[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50796.1

[Show Plain Result]


## Summary of Sequence Search
    1::200
    5::189     2e-32  38%  189 aa  RPOE_HAEIN RecName: Full=RNA polymerase sigma-E factor;AltName:
    5::185     2e-32  40%  191 aa  RPOE_SHIFL RecName: Full=RNA polymerase sigma-E factor;AltName:
    5::185     2e-32  40%  191 aa  RPOE_ECOLI RecName: Full=RNA polymerase sigma-E factor;AltName:
    5::185     2e-32  40%  191 aa  RPOE_ECOL6 RecName: Full=RNA polymerase sigma-E factor;AltName:
    5::185     2e-32  40%  191 aa  RPOE_ECO57 RecName: Full=RNA polymerase sigma-E factor;AltName:
    5::185     5e-32  39%  191 aa  RPOE_SALTY RecName: Full=RNA polymerase sigma-E factor;AltName:
    5::185     5e-32  39%  191 aa  RPOE_SALTI RecName: Full=RNA polymerase sigma-E factor;AltName:
    6::186     3e-30  35%  193 aa  RPSH_PSEAE RecName: Full=RNA polymerase sigma-H factor;AltName:
    9::184     8e-30  37%  187 aa  SIGW_BACSU RecName: Full=RNA polymerase sigma factor sigW;AltName:
    4::169     5e-22  36%  173 aa  YLAC_BACSU RecName: Full=RNA polymerase sigma factor ylaC;
    4::177     1e-18  33%  186 aa  NCCH_ALCXX RecName: Full=RNA polymerase sigma factor nccH;
   20::189     2e-16  32%  400 aa  RFAY_XANCP RecName: Full=Probable RNA polymerase sigma factor rfaY;
   24::182     9e-15  31%  216 aa  RPOE_MYCTU RecName: Full=RNA polymerase sigma-E factor;AltName:
   24::182     9e-15  31%  216 aa  RPOE_MYCBO RecName: Full=RNA polymerase sigma-E factor;AltName:
    3::163     3e-13  27%  194 aa  SIGX_BACSU RecName: Full=RNA polymerase sigma factor sigX;
   18::163     7e-13  31%  166 aa  SIGV_BACSU RecName: Full=RNA polymerase sigma factor sigV;
   20::167     2e-12  30%  185 aa  RPSC_MYCTU RecName: Full=Probable RNA polymerase sigma-C factor;
   20::167     2e-12  30%  185 aa  RPSC_MYCBO RecName: Full=Probable RNA polymerase sigma-C factor;
   34::194     7e-12  32%  194 aa  Y1459_HAEIN RecName: Full=Probable RNA polymerase sigma factor
    4::152     1e-11  30%  176 aa  SIGZ_BACSU RecName: Full=RNA polymerase sigma factor sigZ;
    7::190     2e-11  25%  191 aa  CNRH_RALME RecName: Full=RNA polymerase sigma factor cnrH;
    4::153     3e-11  27%  163 aa  SIGM_BACSU RecName: Full=RNA polymerase sigma factor sigM;
    1::156     4e-10  25%  174 aa  CARQ_MYXXA RecName: Full=RNA polymerase sigma factor carQ;
    5::174     7e-10  27%  178 aa  SIGY_BACSU RecName: Full=RNA polymerase sigma factor sigY;
   43::180     9e-10  28%  184 aa  HRPL_PSESY RecName: Full=RNA polymerase sigma factor hrpL;
    4::146     2e-09  30%  179 aa  RPOE_STRAW RecName: Full=RNA polymerase sigma-E factor;
    2::146     3e-09  30%  177 aa  RPOE_STRCO RecName: Full=RNA polymerase sigma-E factor;
   18::213     1e-08  25%  218 aa  RPSH_BACSU RecName: Full=RNA polymerase sigma-H factor;AltName:
   23::218     2e-08  26%  223 aa  RPSH_BACLI RecName: Full=RNA polymerase sigma-H factor;AltName:
   13::160     2e-08  28%  173 aa  FECI_ECOLI RecName: Full=Probable RNA polymerase sigma factor fecI;
    3::146     5e-08  26%  180 aa  RPOE_STRAT RecName: Full=RNA polymerase sigma-E factor;
   19::187     2e-07  22%  193 aa  SIGK_MYCSS RecName: Full=RNA polymerase sigma factor sigK;AltName:
   19::187     2e-07  22%  193 aa  SIGK_MYCSK RecName: Full=RNA polymerase sigma factor sigK;AltName:
   19::187     2e-07  22%  193 aa  SIGK_MYCSJ RecName: Full=RNA polymerase sigma factor sigK;AltName:
   23::191     2e-06  23%  196 aa  SIGK_MYCVP RecName: Full=RNA polymerase sigma factor sigK;AltName:
   22::181     2e-06  22%  187 aa  SIGK_MYCTU RecName: Full=RNA polymerase sigma factor sigK;AltName:
   22::181     2e-06  22%  187 aa  SIGK_MYCTA RecName: Full=RNA polymerase sigma factor sigK;AltName:
   22::181     2e-06  22%  187 aa  SIGK_MYCBP RecName: Full=RNA polymerase sigma factor sigK;AltName:
   22::181     2e-06  22%  187 aa  SIGK_MYCBO RecName: Full=RNA polymerase sigma factor sigK;AltName:
   14::181     8e-06  21%  187 aa  SIGK_MYCUA RecName: Full=RNA polymerase sigma factor sigK;AltName:
   16::262     2e-05  29%  262 aa  RPSB_BACSU RecName: Full=RNA polymerase sigma-B factor;AltName:
  138::228     3e-05  33%  399 aa  RPOD_THEMA RecName: Full=RNA polymerase sigma factor rpoD;       
  102::153     4e-04  31%  169 aa  PCF_BACSU RecName: Full=Positive control factor;
    1::200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xPLEDQLLVERSKKGDREAFEHLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQALPNFRGDSSFS
RPOE_HAEIN      --LTDQALVERVQQGDKKAFNLLVSRYQNKVAGLLTRYVSRN-DIPDVVQESFIKAYRSIESFRGESAFY
RPOE_SHIFL      --LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPS-GDVPDVVQEAFIKAYRALDSFRGDSAFY
RPOE_ECOLI      --LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPS-GDVPDVVQEAFIKAYRALDSFRGDSAFY
RPOE_ECOL6      --LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPS-GDVPDVVQEAFIKAYRALDSFRGDSAFY
RPOE_ECO57      --LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPS-GDVPDVVQEAFIKAYRALDSFRGDSAFY
RPOE_SALTY      --LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPS-GDVPDVVQESFIKAYRALDSFRGDSAFY
RPOE_SALTI      --LTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPS-GDVPDVVQESFIKAYRALDSFRGDSAFY
RPSH_PSEAE      ---QDQQLVERVQRGDKRAFDLLVLKYQHKILGLIVRFVHXXXXXXXXXXXXFIKAYRALGNFRGDSAFY
SIGW_BACSU      --------IKQVKKGDQDAFADIVDIYKDKIYQLCYRMLGNVHEAEDIAQEAFIRAYVNIDSFDINRKFS
YLAC_BACSU      ----------------RDSIEDLYRQYYQEILNYLFRRTHHLETAKDLAQDTFVKALNGLASFRGHSSIR
NCCH_ALCXX      -PSVDEALARRAAQGDQYAFGQLVQRHGRALAQAARSFGVPESDVDDIVQDTFIAAWHALDDFDSDKLFR
RFAY_XANCP      --------------GCQQAYGRIVTACQNTVTAIALAITRDVAASEDIAQEAFLRAWQRLAQLHQPASFL
RPOE_MYCTU      ---------ELTARFERDAIPLLDQLYGG-----ALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLK
RPOE_MYCBO      ---------ELTARFERDAIPLLDQLYGG-----ALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLK
SIGX_BACSU      -----------------ETFQLLYDTYHQDLYQFLFYMVKDKNQTEDLLQEVYIRVLNSYHTFEGRSSEK
SIGV_BACSU      --------------------------HKQDFYRLAFSYVKNQDDALDIVQESIKKALSSVETVRNPETIK
RPSC_MYCTU      -------------KGNGRALEAFIKATQQDVWRVAY--LSDVGSADDLTQETFLRAIGAIPRFSARSSAR
RPSC_MYCBO      -------------KGNGRALEAFIKATQQDVWRVAY--LSDVGSADDLTQETFLRAIGAIPRFSARSSAR
Y1459_HAEIN     ------------------------------------QLQVNQADAEDLVQEAFLSAFKNLANFKRQSAFK
SIGZ_BACSU      --------------------EDLWDQFHQPLKTYISHRVNDQSIVDDLLQIVFMKIQVHLPNLIDEQKID
CNRH_RALME      ----DRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPEXXXXXXXXXXXXAAWHALDDFDPDRPFR
SIGM_BACSU      --------------------DEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSY-DHSKVK
CARQ_MYXXA      --------MERFRDGAQDAFEDLFARHAPRVQGFLARMVRNGALAEDLLQATFLSVIRSRGRYEPGTRFI
SIGY_BACSU      ---EEQRLIQQAKEGNDEAFTAXXXXXXXXXXXXXXXXXXHPDLSEELVQETFLKGYIHLRSFQGRSKFS
HRPL_PSESY      ----------------------------------------NADDVDDILQCVFLEALRNEHKFQHASKPQ
RPOE_STRAW      --------------GEVLEFEEYVRTRQDALLRSARRLVPDPVDAQDLLQTALVRTYGRWDGIADKRLAD
RPOE_STRCO      --------------GEVLEFEEYVRTRQDALLRSARRLVPDPVDAQDLLQTALARTYGRWETIEDKRLAD
RPSH_BACSU      --LEDEQVIEKVHVGDSDALDYLITKYRNFVRAKAYFLIG--ADREDIVQEGMIGLYKSIRDFKEDTSFK
RPSH_BACLI      --LEDEQVIEMVHVGDSDALDYLITKYRNFVRAKAYFLIG--ADREDIVQEGMIGLYKSIRDFREDTSFK
FECI_ECOLI      -------------------FESLYGTHHGWLKSWLTRKLQSAFDADDIAQDTFLRVMETLSTIRDPRSFC
RPOE_STRAT      -------------QGEVLEFEEIVRTRQDALLRTPPGLVPDPVDAQDLLQTALARTYGRWEGIADKRLAD
SIGK_MYCSS      ------VLLRQVAERDVDAFAALYDRTRSRVYGMVTRVLRDPGYSEETTQDIYLQVWRSAGSYDPKASPM
SIGK_MYCSK      ------VLLRQVAERDVDAFAALYDRTRSRVYGMVTRVLRDPGYSEETTQDIYLQVWRSAGSYDPKASPM
SIGK_MYCSJ      ------VLLRQVAERDVDAFAALYDRTRSRVYGMVTRVLRDPGYSEETTQDIYLQVWRSAGSYDPKASPM
SIGK_MYCVP      -------LLRQVAQRDAEAFAAFYDQTRARVYGLITRVLRDPGYSEETTQDVYLQVWRNAAGYDPSGSAL
SIGK_MYCTU      ---------------DQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFSAKGSAL
SIGK_MYCTA      ---------------DQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFSAKGSAL
SIGK_MYCBP      ---------------DQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFSAKGSAL
SIGK_MYCBO      ---------------DQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFSAKGSAL
SIGK_MYCUA      -------LLRQIARGERDAFAMFYDHTCTRVYGLVARVLRDAGYSEETTQEIYLEVWRTASDYDATKSPL
RPSB_BACSU      ----DRLISDYQTKQDEQAQETLVRVYTNLVDMLAKKYSKGKSFHEDLRQVGMIGLLGAIKRYKSFEAFA
RPOD_THEMA      -PAQERELARRAQMGDKKAKEKLITSNLRLVVSIAKRYMGRGLSFQDLIQEGNIGLLKAVEKFRKGYKFS
PCF_BACSU       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TWIYHITVNVCRDELRKRQRRPTVSLXXXXXXXXXXXTYEIRSNDPGPEEMLDRSETQAMIQACLNTLSD
RPOE_HAEIN      TWLYRIAVNTAKNYLTAQGRRPPNEDILAEDAENYDVGTHLRDVDTPENEMLS-SELERIVFDTIHNLPE
RPOE_SHIFL      TWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEIS-NPENLMLSEELRQIVFRTIESLPE
RPOE_ECOLI      TWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEIS-NPENLMLSEELRQIVFRTIESLPE
RPOE_ECOL6      TWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEIS-NPENLMLSEELRQIVFRTIESLPE
RPOE_ECO57      TWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEIS-NPENLMLSEELRQIVFRTIESLPE
RPOE_SALTY      TWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEIS-NPENLMLSEELRQIVFRTIESLPE
RPOE_SALTI      TWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEIS-NPENLMLSEELRQIVFRTIESLPE
RPSH_PSEAE      TWLYRIAINTAKNHLVARGRRPPDSDVTAEDAEFFEGDHALKDIE-SPERAMLRDEIEATVHQTIQQLPE
SIGW_BACSU      TWLYRIATNLTIDRIRK--KKPDYYLDAEVAGTEGLTMYQIVADGVLPEDAVVSLELSNTIQQKILKLPD
YLAC_BACSU      TWLYTIAHHTFINWYRRDVKYQFTEISKNEGLTQT--TYD------QPEQYLSRTVKSETLRQELLKLKD
NCCH_ALCXX      PWLFRIGLNKMRDLRRFRQVR------HFLFGAKDIEDAELTSDVPGPEREVSARLELAKIMQVLNRLDL
RFAY_XANCP      PWLRQITRNLARDWLRSHRHRP--------LSGEXXXXXXXXXXDPSPEQALQVEEERAALE-IMSALPN
RPOE_MYCTU      AWLYRILTNTYINSYRKKQRQPA------EYPTEQITDWQLASNAEHSSTGLRSAEVEALIKEALQALPE
RPOE_MYCBO      AWLYRILTNTYINSYRKKQRQPA------EYPTEQITDWQLASNAEHSSTGLRSAEVEALIKEALQALPE
SIGX_BACSU      TWLLSIARHVAIDWFRKQQ-----TIRQRILGTFDWDTQDVRDQQLLPDELAVQHENVREIYAALDQCTI
SIGV_BACSU      SWFYKILVRTAIDFLRKQKK--------------------IRVMDDETIEFLSKGKEDHYKDTDLHEALD
RPSC_MYCTU      TWLLAIARHVVADHIRHVRSRPRT------------------TRGARPEHLIDGDEDLVEVTTMIADLTT
RPSC_MYCBO      TWLLAIARHVVADHIRHVRSRPRT------------------TRGARPEHLIDGDEDLVEVTTMIADLTT
Y1459_HAEIN     TWIFAILKNKIIDYLRQKGRFVLESELEDENTNNSFFDEKGHSELQGEEETVYSDEFWLIFETCLNCLPA
SIGZ_BACSU      SWIYRITRNTIIDFYRTKKTSEILPDV-------------LHFNDSAEEENFTKEAT-VCIRSTIKRLPE
CNRH_RALME      AWLFRIGLNKMRDLYRFRRVRQF--LFGAENLGDLELAGGVANDEPGPEQQVAARLELARVASTLGKLDT
SIGM_BACSU      PWLFQVARNAFIDYVRKHKKEVTIS------DDLIGSLFQNAVQSPAHQV-----EIKEVLTGYMSELPD
CARQ_MYXXA      PWLMTIAANAARDALRHQRHVDAYA------------SREXXXXXXXXXXXXXXXXLRRHLLDALQQLHP
SIGY_BACSU      TWLISIASRLYLDHQKKRKR-------------------EWKRNQTVTEETIRKIKWDVSAKGAFSKLDP
HRPL_PSESY      TWLCGIALNLIRNHFRKMYRQPYQESWEDDVHTDLEWHGDITHQVDGHRQL-------ARVIEAIDCLPT
RPOE_STRAW      AYLRRVMINTRTERARKLEEVPTEQLPDA-------------SVDDSTEQHADR----ALLMDILKVLAP
RPOE_STRCO      AYLRRVMINTRTERARKLEEVPTEQLPESPM-------------DDATEQHADR----ALLMDVLKVLAP
RPSH_BACSU      AFAELCITRQIITAIKTATRQKHIPLNSYASLDKPIFDEESGAKTLNPEEMIINQEEFDDIEMKMGELLS
RPSH_BACLI      AFAELCITRQIITAIKTATRQKHIPLNSYVSLDKPIYDEESGAKVMNPEELIINQEEFDDIELKMGELLS
FECI_ECOLI      TIAKRVMVDLFRRNALEKAYLEMLALMP-------------EGGAPSPEERESQLETLQLLDSMLDGLNG
RPOE_STRAT      AYLRRVMINTRTERARKLEEVPTEQLP-----------------DARVEDSTEQHADRALLMDAMKVLAP
SIGK_MYCSS      AWLLTLAHRRAVDRVRSEEAASQ-----------RESRYGAASVDPPVDHVADSVDERRRVVDCMGSLSD
SIGK_MYCSK      AWLLTLAHRRAVDRVRSEEAASQ-----------RESRYGAASVDPPVDHVADSVDERRRVVDCMGSLSD
SIGK_MYCSJ      AWLLTLAHRRAVDRVRSEEAASQ-----------RESRYGAASVDPPVDHVADSVDERRRVVDCMGSLSD
SIGK_MYCVP      SWLLTLAHRRAVDRVRSEQAAST-----------RESRYGAISVDPPSDHXXXXXXXXXXXXGCLDSLTD
SIGK_MYCTU      AWLLTMAHRRAVDRVRCEQA-----------GNQREVRYGAANVDPASDVVADLADERRRVTECLKALTD
SIGK_MYCTA      AWLLTMAHRRAVDRVRCEQA-----------GNQREVRYGAANVDPASDVVADLADERRRVTECLKALTD
SIGK_MYCBP      AWLLTMAHRRAVDRVRCEQA-----------GNQREVRYGAANVDPASDVVADLADERRRVTECLKALTD
SIGK_MYCBO      AWLLTMAHRRAVDRVRCEQA-----------GNQREVRYGAANVDPASDVVADLADERRRVTECLKALTD
SIGK_MYCUA      AWLLTMAHRRAVDRVRAEQA-----------GSQRESRYGAANVDLASDVVADSADERRRVVECLDGLTD
RPSB_BACSU      TWSVHVPIKMAVDQLTETQRSPKVTMEMGKSYQALSVDHSIEADSDGSEDGYERVNQQLMLQSVLHVLSD
RPOD_THEMA      TWIRQAITRAIADQAR------------------------------------------------------
PCF_BACSU       -------------------------------------------------------EDRDRIREALALLTD


                         +         .         .         .         .         *         .:210
query           DYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQALKEKISKQMELIxxxxxxxx
RPOE_HAEIN      DLKTAITLRELEGLSYEDIAEIMDCPVGTVRSRIFRAREMIENKIQPLM-----------
RPOE_SHIFL      DLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKV---------------
RPOE_ECOLI      DLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKV---------------
RPOE_ECOL6      DLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKV---------------
RPOE_ECO57      DLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKV---------------
RPOE_SALTY      DLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKV---------------
RPOE_SALTI      DLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKV---------------
RPSH_PSEAE      DLRTALTLREFEGLSYEDIATVMQCPVGTVRSRIFRAREAIDKAL---------------
SIGW_BACSU      KYRTVIVLKYIDELSLIEIGEILNIPVGTVKTRIHRGREALRKQL---------------
YLAC_BACSU      QHQSVLILREFQELSYEEIAEILGWSLSKVNTTLHRARLELKKNMTKSRE----------
NCCH_ALCXX      ASREIIILTSFVGMSHPEAAMALGTSAKAVESRVARARAKL-------------------
RFAY_XANCP      DSREILLLYYREGQRSQQVASLLGLSDAAVRKRLSRARATVRNELLQRFD----------
RPOE_MYCTU      EFRMAVYYADVEGFPYKEIAEIMDTPIGTVMS----------------------------
RPOE_MYCBO      EFRMAVYYADVEGFPYKEIAEIMDTPIGTVMS----------------------------
SIGX_BACSU      DQRAVIILRFIQGYSIQETAKALRFSESKVKTTQHRGLKVLRK-----------------
SIGV_BACSU      EYKTIIILRFFEDLKLEEIAEITGENTNTVKTRLYRALKLMRIQLTKE------------
RPSC_MYCTU      DQREALLLTQLLGLSYADAAAVCGCPVGTIRSRV--------------------------
RPSC_MYCBO      DQREALLLTQLLGLSYADAAAVCGCPVGTIRSRV--------------------------
Y1459_HAEIN     KQAKIFMMREFLELSSEEICQEXXXXXXXXXXXXYRARLQLQNCLSKKL-----------
SIGZ_BACSU      KYREALELTDFQGLSQKELSEKLGISYSGAKSRVQRGRGKLKQ-----------------
CNRH_RALME      GSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADSE----------
SIGM_BACSU      NYREALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRLK------------------
CARQ_MYXXA      DHREAVVLSKVEGWSFEEIGALRGISPGAARLRAHR------------------------
SIGY_BACSU      KLRTPVLLRHYYGYTYAEIGVMLQIKEGTVKSRVHKGLQQIRKE----------------
HRPL_PSESY      NMQKVLEVSLEMDGNYQETANTLGVPIGTVRSRLSRARVQLKQQI---------------
RPOE_STRAW      KQRSVVVLRHWEQMSTEETAAALGMSAGTVKS----------------------------
RPOE_STRCO      KQRSVVVLRHWEQMSTEETAAALGMSAGTVKSTL--------------------------
RPSH_BACSU      DLERKVLVLYLDGRSYQEISDELNRHVKSIDNALQR----VKRKLEKYLEI---------
RPSH_BACLI      DLERKVLALYLDGRSYQEISEELNRHVKSIDNALQR----VKRKLEKYLEL---------
FECI_ECOLI      KTREAFLLSQLDGLTYSEIAHKLGVSISSVKKYVAKA-----------------------
RPOE_STRAT      KQRSVVVLRHWEQMSTEETAAALGMSAGTVKS----------------------------
SIGK_MYCSS      LQREAIQLAYYEGLTYVQVSERLSANLATIKSRMRGGIRGLK------------------
SIGK_MYCSK      LQREAIQLAYYEGLTYVQVSERLSANLATIKSRMRGGIRGLK------------------
SIGK_MYCSJ      LQREAIQLAYYEGLTYVQVSERLSANLATIKSRMRDGIRGLK------------------
SIGK_MYCVP      VQRECIQLAYYDGLTYAQVADRLAANLATIKSRMRDGIRALRK-----------------
SIGK_MYCTU      TQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLR------------------
SIGK_MYCTA      TQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLR------------------
SIGK_MYCBP      TQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLR------------------
SIGK_MYCBO      TQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLR------------------
SIGK_MYCUA      TQRQCIELAYYGGLTYAEVSQRLATNLSTIKSRMRDALRGLR------------------
RPSB_BACSU      REKQIIDLTYIQNKSQKETGDILGISQMHVSRLQRKAVKKLREALDPSMELM--------
RPOD_THEMA      ------------------------------------------------------------
PCF_BACSU       REKEMFLLHKVECFSYERIADLLGVKKSTVQTTIKRA-----------------------