[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50766.1

[Show Plain Result]


## Summary of Sequence Search
    1::80
  106::182     3e-05  36%  182 aa  YCBK_SHIFL RecName: Full=Uncharacterized protein ycbK;Flags:
  106::182     3e-05  36%  182 aa  YCBK_ECOLI RecName: Full=Uncharacterized protein ycbK;Flags:
  106::182     3e-05  36%  182 aa  YCBK_ECOL6 RecName: Full=Uncharacterized protein ycbK;Flags:
  106::182     3e-05  36%  182 aa  YCBK_ECO57 RecName: Full=Uncharacterized protein ycbK;Flags:
    1::80

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxKLASNYRCPPHNRAVGGAVNSLHLKGMAADIRVLEMTAKEITHLAEKAGFDGIGLYPSQCFVHVD
YCBK_SHIFL      -----QLISGYRSIDTNRSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHID
YCBK_ECOLI      -----QLISGYRSIDTNRSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHID
YCBK_ECOL6      -----QLISGYRSIDTNRSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHID
YCBK_ECO57      -----QLISGYRSIDTNRSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHID


                         .         .         *         .         .         .         .:140
query           VRGYCARWxx
YCBK_SHIFL      T-GPARHW--
YCBK_ECOLI      T-GPARHW--
YCBK_ECOL6      T-GPARHW--
YCBK_ECO57      T-GPARHW--