------------------------------DIKMGSLYPFSGPLALLGDESARGLEIAVEEIN
LIVB7_BRUSU     -------------------------------------DIKMGSLYPFSGPLALLGDESARGLEIAVEEIN
LIVB7_BRUME     -------------------------------------DIKMGSLYPFSGPLALLGDESARGLEIAVEEIN
LIVB8_BRUME     -------------------------------------DVKFGSLYPISGSLALLGEESARGLELAVDEVN
LIVB8_BRUSU     -------------------------------------DVKFGSLYPISGSLALLGEESARGLELAVDEVN
LIVB8_BRUAB     -------------------------------------DVKFGSLYPISGSLALLGEESARGLELAVDEVN
LIVB8_BRUA2     -------------------------------------DVKFGSLYPISGSLALLGEESARGLELAVDEVN
Y1266_METJA     ------------------------------------NVIKVGLLVDLSGGLATYGNNEKHICEIAEEKIN
GLR23_ARATH     ----------------------------------------------------------------------
GLR22_ARATH     ----------------------------------------------------------------------
GLR25_ARATH     ----------------------------------------------------------------------
GLR26_ARATH     ----------------------------------------------------------------------
GLR35_ARATH     ------------------------------------------------GALFTYDSFIGRAAKLAFEDIN
GLR34_ARATH     ------------------------------------------------------GRAAKPAVKAAMDDVN
GLR21_ARATH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTA
LIVB3_BRUME     KAGGIKGEKVVLKFADDAGEPKQGVSAANQIVG-DGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATG
BRAC_PSEAE      KAGGVNGAQLEGVIYDDACDPXXXXXXXXXXXXXXXXF-VVGHVCSSSTQPATDIYEDEGVLMITPSATA
LIVB3_BRUSU     KAGGIKGEKVVLKFADDAGEPKQGVSAANQIVG-DGIKFXXXXXXXXXXXXXSDVLSENGVLMVTPTATG
LIVB1_BRUAB     DAGGINGEKIAITIGDDVSDPKQGISVANKFAA-DGVKFVIGHFNSGVTIPASQVYAENGILEISPGATN
LIVB1_BRUA2     DAGGINGEKIAITIGDDVSDPKQGISVANKFAA-DGVKFVIGHFNSGVTIPASQVYAENGILEISPGATN
LIVB2_BRUME     AKGGMNGEQITLVYGDDAADSKQGISVANKFVG-DGVKFVIGHFNSGVSIPTSDIYAENGVLMIAPG---
LIVB1_BRUSU     DAGGINGEKIAITIGDDVSDPKQGISVANKFAA-DGVKFVIGHFNSGVTIPASQVYAENGILEISPGATN
LIVB2_BRUSU     AKGGMNGEQITLVYGDDAADPKQGISVANKFVG-DGVKFVIGHFNSGVSIPTSDIYAENGVLMIAPG---
LIVB1_BRUME     DAGGINGEKIAITIGDDVSDPKQGISVANKFAA-DGVKFVIGHFNSGVTIPASQVYAENGILEISPGATN
LIVK_SALTY      AKGGIKGDKLVGVEYDDACDPKQAVAVANKIVN-DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATN
LIVK_SALTI      AKGGIKGDKLVGVEYDDACDPKQAVAVANKIVN-DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATN
LIVB2_BRUAB     AKGGMNGEQITLVYGDDAADPKQGISVANKFVG-DGVKFVIGHFNSGVSIPTSDIYAENGVLMIAPG---
LIVB2_BRUA2     AKGGMNGEQITLVYGDDAADPKQGISVANKFVG-DGVKFVIGHFNSGVSIPTSDIYAENGVLMIAPG---
LIVK_ECOLI      AKGGIKGDKLVGVEYDDACDPKQAVAVANKIVN-DGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATN
LIVJ_CITFR      AKGGVKGDKLVMVKYDDACDPKQXXXXXXXXXX-DGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATA
LIVJ_ECOLI      AKGGIKGNKLQIVKYDDACDPKQXXXXXXXXXX-DGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATA
LIVJ_ECOL6      AKGGIKGNKLQIVKYDDACDPKQXXXXXXXXXX-DGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATA
LIVJ_ECO57      AKGGIKGNKLQIVKYDDACDPKQXXXXXXXXXX-DGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATA
LIVJ_SALTY      AKGGIKGDKLVAVKYDDACDPKQXXXXXXXXXX-DGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATA
LIVB5_BRUSU     AAGGVKGKKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMVQGGGAS
LIVB5_BRUME     AAGGVKGKKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMVQGGGAS
LIVB5_BRUAB     AAGGVKGKKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMVQGGGAS
LIVB5_BRUA2     AAGGVKGKKLALKIYDNQSNVNLSVRQYTQLVTTDKVNFLLGPFASNFALADSVISEKYRIPMVQGGGAS
LIVB7_BRUAB     AKGGVQGEKIVL-VRGDAVDNNQAIGEARRLISVENVAGIFGSFSSGRAVAASQVSELAGVPYFELGAVA
LIVB7_BRUA2     AKGGVQGEKIVL-VRGDAVDNNQAIGEARRLISVENVAGIFGSFSSGRAVAASQVSELAGVPYFELGAVA
LIVB7_BRUSU     AKGGVQGEKIVL-VRGDAVDNNQAIGEARRLISVENVAGIFGTFSSGRAVAASQVSELAGVPYFELGAVA
LIVB7_BRUME     AKGGVQGEKIVL-VRGDAVDNNQAIGEARRLISVENVAGIFGSFSSGRAVAASQVSELAGLPYFELGAVA
LIVB8_BRUME     AAGGIKGEKVVLERGD-AVDNNQATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYFEMGAVA
LIVB8_BRUSU     AAGGIKGEKVVLERGD-AVDNNQATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYFEMGAVA
LIVB8_BRUAB     AAGGIKGEKVVLERGD-AVDNNQATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYFEMGAVA
LIVB8_BRUA2     AAGGIKGEKVVLERGD-AVDNNQATGEARRLISLVGVKAIFGTYSSARVIAASQVSELAGIPYFEMGAVA
Y1266_METJA     KYFEEKGMKVKLYVEDTRADPNICLQKVQALHAQG-ITFFLGPMASGEVKNIKGFINSNKIVIISPSSTA
GLR23_ARATH     --------RLVVNVGDSKSDVVGAAIAALDLIKNKQVKAILGPWTSMQAHFLIEIGQKSRVPIVSYSATS
GLR22_ARATH     --------RLVVNVGDSKNDVVGAATAAIDLIKNKQVKAILGPWTSMQAHFLIEIGQKSRVPVVSYSATS
GLR25_ARATH     --------RIVLNVRDSKQTVVGAAASALYLIKKREVVAIIGPGTSMQAPFLINLGNQSKVPIISFSATS
GLR26_ARATH     --------RIVLNIRDSKRTVVGAAASALYLIKKREVVAIIGPGNSMQAPFLINLGNQSQVPIISFSASS
GLR35_ARATH     ADQSILGTKLNIVFQDTNCSGFVGTMGALQLM-ENKVVAAIGPQSSGIGHIISHVANELHVPFLSFAAT-
GLR34_ARATH     ADQSVL-KGIKLNIIFQDSNCSGFIGTMGALLMENKVVAAIGPQSSGIAHMISYVANELHVPLLSFGAT-
GLR21_ARATH     -------------VVDSKNDVVTXXXXXLDLITNKEVKAILGPWTSMQAQFMIEMGQKSQVPIVTYSATS


                         +         .         .         .         .         *         .:210
query           LEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGG
LIVB3_BRUME     PDLTA-----RGLENVFRTCGRDGQQAEVMADYVLKNMKDKK-VAVIHDKGAYGKGLADAFKAAINKGGI
BRAC_PSEAE      PEIT-----SRGYKLIFRTIGLDNMQGPVAGKFIAERYKDKTIAVLHDKQQ-YGEGIATEVKKTVEDAGI
LIVB3_BRUSU     PDLTA-----RGLENVFRTCGRDDQQAEVMADYVLKNMKDKK-VAVIHDKGAYGKGLADAFKAAINKGGI
LIVB1_BRUAB     PQYTEQGNT-------FRTCGRDDQQGTVAGQYIFDHFKAKIAVIH--DKTPYGQGLADETKKKLNELGT
LIVB1_BRUA2     PQYTEQGNT-------FRTCGRDDQQGTVAGQYIFDHFKAKIAVIH--DKTPYGQGLADETKKKLNELGT
LIVB2_BRUME     ---TTNPTTERELWNTFRTCRRDDKQGIVAGKYMADNYKGKVAILH--DKTPYGQGLADETKKSLNENGM
LIVB1_BRUSU     PQYTEQGNT-------FRTCGRDDQQGTVAGQYIFDHFKAKIAVIH--DKTPYGQGLADETKKKLNELGT
LIVB2_BRUSU     ---TTNPTTERELWNTFRTCRRDDKQGIVAGKYMADNYKGKVAILH--DKTPYGQGLADETKKSLNENGM
LIVB1_BRUME     PQYTEQGNT-------FRTCGRDDQQGTVAGQYIFDHFKAKIAVVH--DKTPYGQGLADETKKKLNELGT
LIVK_SALTY      PELT-----QRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQ-YGEGLARSVQDGLKQGNA
LIVK_SALTI      PELT-----QRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQ-YGEGLARSVQDGLKQGNA
LIVB2_BRUAB     ---TTNPTTERELWNTFRTCRRDDKQGIVPGKYMADNYKGKVAILH--DKTPYGQGLADETKKKLNELGT
LIVB2_BRUA2     ---TTNPTTERELWNTFRTCRRDDKQGIVPGKYMADNYKGKVAILH--DKTPYGQGLADETKKKLNELGT
LIVK_ECOLI      PELT-----QRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQ-YGEGLARSVQDGLKAANA
LIVJ_CITFR      PELTA-----RGYNLVLRTTGLDSDQGPTAAKYIVEKVKPKRIAIVHDKQQ-YGEGLARSVQDNLKKANA
LIVJ_ECOLI      PELTA-------RGYILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQ-YGEGLARAVQDGLKKGNA
LIVJ_ECOL6      PELTA-------RGYILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQ-YGEGLARAVQDGLKKGNA
LIVJ_ECO57      PELTA-------RGYILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQ-YGEGLARAVQDGLKKGNA
LIVJ_SALTY      PELTA-------RGYVLRTTGLDSDQGPTAAKYILEKVKPQRIAIIHDKQQ-YGEGLARAVQDGLKKGGV
LIVB5_BRUSU     DEI-YSRNFK----YIFGTLAASNYFGSTVEMLKGLDPKTNVALVYADDDISVADGTRKLLKDA----GF
LIVB5_BRUME     DEI-YSRNFK----YIFGTLAASNYFGSTVEMLKGLDPKTNVALVYADDDVSVADGTRKLLKDA----GF
LIVB5_BRUAB     DEI-YSRNFK----YIFGTLAASNYFGSTVEMLKGLDPKTNVALVYADDDVSVADGTRKLLKDA----GF
LIVB5_BRUA2     DEI-YSRNFK----YIFGTLAASNYFGSTVEMLKGLDPKTNVALVYADDDVSVADGTRKLLKDA----GF
LIVB7_BRUAB     DEITDRENVYRANPYAFAQMIVEMLQKKIAPKLGRDSKDLKIAVIYED--SSYGTSVAK-HEETFLKEAG
LIVB7_BRUA2     DEITDRENVYRANPYAFAQMIVEMLQKKIAPKLGRDSKDLKIAVIYED--SSYGTSVAK-HEETFLKEAG
LIVB7_BRUSU     DEITDRENVYRANPYAFAQMIVEMLQKKIAPKLGKDSKDLKIAVIYED--SSYGTSVAK-HEETFLKEAG
LIVB7_BRUME     DEITDRENVYRANPYAFAQMIVEMLQKKIAPKLGRDSKDLKIAVIYED--SSYGTSVAK-HEETFLKEAG
LIVB8_BRUME     DEV-----TGRGLQYLFRTDSVDMLIKGIAPGLGKDPKDMKIGIIYED--SSYGTSVAGHQEDNAKAAGL
LIVB8_BRUSU     DEV-----TGRGLQYLFRTDSVDMLIKGIAPGLGKDPKDMKIGIIYED--SSYGTSVAGHQEDNAKAAGL
LIVB8_BRUAB     DEV-----TGRGLQYLFRTDSVDMLIKGIAPGLGKDPKDMKIGIIYED--SSYGTSVAGHQEDNAKAAGL
LIVB8_BRUA2     DEV-----TGRGLQYLFRTDSVDMLIKGIAPGLGKDPKDMKIGIIYED--SSYGTSVAGHQEDNAKAAGL
Y1266_METJA     PPQMLGFRTPEEKKYVFRFVPTDNFQGNAIGDVA-KQLGLKN-VIVIYRKDAWGDGLERATVEKLKANGI
GLR23_ARATH     ------PILTSLRSYFLRATYEDSFQVQPIKAIIKLFGWREVVPVYIDN--TFGEGIMPRLTDALQDINV
GLR22_ARATH     ------PSLTSLRSYFFRATYEDSSQVHAIKAIIKLFGWREVVPVYIDN--TFGEGIMPRLTDSLQDINV
GLR25_ARATH     ------PLLDSLRSYFIRATHDDSSQVQAISAIIESFRWREVVPIYVDNE--FGEGILPNLVDAFQEINV
GLR26_ARATH     ------PVLDSLRSYFIRATHDDSSQVHAISAIIESFRWREVVPIYADNE--FGEGILPYLVDAFQEINV
GLR35_ARATH     -----DPTLSSLQPYFLRTTQNDYFQMNAITDFVSYFRWREVVAIFVDDE--YGRNGISVLGDALAKKRA
GLR34_ARATH     -----DPTLSSLQPYFLRTTQNDYFQMHAIADFLSYSGWRQVIAIFVDDE--------------------
GLR21_ARATH     ------PSLASIRQYFFRATYDDSSQVHAIKEIIKLFGWREVAPVYVDD--TFGEGIMPRLTDVLQEINV


                         .         .         .         +         .         .         .:280
query           KIVGEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIA
LIVB3_BRUME     TEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAI-
BRAC_PSEAE      KVAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITAIA
LIVB3_BRUSU     TEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAI-
LIVB1_BRUAB     KETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASIA
LIVB1_BRUA2     KETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASIA
LIVB2_BRUME     KETLYEGVNQGDKDFSALISKMKAAGITAVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASIA
LIVB1_BRUSU     KETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASIA
LIVB2_BRUSU     KETLYEGVNQGDKDFSALISKMKAAGITAVYWGGMHPEAGLLIRQMADQGLKAQFISGDGIVSNELASIA
LIVB1_BRUME     KETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASIA
LIVK_SALTY      NIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQMLRQARANGLKTQFMGPEGVGNASLSNIA
LIVK_SALTI      NIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQMLRQARANGLKTQFMGPEGVGNASLSNIA
LIVB2_BRUAB     KETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASIA
LIVB2_BRUA2     KETLYEGVNVGEKDFSALIAKLKQAGVNVVYWGGLHPEAGLIIRQMADQGLKAQFISGDGIVSNELASIA
LIVK_ECOLI      NVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIA
LIVJ_CITFR      DVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIA
LIVJ_ECOLI      NVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIA
LIVJ_ECOL6      NVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIA
LIVJ_ECO57      NVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIA
LIVJ_SALTY      NVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQSRAAGLKTQFMGPEGVANVSLSNIA
LIVB5_BRUSU     TIAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAVGVPALGKDANYAFGMTAWL
LIVB5_BRUME     TIAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAVGVPALGKDANYAFGMTAWL
LIVB5_BRUAB     TIAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAVGVPALGKDANYAFGMTAWL
LIVB5_BRUA2     TIAADEKFATNSTDFTSLISQIKSKNVDAVLVAGHETEVLNFVRQSKSLAVGVPALGKDANYAFGMTAWL
LIVB7_BRUAB     NMVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAIAGGGYSLQPTADAV
LIVB7_BRUA2     NMVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAIAGGGYSLQPTADAV
LIVB7_BRUSU     NMVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAIAGGGYSLQPTADAV
LIVB7_BRUME     NMVLSQSYPGNTVDMSSLVLDLKSAGADVVLQTSYQSDSVLFLQQANEGGYKPSAIAGGGYSLQPTADAV
LIVB8_BRUME     TVVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYPLAIIGGGGGYSMQPTADA
LIVB8_BRUSU     TVVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYPLAIIGGGGGYSMQPTADA
LIVB8_BRUAB     TVVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYPLAIIGGGGGYSMQPTADA
LIVB8_BRUA2     TVVLKSGYPSNTVDMSSLVLELREKGADVVMQTSYQNDSVLFLQQANEAGYPLAIIGGGGGYSMQPTADA
Y1266_METJA     NIIDEIPYDPNIGDWQTTTNKIAGKGNDTGVIFIGYEEVATLLSQIDDNSLKHVWIGCDGTNSKKVLEEA
GLR23_ARATH     RIPYRSAINATDHEISVELLKMMNMPTRVFLVHMYYDLASRFFIKAKELGLMEPILTNGVIDDLSLINET
GLR22_ARATH     RIPYRSVLNATDQDISVELLKMMNMPTRVFIVHMSSSLASTVFIKAKELGLMKPILTNGVMDGLRSINET
GLR25_ARATH     RIRYRSAISYSDDQIKKELYKLMTMPTRVFIVHMLPDLGSRLFSIAKEIDM---LSKGYVWGIADLMSIM
GLR26_ARATH     RIRYRSAISVHSTDVKKELYKLMTMPTRVFIVHMLPDLGSRLFSIAKEIGMMTK---GYVWGIADQMSVM
GLR35_ARATH     KISYKAAFPP------------------------------------------------------------
GLR34_ARATH     ----------------------------------------------------------------------
GLR21_ARATH     RIPYRTVISPNDDEISVELLRMMTLPTRVFVVHLVELLASRFFAKATEIGL-------------------


                         .         *         .         .         .         .         +:350
query           GGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEA
LIVB3_BRUME     GGTNAQGTLFTNAKDATK-NPAAKDAIQALKAK--NIPEAFTMNAYAAVEVIKAGIERAGSTDDSAVAKA
BRAC_PSEAE      GDA--SEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAGEADPEKVAEA
LIVB3_BRUSU     GGTNAQGTLFTNAKDATK-NPAAKDAIQALKAK--NIPEAFTMNAYAAVEVIKAGIERAGSTDDSAVAKA
LIVB1_BRUAB     GDAGVMNTFGPDPRDDKANAELIKAFRDK-----GFEPEAYTLXXXXXXXXXXXXXXXXGSNDPQEVAKA
LIVB1_BRUA2     GDAGVMNTFGPDPRDDKANAELIKAFRDK-----GFEPEAYTLXXXXXXXXXXXXXXXXGSNDPQEVAKA
LIVB2_BRUME     GDAGVMNTFGPDPRDDKANAELIKAFRDK-----GFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATA
LIVB1_BRUSU     GPAVEGT--LNTFGPDPRNNPDNAELVKKFR-DAGFEPEAYTLXXXXXXXXXXXXXXXXGSNDPQEVAKA
LIVB2_BRUSU     GDAGVMNTFGPDPRDDKANAELIKAFRDK-----GFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATA
LIVB1_BRUME     GPAVEGT--LNTFGPDPRNNPDNAELVKKFR-DAGFEPEAYTLXXXXXXXXXXXXXXXXGSNDPQEVAKA
LIVK_SALTY      GGAAEGMLVTMPKRYDQ--DPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHAPDLVKDL
LIVK_SALTI      GGAAEGMLVTMPKRYDQ--DPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHAPDLVKDL
LIVB2_BRUAB     GPAVEGT--LNTFGPDPRNNPDNAELVKKFR-DAGFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATA
LIVB2_BRUA2     GPAVEGT--LNTFGPDPRNNPDNAELVKKFR-DAGFEPEAYTFYAYAGVQSLVNAANAAGSNDPMEVATA
LIVK_ECOLI      GDAAEGMLVTMPKRYDQ--DPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKD
LIVJ_CITFR      GESA--EGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKY
LIVJ_ECOLI      GESA--EGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKY
LIVJ_ECOL6      GESA--EGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKY
LIVJ_ECO57      GESA--EGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKY
LIVJ_SALTY      GESA--EGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNHSDD--PAEIAKY
LIVB5_BRUSU     PSADLKDRWFG----------DAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDA
LIVB5_BRUME     PSADLKDRWFG----------DAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDA
LIVB5_BRUAB     PSADLKDRWFG----------DAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDA
LIVB5_BRUA2     PSADLKDRWFG----------DAAKFETEYKARFNYEPDYHAASGASDVEAFAEAIEKANSLDPQKVRDA
LIVB7_BRUAB     GHDVIEAAYFTQFAVNTSFTPGLEEFVEAYKKKYGETPRSYSLTNYVGAKVILEALNKVKGFDAAAVKQA
LIVB7_BRUA2     GHDVIEAAYFTQFAVNTSFTPGLEEFVEAYKKKYGETPRSYSLTNYVGAKVILEALNKVKGFDAAAVKQA
LIVB7_BRUSU     GHDVIEAAYFTQFAVNTSFTPGLEEFVEAYKKKYGETPRSGHSLNYVGAKVILEALNKVKGFDAAAVKQA
LIVB7_BRUME     GHDVIEAAYFTQFAVNTSFTPGLEEFVEAYKKKYGETPRSGHSLNYVGAKVILEALNKVKGFDAAAVKQA
LIVB8_BRUME     VGHDLIDGVFDADYTNTSATPGLTEFVEAYKAKYGSQPRSGHSLNYVGAKAIFQALNAGEGFEPDQIVSA
LIVB8_BRUSU     VGHDLIDGVFDADYTNTSATPGLTEFVEAYKAKYGSQPRSGHSLNYVGAKAIFQALNAGEGFEPDQIVSA
LIVB8_BRUAB     VGHDLIDGVFDADYTNTSATPGLTEFVEAYKAKYGSQPRSGHSLNYVGAKAIFQALNAGEGFEPDQIVSA
LIVB8_BRUA2     VGHDLIDGVFDADYTNTSATPGLTEFVEAYKAKYGSQPRSGHSLNYVGAKAIFQALNAGEGFEPDQIVSA
Y1266_METJA     KNKAVKVKLYSTMFQSETDEAE--KIKEEFKKRGYGEPDQYALNVYDAAISYAEMLKYDADLLSKLIKEN
GLR23_ARATH     AVEAMEGVLGIKTYIPK--SPDLEKFRSRWRSLFPRVESVYGLWAYDATTALAVAIEETNNMTFSKVVDT
GLR22_ARATH     GIEAMEGVLGIKTYIPKSKD--LETFRSRWKRRFPQMENVYGLWAYDATTALAMAIE-------------
GLR25_ARATH     GESSLVNMHVKTYFAKSK---ELLHLEARWQKRFGEELNNFACWAYDAATALAMSVE-------------
GLR26_ARATH     GESSLENTYFSR-------SKELMYLETRWRKRFGEELNNFECWGYDTATALAMSIE-------------
GLR35_ARATH     ----------------------------------------------------------------------
GLR34_ARATH     ----------------------------------------------------------------------
GLR21_ARATH     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LANAKDVQAITGKLSFDENHNPIKGAVILEMKDGKQVYKTYVQx
LIVB3_BRUME     LHDGKPIETAIGTLTYSETGDLSSPSFIFKWDDGKIV-------
BRAC_PSEAE      L-RANTFETPTGNLGFDE--------------------------
LIVB3_BRUSU     LHDGKPIETAIGTLTYSETGDLSSPSFIFKWDDGKIV-------
LIVB1_BRUAB     MKEKGPFKTVLGDLSYDEKGDPLPGYVMYKWEKGADGKYNYIQ-
LIVB1_BRUA2     MKEKGPFKTVLGDLSYDEKGDPLPGYVMYKWEKGADGKYNYIQ-
LIVB2_BRUME     MKEKGPFKTVLGDISFDAKGDPLSPYVMFEWRKGEDGKYNYFQ-
LIVB1_BRUSU     MKEKGPFKTVLGDLSYDEKGDPLPGYVMYKWEKGADGKYNYIQ-
LIVB2_BRUSU     MKEKGPFKTVLGDISFDAKGDPLSPYVMFEWRKGEDGKYNYFQ-
LIVB1_BRUME     MKEKGPFKTVLGDLSYDEKGDPLPGYVMYKWEKGADGKYNYIQ-
LIVK_SALTY      KANGAD--TVIGPLKWDE--------------------------
LIVK_SALTI      KANGAD--TVIGPLKWDE--------------------------
LIVB2_BRUAB     MKEKGPFKTVLGDISFDAKGDPLSPYVMFEWRKGEDGKYNYFQ-
LIVB2_BRUA2     MKEKGPFKTVLGDISFDAKGDPLSPYVMFEWRKGEDGKYNYFQ-
LIVK_ECOLI      L-KANGANTVIGPLNWDE--------------------------
LIVJ_CITFR      L-KANSVETVMGPLSWD---------------------------
LIVJ_ECOLI      L-KANSVDTVMGPLTWDE--------------------------
LIVJ_ECOL6      L-KANSVDTVMGPLTWDE--------------------------
LIVJ_ECO57      L-KANSVDTVMGPLTWDE--------------------------
LIVJ_SALTY      LKGA-TVDTVMGPLSWDE--------------------------
LIVB5_BRUSU     LASIK-FDSLYGPIAFDKQGQINLPQIVVQVQDGKLV-------
LIVB5_BRUME     LASIK-FDSLYGPIAFDKQGQINLPQIVVQVQDGKLV-------
LIVB5_BRUAB     LASIK-FDSLYGPIAFDKQGQINLPQIVVQVQDGKLV-------
LIVB5_BRUA2     LASIK-FDSLYGPIAFDKQGQINLPQIVVQVQDGKLV-------
LIVB7_BRUAB     L-SAVDIEA--GKFKFDQNNQNERASMMMQWQDGKLV-------
LIVB7_BRUA2     L-SAVDIEA--GKFKFDQNNQNERASMMMQWQDGKLV-------
LIVB7_BRUSU     L-SAVDIEA--GKFKFDQNNQNERASMMMQWQDGKLV-------
LIVB7_BRUME     L-SAVDIEA--GKFKFDQNNQNERASMMMQWQDGKLV-------
LIVB8_BRUME     VLDIPDGQAAAGGVKFGKNNQNERATMMMQWQDGKLV-------
LIVB8_BRUSU     VLDIPDGQTAAGGVKFGKNNQNERATMMMQWQDGKLV-------
LIVB8_BRUAB     VLDIPDGQTAAGGVKFGKNNQNERATMMMQWQDGKLV-------
LIVB8_BRUA2     VLDIPDGQTAAGGVKFGKNNQNERATMMMQWQDGKLV-------
Y1266_METJA     TVKYSEVKSVTGYIKLNEWNDRASG-------------------
GLR23_ARATH     GRNVSELEAL----------------------------------
GLR22_ARATH     --------------------------------------------
GLR25_ARATH     --------------------------------------------
GLR26_ARATH     --------------------------------------------
GLR35_ARATH     --------------------------------------------
GLR34_ARATH     --------------------------------------------
GLR21_ARATH     --------------------------------------------