[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50761.1

[Show Plain Result]


## Summary of Sequence Search
    1::227
   49::215     4e-31  43%  646 aa  T3MO_BPP1 RecName: Full=Type III restriction-modification system
   49::215     2e-29  41%  645 aa  T3MO_ECOLX RecName: Full=Type III restriction-modification system
   35::225     1e-25  38%  652 aa  T3MO_SALTY RecName: Full=Type III restriction-modification system
  120::211     4e-17  53%  629 aa  T3MH_HAEIN RecName: Full=Putative type III restriction-modification
   35::137     4e-13  41%  417 aa  MTK1_KLEPN RecName: Full=Modification methylase KpnI;       
    3::97      1e-05  35%  273 aa  MT1B_MORBO RecName: Full=Modification methylase MboIB;       
    1::227

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYREDGSPIIEQAIDFDVLRQELSSVLVEGPAERYQFT
T3MO_BPP1       -----------------------------------------------------------VELSKESYSLN
T3MO_ECOLX      -----------------------------------------------------------VELSKESYSLN
T3MO_SALTY      ---------------------------------YNEQGELIAKGGFDLARFERALKARNIDELTSGYQID
T3MH_HAEIN      ----------------------------------------------------------------------
MTK1_KLEPN      ----------------------------------------------------------------------
MT1B_MORBO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WPDKRKSILLANAPIAKTLRPYREESVDFDNTENLYIEGDNLDALKLLQETYLGKVKMIYIDPPYNTGND
T3MO_BPP1       WLGKSYARLLANLPPKTLLAEDKNQQEENKNSQNLLIKGDNLEVLKHMVNAYAEKVNMIYIDPPYNTGKD
T3MO_ECOLX      WLGKSYARLLANLPPKTLLAEDKNQQEENKNSQHLLIKGDNLEVLKHMVNAYAEKVKMIYIDPPYNTGKD
T3MO_SALTY      FIGKDYAKKQAGEKSVTVIVPDVEHNTENKNSHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSD
T3MH_HAEIN      --------------------------------ENLIIKGNNLIALHSLAKQFKGKVKLIYIDPPYNTGND
MTK1_KLEPN      -----------------------------DSTSSSIYIGDNLTYLQGLSKTSPKTIDFCYIDPPYNTGNK
MT1B_MORBO      ------------------IKPYFESD---DKNFNIY-QGNCIDFMSHFQDN---SIDMIFADPPYFLSND


                         +         .         .         .         .         *         .:210
query           FIYEDDFAQDADEYLANSGQYDENGNRLVQNTESNGRFHTDWLNMIYPRLKLAKDLLTEDGAIFISIDDN
T3MO_BPP1       FVYNDDRKFTPEQLSELAGIELDEANRILEFTTKGSSSHSAWLTFIYPRLYIARELLKEDGVIFISIDDN
T3MO_ECOLX      FVYNDDRKFTPEQLSELAGIDLDQAKRILEFTTKGSSSHSAWLTFIYPRLYIARELMREDGTIFISIDHN
T3MO_SALTY      FVYPDHF-EYSDRALQD--MFGLNDTELARLKSIQGKTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDN
T3MH_HAEIN      FKYNDKFN------------------------------HSTWLTFMKNRLEIAKTLLADDGVIFVQCDDI
MTK1_KLEPN      IIYHD--------------------NRKSVSSDIFG-LHNEWMSFLLPRLFHAHKMLKDTGIIAISIDDY
MT1B_MORBO      LTFKNSIIQS-----VNKGEWDKN-----DNEASIYNFNHEWIAQ-------ARQLLKDNGTIWIS----


                         .         .         .         +         .         .         .:280
query           EVENLNLKSESSFxxxx
T3MO_BPP1       EDKQLGLLCDEVF----
T3MO_ECOLX      EFSQLKLVCDEIF----
T3MO_SALTY      EYANLKLMMDEIF----
T3MH_HAEIN      EQAYLKILMDDIF----
MTK1_KLEPN      EFAHLKILMDKIF----
MT1B_MORBO      -----------------