[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50877.1

[Show Plain Result]


## Summary of Sequence Search
    1::233
    1::229     4e-94  67%  234 aa  PURQ_CARHZ RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::230     1e-90  63%  236 aa  PURQ_MOOTA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-81  60%  227 aa  PURQ_BACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::227     9e-81  60%  235 aa  PURQ_SALRD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-80  60%  227 aa  PURQ_BACCZ RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-80  60%  227 aa  PURQ_BACCQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACHK RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACC7 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACC2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACC1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACC0 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACAN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-80  60%  227 aa  PURQ_BACAA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     3e-80  60%  227 aa  PURQ_BACAH RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     7e-80  60%  227 aa  PURQ_BACWK RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-79  60%  227 aa  PURQ_BACCR RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-79  60%  227 aa  PURQ_BACCN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-79  60%  227 aa  PURQ_BACC4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     8e-79  61%  227 aa  PURQ_BACHD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::227     5e-78  57%  235 aa  PURQ_ACAM1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     2e-77  59%  227 aa  PURQ_LISMO RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::223     2e-77  59%  230 aa  PURQ_BREBN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     2e-77  59%  227 aa  PURQ_LISMH RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     3e-77  59%  228 aa  PURQ_GEOSW RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     3e-77  60%  226 aa  PURQ_ALKMQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     4e-77  58%  227 aa  PURQ_LISMF RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     4e-77  58%  227 aa  PURQ_LISMC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     6e-77  61%  224 aa  PURQ_ANAVT RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     8e-77  61%  224 aa  PURQ_ANASP RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     1e-76  58%  227 aa  PURQ_LISIN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     2e-76  58%  227 aa  PURQ_LISW6 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     2e-76  59%  228 aa  PURQ_ANOFW RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     8e-76  57%  227 aa  PURQ_LYSSC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::231     8e-76  55%  231 aa  PURQ_ACIBL RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     1e-75  58%  224 aa  PURQ_THETN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     2e-75  58%  228 aa  PURQ_GEOTN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::226     5e-75  54%  235 aa  PURQ_SYMTH RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     9e-75  55%  227 aa  PURQ_BACSU RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-74  55%  227 aa  PURQ_BACA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     2e-74  60%  223 aa  PURQ_LACAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-74  57%  227 aa  PURQ_BACP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::227     3e-74  57%  231 aa  PURQ_PELLD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     3e-74  60%  224 aa  PURQ_LACS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::224     4e-74  57%  224 aa  PURQ_SYNY3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::228     6e-74  59%  234 aa  PURQ_THELT RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::227     6e-74  57%  252 aa  PURQ_CHLP8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::225     2e-73  57%  232 aa  PURQ_GLOVI RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-73  58%  227 aa  PURQ_BACSK RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     4e-73  58%  226 aa  PURQ_EXISA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     5e-73  58%  228 aa  PURQ_OCEIH RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     5e-73  57%  228 aa  PURQ_GEOKA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     1e-72  61%  226 aa  PURQ_LACF3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     1e-72  58%  227 aa  PURQ_EXIS2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     1e-72  55%  227 aa  PURQ_BACLD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     2e-72  58%  224 aa  PURQ_LACDA RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::227     2e-72  57%  234 aa  PURQ_CHLTE RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     3e-72  60%  221 aa  PURQ_SYNP6 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     3e-72  60%  221 aa  PURQ_SYNE7 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::231     1e-71  55%  233 aa  PURQ_NITWN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::231     1e-70  54%  233 aa  PURQ_NITHX RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     1e-70  59%  222 aa  PURQ_DEIGD RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::223     7e-70  56%  225 aa  PURQ_SYNJB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::225     9e-70  54%  236 aa  PURQ_THERP RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::227     9e-70  52%  233 aa  PURQ_BRAJA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     2e-69  55%  217 aa  PURQ_PROMT RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::226     2e-69  53%  232 aa  PURQ_METAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::226     3e-69  53%  232 aa  PURQ_METMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     3e-69  56%  224 aa  PURQ_ENTFA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     6e-69  55%  226 aa  PURQ_LACLC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::226     1e-68  52%  232 aa  PURQ_METBF RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::222     2e-68  55%  225 aa  PURQ_SYNJA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     3e-68  57%  225 aa  PURQ_LACPL RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     6e-68  55%  228 aa  PURQ_LACSS RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     6e-68  56%  228 aa  PURQ_LACC3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::230     8e-68  52%  234 aa  PURQ_CHLCH RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     2e-67  54%  217 aa  PURQ_PROMM RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     3e-67  56%  228 aa  PURQ_LACCB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     7e-67  56%  226 aa  PURQ_LACRJ RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     7e-67  56%  226 aa  PURQ_LACRD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::220     2e-66  53%  223 aa  PURQ_LACLA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     2e-66  56%  221 aa  PURQ_DEIRA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     3e-66  55%  218 aa  PURQ_ANADE RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::225     5e-66  48%  227 aa  PURQ_AQUAE RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::227     6e-66  53%  233 aa  PURQ_RHOP2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     2e-65  53%  217 aa  PURQ_SYNS9 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::228     2e-65  50%  230 aa  PURQ_RHORT RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::227     4e-65  52%  233 aa  PURQ_RHOPA RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::223     7e-65  54%  223 aa  PURQ_PYRHO RecName: Full=Phosphoribosylformylglycinamidine synthase
    3::223     7e-65  54%  223 aa  PURQ_PYRAB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     1e-64  57%  221 aa  PURQ_SPHAL RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::219     1e-64  54%  221 aa  PURQ_PROM9 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     4e-64  53%  223 aa  PURQ_RHIL3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::227     6e-64  50%  233 aa  PURQ_RHOPB RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::219     1e-63  53%  221 aa  PURQ_PROMP RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::229     1e-63  47%  230 aa  PURQ_METJA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     2e-63  53%  223 aa  PURQ_RHIEC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::223     2e-63  55%  223 aa  PURQ_PYRKO RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::222     2e-63  53%  223 aa  PURQ_PYRFU RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::215     3e-63  52%  216 aa  PURQ_SYNSC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     5e-63  52%  222 aa  PURQ_RHILO RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     5e-63  54%  223 aa  PURQ_BRUSU RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     8e-63  52%  223 aa  PURQ_RHIME RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::219     1e-62  56%  225 aa  PURQ_NOVAD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     1e-62  51%  223 aa  PURQ_BARHE RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::215     1e-62  53%  220 aa  PURQ_RUBXD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     2e-62  53%  223 aa  PURQ_BRUME RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     2e-62  53%  223 aa  PURQ_BRUAB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     2e-62  53%  223 aa  PURQ_BRUA2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::218     2e-62  51%  241 aa  PURQ_THEEB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::229     5e-62  51%  233 aa  PURQ_GLUOX RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::222     1e-61  50%  224 aa  PURQ_SULDN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     2e-61  49%  223 aa  PURQ_STAHJ RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     3e-61  51%  222 aa  PURQ_MESSB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     3e-61  50%  223 aa  PURQ_BARQU RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     1e-60  49%  223 aa  PURQ_STAS1 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     2e-60  50%  218 aa  PURQ_WOLSU RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::215     2e-60  54%  222 aa  PURQ_SILST RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::225     2e-60  47%  226 aa  PURQ_METKA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::218     2e-60  53%  221 aa  PURQ_ZYMMO RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::220     2e-60  54%  223 aa  PURQ_COREF RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::223     6e-60  49%  227 aa  PURQ_THET8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::222     8e-60  50%  227 aa  PURQ_THET2 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     8e-60  47%  223 aa  PURQ_STAES RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     8e-60  47%  223 aa  PURQ_STAEQ RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::223     8e-60  48%  227 aa  PURQ_PELUB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::204     1e-59  54%  232 aa  PURQ_LEIXX RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::199     2e-59  52%  218 aa  PURQ_PROMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::215     4e-59  53%  222 aa  PURQ_ROSDO RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     4e-59  48%  219 aa  PURQ_LEPIN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     4e-59  48%  219 aa  PURQ_LEPIC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     5e-59  47%  223 aa  PURQ_STAAR RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     9e-59  47%  223 aa  PURQ_STAAW RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     9e-59  47%  223 aa  PURQ_STAAN RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     9e-59  47%  223 aa  PURQ_STAAM RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     9e-59  47%  223 aa  PURQ_STAAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     9e-59  47%  223 aa  PURQ_STAAB RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     9e-59  47%  223 aa  PURQ_STAA8 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     9e-59  47%  223 aa  PURQ_STAA3 RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     1e-58  53%  222 aa  PURQ_HELHP RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     2e-58  50%  217 aa  PURQ_SYNPX RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::221     3e-58  46%  223 aa  PURQ_STAAS RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::219     5e-58  51%  220 aa  PURQ_CAUCR RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::229     6e-58  51%  234 aa  PURQ_STRAW RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::215     8e-58  51%  222 aa  PURQ_SILPO RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::215     2e-57  48%  218 aa  PURQ_METTH RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::214     5e-57  47%  223 aa  PURQ_CAMJE RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::221     9e-57  52%  226 aa  PURQ_STRCO RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::220     1e-56  51%  223 aa  PURQ_CORGL RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::221     1e-56  50%  225 aa  PURQ_RHOSR RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::218     4e-55  50%  225 aa  PURQ_CORAM RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::221     2e-54  49%  225 aa  PURQ_NOCFA RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::226     2e-53  48%  228 aa  PURQ_HALWD RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::208     1e-52  50%  222 aa  PURQ_JANSC RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::219     2e-52  48%  224 aa  PURQ_MYCPA RecName: Full=Phosphoribosylformylglycinamidine synthase
   10::221     2e-52  45%  221 aa  PURQ_METST RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     3e-52  44%  224 aa  PURQ_NATPD RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::220     1e-51  47%  223 aa  PURQ_CORJK RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::217     4e-51  46%  224 aa  PURQ_HALSA RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::216     6e-51  49%  222 aa  PURQ_RHOS4 RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::219     4e-50  48%  224 aa  PURQ_MYCTU RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::219     4e-50  48%  224 aa  PURQ_MYCBO RecName: Full=Phosphoribosylformylglycinamidine synthase
    9::224     2e-49  46%  233 aa  PURQ_FRASC RecName: Full=Phosphoribosylformylglycinamidine synthase
    2::217     7e-49  48%  224 aa  PURQ_PROAC RecName: Full=Phosphoribosylformylglycinamidine synthase
    7::213     1e-47  48%  213 aa  PURQ_THEMA RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::220     1e-47  46%  224 aa  PURQ_MYCLE RecName: Full=Phosphoribosylformylglycinamidine synthase
    4::222     4e-43  41%  224 aa  PURQ_SULSO RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::189     4e-43  49%  212 aa  PURQ_PYRAE RecName: Full=Phosphoribosylformylglycinamidine synthase
    1::226     3e-41  46%  262 aa  PURQ_METTP RecName: Full=Phosphoribosylformylglycinamidine synthase
    8::218     2e-39  44%  248 aa  PURQ_PICTO RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::266     7e-36  44%  271 aa  PURQ_ARCFU RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::228     1e-35  44%  272 aa  PURQ_METMP RecName: Full=Phosphoribosylformylglycinamidine synthase
    6::223     2e-35  42%  258 aa  PURQ_THEVO RecName: Full=Phosphoribosylformylglycinamidine synthase
    5::222     3e-35  41%  257 aa  PURQ_THEAC RecName: Full=Phosphoribosylformylglycinamidine synthase
   15::228     3e-34  44%  272 aa  PURQ_METM7 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::225     4e-34  44%  269 aa  PURQ_METM5 RecName: Full=Phosphoribosylformylglycinamidine synthase
   12::238     5e-28  44%  270 aa  PURQ_TREDE RecName: Full=Phosphoribosylformylglycinamidine synthase
 1121::1350    2e-22  39% 1387 aa  PUR4_ARATH RecName: Full=Probable phosphoribosylformylglycinamidine
 1068::1271    2e-21  38% 1303 aa  PUR4_VIBF1 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1124::1315    2e-21  38% 1354 aa  PUR4_DROME RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1085::1268    5e-21  37% 1295 aa  PUR4_PHOLL RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1087::1265    5e-21  37% 1297 aa  PUR4_PASMU RecName: Full=Phosphoribosylformylglycinamidine synthase; 
   12::254     8e-21  33%  255 aa  PURQ_DEHE1 RecName: Full=Phosphoribosylformylglycinamidine synthase
 1067::1270    1e-20  38% 1302 aa  PUR4_VIBPA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1104::1290    4e-20  37% 1322 aa  PUR4_PHOPR RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1079::1261    7e-20  38% 1293 aa  PUR4_SHEDO RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1062::1265    1e-19  37% 1297 aa  PUR4_VIBCH RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1080::1262    2e-19  36% 1294 aa  PUR4_ERWCT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1062::1265    2e-19  37% 1297 aa  PUR4_VIBVY RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1062::1265    2e-19  37% 1297 aa  PUR4_VIBVU RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1080::1266    6e-19  38% 1298 aa  PUR4_PSESM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1081::1263    7e-19  36% 1295 aa  PUR4_PSEA6 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1079::1261    9e-19  36% 1293 aa  PUR4_SHEFN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1080::1266    9e-19  38% 1298 aa  PUR4_PSEU2 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1080::1266    9e-19  38% 1298 aa  PUR4_PSE14 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1087::1265    9e-19  37% 1297 aa  PUR4_MANSM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1087::1265    1e-18  37% 1297 aa  PUR4_HAES1 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1088::1266    2e-18  35% 1297 aa  PUR4_HAEI8 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1082::1263    2e-18  38% 1295 aa  PUR4_ECOL5 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1081::1263    2e-18  36% 1295 aa  PUR4_SODGM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1082::1263    2e-18  38% 1295 aa  PUR4_ECOUT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1082::1263    2e-18  38% 1295 aa  PUR4_ECOL6 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1085::1263    3e-18  39% 1295 aa  PUR4_SALPA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1085::1263    3e-18  39% 1295 aa  PUR4_SALCH RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1088::1266    3e-18  35% 1297 aa  PUR4_HAEIN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1083::1264    4e-18  36% 1296 aa  PUR4_YERPS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1083::1264    4e-18  36% 1296 aa  PUR4_YERPN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1083::1264    4e-18  36% 1296 aa  PUR4_YERPE RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1083::1264    4e-18  36% 1296 aa  PUR4_YERPA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1133::1322    4e-18  38% 1358 aa  PUR4_YEAST RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1060::1263    8e-18  36% 1295 aa  PUR4_SHISS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1060::1263    8e-18  36% 1295 aa  PUR4_SHIBS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1082::1264    8e-18  36% 1296 aa  PUR4_PSEHT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1060::1263    8e-18  36% 1295 aa  PUR4_ECOLI RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1082::1263    1e-17  37% 1295 aa  PUR4_SHIDS RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1085::1266    1e-17  35% 1298 aa  PUR4_PSEAE RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1082::1263    1e-17  37% 1295 aa  PUR4_ECO57 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1081::1267    2e-17  36% 1299 aa  PUR4_PSEPK RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1135::1313    2e-17  36% 1355 aa  PUR4_DICDI RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1085::1263    3e-17  38% 1295 aa  PUR4_SALTY RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1085::1263    3e-17  38% 1295 aa  PUR4_SALTI RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1081::1263    4e-17  36% 1295 aa  PUR4_IDILO RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1091::1266    2e-16  36% 1298 aa  PUR4_PSEPF RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1166::1333    3e-16  39% 1369 aa  PUR4_RALSO RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1104::1299    3e-16  39% 1337 aa  PUR4_MOUSE RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1080::1266    3e-16  36% 1298 aa  PUR4_PSEF5 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1085::1276    3e-16  32% 1298 aa  PUR4_HAHCH RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1119::1288    4e-16  37% 1320 aa  PUR4_NEIMB RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1149::1316    6e-16  38% 1348 aa  PUR4_XANAC RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1119::1288    6e-16  38% 1320 aa  PUR4_NEIMA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1113::1282    6e-16  39% 1314 aa  PUR4_NEIG1 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1123::1295    8e-16  36% 1322 aa  PUR4_XYLFT RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1123::1295    8e-16  36% 1322 aa  PUR4_XYLFA RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1079::1261    8e-16  34% 1293 aa  PUR4_SHESR RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1079::1261    8e-16  34% 1293 aa  PUR4_SHESM RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1102::1288    1e-15  34% 1320 aa  PUR4_COLP3 RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1079::1261    2e-15  36% 1293 aa  PUR4_SHEON RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1079::1261    2e-15  36% 1293 aa  PUR4_METFK RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1080::1302    2e-15  31% 1343 aa  PUR4_CAEEL RecName: Full=Probable phosphoribosylformylglycinamidine
 1102::1287    2e-14  35% 1323 aa  PUR4_SCHPO RecName: Full=Probable phosphoribosylformylglycinamidine
 1085::1267    2e-14  32% 1299 aa  PUR4_MYXXD RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1105::1300    1e-13  36% 1338 aa  PUR4_HUMAN RecName: Full=Phosphoribosylformylglycinamidine synthase; 
 1189::1321    3e-13  40% 1348 aa  PUR4_XANCP RecName: Full=Phosphoribosylformylglycinamidine synthase; 
    1::42      1e-10  60%   54 aa  PURQ_LACCA RecName: Full=Phosphoribosylformylglycinamidine synthase
   41::186     4e-07  33%  202 aa  HIS5_METAC RecName: Full=Imidazole glycerol phosphate synthase
   41::186     6e-07  32%  202 aa  HIS5_METBF RecName: Full=Imidazole glycerol phosphate synthase
   41::186     3e-06  35%  202 aa  HIS5_METMA RecName: Full=Imidazole glycerol phosphate synthase
  278::373     9e-06  35%  507 aa  COBQ_POLSJ RecName: Full=Cobyric acid synthase;
   39::203     2e-05  34%  209 aa  HIS5_BACCZ RecName: Full=Imidazole glycerol phosphate synthase
   39::203     2e-05  34%  209 aa  HIS5_BACC3 RecName: Full=Imidazole glycerol phosphate synthase
   39::203     2e-05  32%  209 aa  HIS5_BACC0 RecName: Full=Imidazole glycerol phosphate synthase
   39::203     2e-05  34%  209 aa  HIS5_BACAN RecName: Full=Imidazole glycerol phosphate synthase
   39::203     2e-05  34%  209 aa  HIS5_BACAH RecName: Full=Imidazole glycerol phosphate synthase
   39::203     2e-05  34%  209 aa  HIS5_BACAC RecName: Full=Imidazole glycerol phosphate synthase
   39::203     2e-05  34%  209 aa  HIS5_BACAA RecName: Full=Imidazole glycerol phosphate synthase
  254::375     2e-05  28%  493 aa  COBQ_PROA2 RecName: Full=Cobyric acid synthase;
   38::189     3e-05  34%  205 aa  HIS5_WOLSU RecName: Full=Imidazole glycerol phosphate synthase
   39::203     3e-05  34%  209 aa  HIS5_BACCQ RecName: Full=Imidazole glycerol phosphate synthase
   39::203     3e-05  34%  209 aa  HIS5_BACC7 RecName: Full=Imidazole glycerol phosphate synthase
  285::340     3e-05  34%  500 aa  COBQ_CHLTE RecName: Full=Cobyric acid synthase;
  274::443     3e-05  30%  488 aa  COBQ_BURCM RecName: Full=Cobyric acid synthase;
  262::395     6e-05  29%  514 aa  COBQ_SYNFM RecName: Full=Cobyric acid synthase;
   39::203     8e-05  34%  209 aa  HIS5_BACWK RecName: Full=Imidazole glycerol phosphate synthase
  274::333     1e-04  42%  492 aa  COBQ_METMJ RecName: Full=Probable cobyric acid synthase;
   95::205     2e-04  31%  528 aa  GUAA_BORBU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  272::331     2e-04  41%  487 aa  COBQ_METPE RecName: Full=Probable cobyric acid synthase;
  279::331     2e-04  38%  480 aa  COBQ_METB6 RecName: Full=Probable cobyric acid synthase;
   39::203     3e-04  33%  209 aa  HIS5_BACC1 RecName: Full=Imidazole glycerol phosphate synthase
  282::339     3e-04  40%  480 aa  COBQ_VIBVY RecName: Full=Cobyric acid synthase;
  285::342     3e-04  40%  483 aa  COBQ_VIBVU RecName: Full=Cobyric acid synthase;
  285::338     3e-04  43%  484 aa  COBQ_VIBCH RecName: Full=Cobyric acid synthase;
  285::338     3e-04  43%  484 aa  COBQ_VIBC3 RecName: Full=Cobyric acid synthase;
  281::340     3e-04  35%  495 aa  COBQ_CHLPB RecName: Full=Cobyric acid synthase;
  274::334     3e-04  38%  488 aa  COBQ_BURVG RecName: Full=Cobyric acid synthase;
  296::459     4e-04  32%  510 aa  COBQ_SHEON RecName: Full=Cobyric acid synthase;
   39::203     5e-04  33%  209 aa  HIS5_BACC2 RecName: Full=Imidazole glycerol phosphate synthase
  278::339     5e-04  38%  488 aa  COBQ_TRIEI RecName: Full=Cobyric acid synthase;
  256::342     5e-04  31%  496 aa  COBQ_SHEAM RecName: Full=Cobyric acid synthase;
  290::336     5e-04  44%  492 aa  COBQ_METM7 RecName: Full=Probable cobyric acid synthase;
  287::353     5e-04  36%  494 aa  COBQ_CYAA5 RecName: Full=Cobyric acid synthase;
  292::347     5e-04  42%  505 aa  COBQ_CHLPD RecName: Full=Cobyric acid synthase;
   24::182     7e-04  29%  194 aa  HIS5_PYRFU RecName: Full=Imidazole glycerol phosphate synthase
   39::203     7e-04  33%  209 aa  HIS5_BACCR RecName: Full=Imidazole glycerol phosphate synthase
   39::203     7e-04  33%  209 aa  HIS5_BACC4 RecName: Full=Imidazole glycerol phosphate synthase
  285::339     7e-04  38%  483 aa  COBQ_VIBPA RecName: Full=Cobyric acid synthase;
  282::372     7e-04  34%  495 aa  COBQ_VIBFM RecName: Full=Cobyric acid synthase;
  287::432     7e-04  34%  493 aa  COBQ_CLOBH RecName: Full=Cobyric acid synthase;
  287::432     7e-04  34%  493 aa  COBQ_CLOB1 RecName: Full=Cobyric acid synthase;
  320::342     9e-04  57%  488 aa  COBQ_XANP2 RecName: Full=Cobyric acid synthase;
  282::372     9e-04  35%  495 aa  COBQ_VIBF1 RecName: Full=Cobyric acid synthase;
  273::333     9e-04  38%  483 aa  COBQ_PYRFU RecName: Full=Probable cobyric acid synthase;
  294::353     9e-04  38%  485 aa  COBQ_POLNA RecName: Full=Cobyric acid synthase;
  292::390     9e-04  31%  503 aa  COBQ_PELPB RecName: Full=Cobyric acid synthase;
  290::336     9e-04  44%  492 aa  COBQ_METM5 RecName: Full=Probable cobyric acid synthase;
  267::341     9e-04  36%  483 aa  COBQ_HALHL RecName: Full=Cobyric acid synthase;
    1::233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFGVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCGAVARFSPVMS
PURQ_CARHZ      MKFGVVVFPGSNCDADCFHVLKNVFGRETVYIWHKEDNFD-VDCIVLPGGFSYGDYLRAGAIARFSPVMK
PURQ_MOOTA      MKFGVIVFPGSNCDQDVHYALGSVLGQNVDYLWHGDTSVSGYDCLILPGGFSYGDYLRAGAIARFAPIMP
PURQ_BACC3      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDGYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_SALRD      -RFGVVVFPGSNCDHDAYHAAHDVFDQEARFIWHEEASLGDVDVVIVPGGFSYGDYLRSGAVARFSPIMQ
PURQ_BACCZ      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACCQ      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACHK      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACC7      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACC2      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACC1      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACC0      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACAN      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACAC      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACAA      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACAH      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACWK      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDRENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACCR      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACCN      MKFAVIVFPGSNCDVDMFHAIKDELGEDVDYVWHDAENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACC4      MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMK
PURQ_BACHD      MKFAVIVFPGSNCDADMYHAVKDALGEEVDYLWHTETSVEGYDAILLPGGFSYGDYLRSGSIARFSPIME
PURQ_ACAM1      MKFGVLVFPGSNCDRDVVLVTRDLLKQPTRMVWHQETDISDLDVVVIPGGFSYGDYLRCGAISRFSPAMQ
PURQ_LISMO      MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYIWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMP
PURQ_BREBN      MRVAVIVFPGSNADVDLFNAVEDVMGVPVDYVWHSDTDLSKYDAILLPGGFSYGDYLRCGAVARFSPVME
PURQ_LISMH      MKFAVIQFPGSNCDLDMLHAIRDSIGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMP
PURQ_GEOSW      MKFAVIVFPGSNCDVDMYHAIADELGEEVEYVWHDAENLDRFDAILLPGGFSYGDYLRSGAIARFSNVMK
PURQ_ALKMQ      MRFGIVVFPGSNCDIDCYYVLKDELQQEVEYIWHEEELKEGFDCIILPGGFSYGDYLRCGAVAQFSKVME
PURQ_LISMF      MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMP
PURQ_LISMC      MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMP
PURQ_ANAVT      MKFGVVVFPGSNCDRDVAYVTRDLLGQPTRMVWHQDTDIADLDVVIIPGGFSYGDYLRCGAIARFSPVMQ
PURQ_ANASP      MKFGVVVFPGSNCDRDVAYVTRDLLGQPTRMVWHQDTDIADLDVVIIPGGFSYGDYLRCGAIARFSPVMQ
PURQ_LISIN      MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMP
PURQ_LISW6      MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLEGFDAVLLPGGFSYGDYLRTGAIAKFSSIMP
PURQ_ANOFW      MKFAVVVFPGSNCDVDMYHAISDELGEEVEYVWHDVDCLDDFDAILLPGGFSYGDYLRSGAIARFSNVMK
PURQ_LYSSC      MKFAVLVFPGSNCDIDMYHAIKDELGEEVEYVWHTATDLSGFDGVLVPGGFSYGDYLRCGAMANQSNIMA
PURQ_ACIBL      MKFGVLIFPGSNCDHDAHWVLGQVAKQPVTFLWHESHDLENCDAIVVPGGFAYGDYLRTGAIAKFSPVME
PURQ_THETN      MKFAVIVFPGSNCDVDCYYAVKDGLGEGVEYVWHQEKNLSKYDVIMLPGGFSYGDYLRAGAIARFSPVME
PURQ_GEOTN      MKFAVIVFPGSNCDVDMYHAIADELGEEVEYVWHDEENLDRFDAILLPGGFSYGDYLRSGAIARFSKVMA
PURQ_SYMTH      MRFGILVFPGTNCEMETFYVLREVVGVQADYVWHEARDLTPYDAVVIPGGFTYGDRVRSGALACRAPVME
PURQ_BACSU      MKFAVIVLPGSNCDIDMYHAVKDELGHEVEYVWHEETSLDGFDGVLIPGGFSYGDYLRCGAIARFANIMP
PURQ_BACA2      MKFAVIVLPGSNCDIDMFHAVKDELGEEVEYVWHEETSLDGFDGVLIPGGFSYGDYLRCGAIARFANIMP
PURQ_LACAC      MKIAVVVFPGSNCDIDMYEAFHTVCKDDVEYVSYKEKSLDGFDVVVLPGGFSYGDYLRTGAIARFSNIIP
PURQ_BACP2      MKFAVIVLPGSNCDIDMYHAIQDELGEQVEYVWHDETSLDGFDGVLVPGGFSYGDYLRCGAIARFSNIMP
PURQ_PELLD      ---GVVVFPGSNCDHDTMHAVASFEGVKPVMLWHGSHDLQGAKAIILPGGFSYGDYLRAGSIARFSPIMQ
PURQ_LACS1      MKIAVIVFPGSNCDIDLYEALHTVCDADVEYVSYKQDNLDGFDAVMLPGGFSYGDYLRCGAIARFSPIMP
PURQ_SYNY3      --FGIIVFPGSNCDRDIATVTAGLLDQPTRFIWHQETDLHGVDVVVLPGGFSYGDYLRCGAIARFSPIMT
PURQ_THELT      MKAAVVVFPGSNCDKDTFYVLKYVMGFDCYYVFHKDHFYEKFDLIVLPGGFSYGDYLRAGAIARFSPVMR
PURQ_CHLP8      LNVGVVVFPGSNCDHDTEYAVASFSGVKPVMLWHNEHDLKGCDAIILPGGFSYGDYLRCGSIARFSPIMR
PURQ_GLOVI      MKFAVIVFPGSNCDRDVVTVTRGLLDQPTRLVWHTEDDLDGCDVAVIPGGFSYGDYLRCGAIARFSPVMQ
PURQ_BACSK      MKFAVIVFPGSNCDADMYHAIKDGLGEEVEYVFHTETSLDGFDAVLLPGGFSHGDYLRSGAIARFAPIMP
PURQ_EXISA      MKFAVIVFPGSNCDLDMYHAVKDVLGEEAEYVFHTETSLEGFDGVLLPGGFSYGDYLRCGSIAQFSPIMA
PURQ_OCEIH      MKFAVIVFPGSNCDRDMYHAVKEVAGAEAELVWYETDKLEGVDGILLPGGFSYGDYLRSGSMASTSDVMH
PURQ_GEOKA      MKFAVVVFPGSNCDVDMYHAIADELGEEVEYVWHDEDNLDRFDAVLLPGGFSYGDYLRSGAIARFSXXXX
PURQ_LACF3      MKIAVIVFPGSNCDIDLYEALKTVCGADVDYVDHQQTSLAGYDAVMLPGGFSYGDYLRAGAIARFAKIMP
PURQ_EXIS2      MKFAVIVFPGSNCDLDMYHAVKDALGEEVEYVFHTETSLEGYDGVLLPGGFSYGDYLRCGAIAQFSPIME
PURQ_BACLD      MKFAVIVLPGSNCDIDMFHAIKDELGEEAEYVWHTETSLDEYDGVLIPGGFSYGDYLRCGAIARFANIMP
PURQ_LACDA      MKFAVIQFPGSNCDIDLYEALHTVCGADVAYVPSKESSLDGFDAVMLPGGFSYGDYLRAGAIARFTNIMP
PURQ_CHLTE      ---GIVVFPGSNCDHDTEYAVASFPGVKPVMLWHNDHDLKGCDAVILPGGFSYGDYLRCGAIARFSPIMR
PURQ_SYNP6      MNVGVIVFPGSNCDRDVQWVTAGLLGQSTRMIWHEERDLSGLDLIVVPGGFSYGDYLRCGAIARFSPAMQ
PURQ_SYNE7      MNVGVIVFPGSNCDRDVQWVTAGLLGQSTRMIWHEERDLSGLDLIVVPGGFSYGDYLRCGAIARFSPAMQ
PURQ_NITWN      MKSAVLVFPGINRERDMARALRLVSGREPAMVWHAETSLEGTDLVVAPGGFSYGDYLRCGAIAARAPVMD
PURQ_NITHX      MKSAILVFPGINRERDMARALKLISGHEPAMVWHAETSLPGTDLVVMPGGFSYGDYLRCGAIAARSPVMD
PURQ_DEIGD      MRTAVIQFPGSNCDADALHAARLTLDPDAGFVWHTETALPGTELVFLPGGFSYGDHLRSGAIAARSPIMA
PURQ_SYNJB      VRFGVVVFPGSNCDRDVAWVTRGLLGCPTRLIWHRETDLSELDVVVLPGGFSYGDYLRCGAIARFAPVMG
PURQ_THERP      MRFAVVTFPGSNGDHDALMAIRLGLGHAAELVWYTETDLSRFDCIIIPGGFSYGDYLRAGALARFAPVMS
PURQ_BRAJA      MKAAILVFPGINRDRDMARALRLISGSEPAMVWHAETSLPGTDLVVVPGGFSYGDYLRCGAIAARAPVMD
PURQ_PROMT      MNIGIIVFPGSNCDRDVRWATEGCLGVPTSFLWHETTDLDGFDAIVIPGGFSYGDYLRCGAIARFAPVLN
PURQ_METAC      MKIAIIQFGGTNCDMDVLHVLKDVVGVDAETVWYKEENLTGFDGVVVPGGFSYGDYLRAGAIAARTPIMD
PURQ_METMA      MKIAIIQFGGTNCDMDVLHVLKDVVGVDAETVWYKEESLTGFDGVVVPGGFSYGDYLRAGAIAARTPIMD
PURQ_ENTFA      MKLAVIVFPGSNCDADLLWAVKEVMGIDAEFVRHDATSLAKFDGVLLPGGFSYGDYLRCGAIARFSPIIN
PURQ_LACLC      MKFAVIQFPGSNCDFDLLWAIRDVMGAEAEFVWHDEKSLAGFDGVLIPGGFSYGDYLRCGAIASFANIMP
PURQ_METBF      MKIAILQFGGTNCDQDVLHVLKDVVGVDAETVWYKQEDLTGFDGVVVPGGFSYGDYLRAGAIAARTPIMN
PURQ_SYNJA      VRFGIVVFPGSNCDRDVAWVTRGLLGCPTRLIWHRETDLSGLDVVVLPGGFSYGDYLRAGALARFAPVMG
PURQ_LACPL      MKFAVPVFPGSNCDHDMVNALRDILHVTADLIPATATSLAGYDAVVLPGGFSYGDYLRSGAIARFAPIMP
PURQ_LACSS      MKFAVLVFPGSNCDADLYHAIVDVCHEEAAYVSYTATSLAGFDAVLIPGGFSYDDYLRSGAIAKLAPIMT
PURQ_LACC3      MKAAVISFPGSNCDLDLQWAVRAIAGAECDLIKPTQTDLTAYDVVMVPGGFSYGDYLRSGAIARFSPVMA
PURQ_CHLCH      ---GVVVFPGSNCDHDTAYALASFAGVKPVMLWHNNHDLQGAQAIVLPGGFSYGDYLRAGAIARFSPLMK
PURQ_PROMM      MSIGVVVFPGSNCDRDVRWAAQGCLNIPTRFLWHETRDLNGLDAVVLPGGFSYGDYLRCGAIARFAPVLE
PURQ_LACCB      MKAAVISFPGSNCDLDLQWAVRDIAGAECDLIKPTQTDLTAYDVVMVPGGFSYGDYLRSGAIARFSPVMD
PURQ_LACRJ      MKIAVVVFPGSNCDVDLYEALHSVCHADVEYVSHRQKSLAGFDAVMLPGGFSYGDYLRAGAIARFTNIMP
PURQ_LACRD      MKIAVVVFPGSNCDVDLYEALHSVCHADVEYVSHRQKSLAGFDAVMLPGGFSYGDYLRAGAIARFTNIMP
PURQ_LACLA      MKFAVIQFPGSNCDFDLLWAIRDVMGAEAEFVWHDEKSLAGFDGVLIPGGFSYGDYLRCGAIASFANIMP
PURQ_DEIRA      MKTAVIQFPGSNCXXXXXXXXXXXXXXGAQFVWHTETALEGTELVFLPGGFSYGDHLRSGAIAARSPIMN
PURQ_ANADE      MRVGILTFPGSNCDHDCYHVVKHVMGAEAQYVWHKDRLPEQLDAVVVPGGFSYGDYLRCGALARFSPVIA
PURQ_AQUAE      MKFAVCVFPGSNCDYDTYYVIRDILEKDVEFVYWEEKNLSKYDVVVLPGGFSFGDYLRPGALAARTPLAQ
PURQ_RHOP2      MKSAVLVFPGINRERDMARALKLVSGHDAAMVWHADTELNGTDLVVVPGGFSYGDYLRCGAIAARAPVMD
PURQ_SYNS9      MTIGVVVFPGSNCDRDVQWATEGCLNLPTRRLWHEETDLSGLDAVVLPGGFSYGDYLRCGAIARFAPVLQ
PURQ_RHORT      MNSAIIVFPGTNRERDMAKALTLVGGKAPQMVWHRDSALPGLDLVVLPGGFSYGDYLRSGAMGARSPILD
PURQ_RHOPA      MKSAVLVFPGINRERDMARALKLVSGNDAAMVWHAETELPGTDLVVVPGGFSYGDYLRCGAIAARAPVMD
PURQ_PYRHO      VKFAVIVFPGTNCDFETVEAIKRAGGE-AERVWYKQ-SVKDYDGVVIPGGFSYADYLRAGAIAARQKVME
PURQ_PYRAB      -RFAVIVFPGTNCDFETVEAIRKAGGE-AERVWYKE-SIREYDGVVLPGGFSYADYLRAGAIAARQRIME
PURQ_SPHAL      MKTAVIVFPGSNCDRDMAVALETVTGKAPAMVWHRTGLPEGTDFIALPGGFSYGDYLRSGAMAARSPILR
PURQ_PROM9      ---GVVVFPGSNCDRDVSWALEGCLDIRTKYLWHESSDLSDVDAIVLPGGFSYGDYLRCGAIARFSPLIN
PURQ_RHIL3      MKSAVVQLPGLNRDRDMIAALTKISGQPPVTIWQTETEIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQ
PURQ_RHOPB      MKSAILVFPGINRERDMARALQLASGSEPAMVWHADTELPGTDLVVVPGGFSYGDYLRCGAIAARAPVMD
PURQ_PROMP      ---GIVVFPGSNCDRDVSWALEGCLDIKTKFLWHESSDLNDVDSIVLPGGFSYGDYLRCGAIARFSPLIN
PURQ_METJA      MKIAVTKFLGTNCDLDVCHAVKLAGGEP-ELVFFTQENLDSYKGAVIPGGFSYGDYLRAGAISARTPIIK
PURQ_RHIEC      MKSAVVQLPGLNRDRDMIAALTKISGHQPVTIWQTETEIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQ
PURQ_PYRKO      VKFAVVVFPGTNCDFETERAIRKA-GAEAERVWYKT-SLKDFDGVVLPGGFSYADYLRAGAIAARQEIIE
PURQ_PYRFU      VKFAVVVFPGTNCDFETVEAIKRAGGK-AERVWYKD-SIKDYDGVVIPGGFSYADYLRAGAIAARQRIME
PURQ_SYNSC      MSIGVIVFPGSNCDRDVQWATDGCLGMSTRRVWHEETDLSGFDAIILPGGFSYGDYLRCGAIARFAPALQ
PURQ_RHILO      MKSAVVLLPGLNRDRDMIAALTKISGKPPVTVWQTDTEIPDVDLIAIPGGFSFGDYLRCGAIAARMPVMR
PURQ_BRUSU      MKSAVILLPGLNRDRDMIAALTKITGQAPVTVWQTDTSIDDVDLILIPGGFSYGDYLRCGAIAARMPVMQ
PURQ_RHIME      MKSAVVQLPGLNRDCDMIAALTKISGKAPVTVWQTETEIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQ
PURQ_NOVAD      ----VITFPGSNCDRDMAVAIEQVCGGTVHRVWHGDADLEGLDFIALPGGFSYGDYLRSGAMAARSPVMQ
PURQ_BARHE      MKTAIIQLPGLNRDRDMVAALHHITGVEPLKIWQTESTIPDVDVIVIPGGFSYGDYLRCGAIGARTPVLQ
PURQ_RUBXD      MRVGVVVFPGSNCDRDALHAVERAGAEPVE-LWHADADLKGSDAVILPGGFSYGDYLRPGAIARFARVMG
PURQ_BRUME      MKSAVILLPGLNRNRDMIAALTKITGQAPVTVWQTDTSIDDVDLILIPGGFSYGDYLRCGAIAARMPVMQ
PURQ_BRUAB      MKSAVILLPGLNRNRDMIAALTKITGQAPVTVWQTDTSIDDVDLILIPGGFSYGDYLRCGAIAARMPVMQ
PURQ_BRUA2      MKSAVILLPGLNRNRDMIAALTKITGQAPVTVWQTDTSIDDVDLILIPGGFSYGDYLRCGAIAARMPVMQ
PURQ_THEEB      LNVGIVVFPGSNCDRDVAYVTREILQWPTQLLWHEETDLGDYDLIVLPGGFSFGDYLRCGAIARFSPIMA
PURQ_GLUOX      MKAAIVVFPGTNRERDMVHALKLVTGQAPRLIWHGETSXXXXXXXXXXXXFSFGDYLRSGAVAAHSPIMR
PURQ_SULDN      MKVTILQFPGTNCEYDAQHAFKSL-GAETEILWHKSDTIPSTDLLIVAGGFSYGDYLRSGAIAKFSPVMK
PURQ_STAHJ      MKFAVLVFPGSNCDRDMYNAA-IKSGAQADYVDYRETSLDGYDGVLIPGGFSFGDYLRSGAMASVAPIIN
PURQ_MESSB      MKSAVIQLPGLNRDRDMIAALTKISGQAPVTVWQTETELPEVDLIVIPGGFSYGDYLRCGAIAARMPVMK
PURQ_BARQU      MKTAIIQLPGLNRDQDMLVALHHITGVEPIKIWQTESTIPDVDVIVIPGGFSYGDYLRCGAIGARTPVLQ
PURQ_STAS1      MKFAVLKFPGSNCDRDMYNAALK-SDVEAEYVDYRNTSLDGFDGVLIPGGFSFGDYLRSGAMASVAPITE
PURQ_WOLSU      MSIAVLRFPGTNCEFDMLHSFKLL-GVESHLVWHQEKELPGTHLVVIPGGFSYGDYLRSGAIARFSPIMQ
PURQ_SILST      MKAAVVVFPGSNCDRDLAVAFEQA-GFDVSMVWHKDSELEGVDIVGVPGGFSYGDYLRCGAIAAQSPICK
PURQ_METKA      VRVAVIRFPGTNCDLEMAWAVKLAGGDP-EFVWHEDGGLDDFDAVIIPGGFTYGDYIRAGAIAALSPILE
PURQ_ZYMMO      MKAAVLVFPGSNCDRDLAVAIEKICGTKPLMVWHQESELDDLDLIAVPGGFSYGDYLRSGAMAARSAVMP
PURQ_COREF      -KIGVITFPGTLDDVDALRAVRIAGAEPVN-LWHADEDLRGVDAVVVPGGFSYGDYLRTGAISALAPVMQ
PURQ_THET8      MRWAIVRFPGANCDEDARFALEKA-GIRAEFVWHTERDLRGFDGVFLPGGFSYGDYLRAGALAAKSPVME
PURQ_THET2      MRWAIVRFPGANCDEDARFALEKA-GIRAEFVWHTERDLRGFDGVFLPGGFSYGDYLRAGALAAKSPVME
PURQ_STAES      MKFAVLVFPGSNCDRDMYNAA-IKSGVDAAYVDYRETTLDGFDGVLIPGGFSFGDYLRSGAMASVAPIIK
PURQ_STAEQ      MKFAVLVFPGSNCDRDMYNAA-IKSGVDAAYVDYRETTLDGFDGVLIPGGFSFGDYLRSGAMASVAPIIK
PURQ_PELUB      MHSSVITFPGSNCDRDMDVALKKF-GFKNKMVWHDDVELPKSDLVVLPGGFSYGDYLRCGSMASKSKIMK
PURQ_LEIXX      MRIGVITFPGSLDDRDALRAIRLAGAEPVA-LWHGDHDLQGVDALVLPGGFSYGDYLRCGAIASLSPIMS
PURQ_PROMA      MTIGIVVFPGSNCDRDVHWATQGCLGMSTRFLWHESTDLNGLEAVVLPGGFSYGDYLRCGAIARFAPVLS
PURQ_ROSDO      MHAAVVVFPGSNCDRDLAVAFEAA-GAQVTKVWHKDTDLEGVDIIGIPGGFSFGDYLRCGAIAANSPICR
PURQ_LEPIN      MKIAVITFPGSNCDSDIYRVLKDQYNAEVDRIWHRDGLDKKYELVILPGGFSYGDYLRSGAMAGFSPVMK
PURQ_LEPIC      MKIAVITFPGSNCDSDIYRVLKDQYNAEVDRIWHRDGLDKKYELVILPGGFSYGDYLRSGAMAGFSPVMK
PURQ_STAAR      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPVIS
PURQ_STAAW      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_STAAN      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_STAAM      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_STAAC      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_STAAB      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_STAA8      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_STAA3      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_HELHP      MSVAIVRFPGTNCEFDTQYAFSLFGG--VTYIWHQDKSLPT-DCVVIPGGFSYGDYLRCGAIAQFSPIMR
PURQ_SYNPX      MSIGVLVFPGSNCDRDVQWATEGCLGMPTRRIWHEETDLSGLDAVVLPGGFSYGDYLRCGAIARXXXXXX
PURQ_STAAS      MKFAVLVFPGSNCDRDMFNAA-IKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIIS
PURQ_CAUCR      MKAAVIVFPGSNCDRDCKVAIERSAGARVEMVWHQETALDDLDLIVLPGGFSYGDYLRCGAMAAQSPVMK
PURQ_STRAW      -RIGVVTFPGSLDDRDTQRAIKLAGAEPVA-LWHKDKDLKQVDAVVLPGGFSYGDYLRAGAISRFSPVME
PURQ_SILPO      MRAAVVVFPGSNCDRDLAVAFEQA-GFDVSMVWHKDADLQGIDIVGIPGGFSYGDYLRCGAIAAQSPICK
PURQ_METTH      MRVGVIRFPGSNCDRDVHHVLELAGAEP-EYVWWNQRNLDHLDAVVIPGGFSYGDYLRAGAIAAITPVMD
PURQ_CAMJE      MKVAIIRFPGTNCEFDTTYAFEKL-GVKTQIVWHEEKEFDA-DLVVLPGGFSYGDYLRCAAIAKLAPAMQ
PURQ_STRCO      -RIGVVTFPGSLDDRDTQRAIRVAGAEPVA-LWHKDKDLKQVDAVVLCGGFSYGDYLRAGAIARFSPVMD
PURQ_CORGL      -KIGVITFPGTLDDVDXXXXXXXXXXEVIS-LWHADEDLKGVDAVVVPGGFSYGDYLRTGAISALAPVMQ
PURQ_RHOSR      -RVGVITFPGTLDDVDAARAVTLAGGEAVS-LWHGDADLKGVDAVIVPGGFSYGDYLRCGAIARFAPVMG
PURQ_CORAM      -KIGVITFPGTLDDVDAQRAVRLAGAEAVS-LWHADTDLKGVDAVVVPGGFSYGDYLRSGAISALAPVMQ
PURQ_NOCFA      -RIGVITFPGTLDDVDAVRAVRLAGAEAVN-LWHADADLKQVDAVIVPGGFSYGDYLRAGAIARFAPVMG
PURQ_HALWD      ----VVQFGGSNCDRDAVRALQHI-GIDATRVWHEDGSVENLDGIILPGGFSYGDYLRAGAMAAHSPIVN
PURQ_JANSC      MKAAVLVFPGSNCDRDLAVGFRSA-GFEVEMVWHKETALPGIDVVGIPGGFSYGDYLRCGAIAAQSPIMR
PURQ_MYCPA      -RIGIITFPGTLXXXXXXXXXXXXGAQPVS-LWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMT
PURQ_METST      ---GIIRFPGTNCDRDIEYAVNLV-GANSHYIYWNETDLSQMDVVIIPGGFSYGDYLRAGSIAGITPIID
PURQ_NATPD      MTVAIIRFGGSNCDRDAERALAHLDID-AEIVWHEDGLPEETTGVMIPGGFSYGDYLRAGAMAARAPIMD
PURQ_CORJK      -RIGVITFPGTLDDVDAVRAVRLAGAEPVE-LWHADEDLKNVDAVVVPGGFSYGDYLRXXXXXXXXXXMK
PURQ_HALSA      MTVAVVRFGGSNCDRDAVRALAHL-GVDAAVAWHDDGLPADTDGVVVPGGFSYGDYLRAGAMAAQSPVVA
PURQ_RHOS4      MKAAVITFPGSNCDRDLATAFEKA-GADVTRVWHKDTALEXXXXXXXXXXFSFGDYLRCGXXXXXXXXXX
PURQ_MYCTU      -RIGVVTFPGTLXXXXXXXXXXXXXXXXXS-LWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMD
PURQ_MYCBO      -RIGVVTFPGTLXXXXXXXXXXXXXXXXXS-LWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMD
PURQ_FRASC      -RIGIVTFPGSLDDQDTALAVRAAGAEPVS-LWHGDSDLAGVDAVILPGGFSYGDYLRAGAIARFSPMVA
PURQ_PROAC      VRIGVVTFPGTLDDQDAARAVRLAGAEPVS-LWYASTDLAGVDAVILPGGFSYGDYLRAGALAAASPVMS
PURQ_THEMA      ----VVVYPGSNCDRDAYHALE-INGFEPSYVG-LDDKLDDYELIILPGGFSYGDYLRPGAVXXXXXXXX
PURQ_MYCLE      -RIGVITFPGTLXXXXXXXXXXXXXXXXXS-LWHADADLKGVDAVVVPGGFSYGDYLRAGAIARLSPIMT
PURQ_SULSO      ----IIKFPGTTCETDVYKAL-IEAGVPTVIVKYKDFDPDRYNGVILPGGFSFGDYLRAGSIAASTETMK
PURQ_PYRAE      MRIAVLKFPGTNGDYDVLRALE-LAGARGELVWYRDYAAGKYDAVVLAGGFSYGDRLRAGAIAAATKAMD
PURQ_METTP      MRIAVIQFPGTNCEHETLVAVRECGMDGEIFRWNREQELCEFDGYVIPGGFSYQDRVRAGVIASKEPVMA
PURQ_PICTO      ----VLRMEGTNNEEEAFLSLKRAGFEPINDLARKRKFIDDYNLMFIPGGFSAGDYIRAGAIARLRPFLS
PURQ_ARCFU      IKVAVLRMEGTNCEDETVKAFRSVEAEAVDMIFEEQRSVFDYQCLVFPGGFSAGDYIRAGAIARVKSVLR
PURQ_METMP      ---------GINCETETAHAFQKA-GAETDIV-HINDLIAGYEIIMFPGGFSYGDDTGSGANKIKNNLFD
PURQ_THEVO      -KIGILLMEGTNNETEVYYSVKRSGGSP-DFIHINDLSVSDYDGLIIPGGFSAGDYIRAGVIARLGAVAG
PURQ_THEAC      -KVGILLMEGTNNETEVFFSVRRSGGDP-DYV-HVSDAISDYDALIVPGGFSAGDYIRAGVIARLLAVAG
PURQ_METM7      ---------GINCETETAHTFQKA-GAKTDIV-HINDLIAGYEIIMFPGGFSYGDDTGSGANKIKNNLFD
PURQ_METM5      ---------GINCETETAHAFQKA-GAETDIV-HINDLIAGYEIIMFPGGFSYGDDTGSGANKIKNNLFD
PURQ_TREDE      ---------GTNRDGDAARALELAGAEPINKLKAKEKNWKDYEILVIPGGFSYADALGAGALDLSNYFFD
PUR4_ARATH      -KVAVIREEGSNGDREMSAAFYAAGFEPWDVLLAGDITLDQFRGIVFVGGFSYADVLDSAASIRFNPVLS
PUR4_VIBF1      -------FDRAGFEATDIHMSDILTGQAV---------LEEYNGLVACGGFSYGDVLGAGEGWAKSVLFN
PUR4_DROME      -----------------------------------TASVSQYRGLIFPGGFSYADTLGSAANILHNPRLL
PUR4_PHOLL      -----------------------------------------FQTLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_PASMU      -----------------------------------------FNALVACGGFSYGDVLGAGGGWAKSILFN
PURQ_DEHE1      --------PGTNCDIETSYAFELAGSETINELLAKPSRLAEFQIMAFPXXXXXXXXXXXXRVLANEVRLK
PUR4_VIBPA      -------FDRAGFEATDIHMSDILTGQAV---------LDEYQGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_PHOPR      -----------------------------------SGNVEGFNGLVACGGFSYGDVLGAGEGWAKSVLFN
PUR4_SHEDO      -------------------------------------SLDEFQGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_VIBCH      -------FDRAGFDAVDVHMSDILTGQTV---------LDAYQGLVACGGFSYGDVLGAGELXXXXXXXX
PUR4_ERWCT      -------------------------------------NLQDFQALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_VIBVY      -------FDRAGFEATDIHMSDILTGQAV---------LDEYHGLVACGGFSYGDVLGAGEGWAKSVLFN
PUR4_VIBVU      -------FDRAGFEATDIHMSDILTGQAV---------LDEYHGLVACGGFSYGDVLGAGEGWAKSVLFN
PUR4_PSESM      -----------------------------------AGRVDLNDFMVACGGFSYGDVLGAGESALFNSRAR
PUR4_PSEA6      -------------------------------------SLSEFQGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SHEFN      -------------------------------------SLEEFQGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_PSEU2      -----------------------------------AGRVDLNDFMVACGGFSYGDVLGAGESALFNSRAR
PUR4_PSE14      -----------------------------------AGRVDLNDFMVACGGFSYGDVLGAGESALFNSRAR
PUR4_MANSM      -----------------------------------------FNALVACGGFSYGDVLGAGGGWAKSVLFN
PUR4_HAES1      -----------------------------------------FNALVACGGFSYGDVLGAGGGWAKSILFN
PUR4_HAEI8      -----------------------------------------FNAMVACGGFSYGDVLGAGGGWAKSILFN
PUR4_ECOL5      --------------------------------------LEGFHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SODGM      -------------------------------------TLEGFHTLVACGGFSYGDVLGAGEGWAKSVLFN
PUR4_ECOUT      --------------------------------------LEGFHVLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_ECOL6      --------------------------------------LEGFHVLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SALPA      -----------------------------------------FHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SALCH      -----------------------------------------FHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_HAEIN      -----------------------------------------FNAMVACGGFSYGDVLGAGGGWAKSILFN
PUR4_YERPS      --------------------------------------LQSFQTLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_YERPN      --------------------------------------LQSFQTLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_YERPE      --------------------------------------LQSFQTLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_YERPA      --------------------------------------LQSFQTLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_YEAST      --------------------------------------LDDFIGLAACGGFSYGDVLGAGAVLYHEGVRS
PUR4_SHISS      -------FHRAGFDAIDVHMSDLLTGRT---------GLEDFHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SHIBS      -------FHRAGFDAIDVHMSDLLTGRT---------GLEDFHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_PSEHT      -------------------------------------SLEQFKGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_ECOLI      -------FHRAGFDAIDVHMSDLLTGRT---------GLEDFHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SHIDS      --------------------------------------LEDFHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_PSEAE      --------------------------------------LDAFKGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_ECO57      --------------------------------------LEDFHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_PSEPK      -----------------------------------AGRVDAFKGLVACGGFSYGDVLGAGESALFNARAR
PUR4_DICDI      --------------------------------------------VAFVGGFSYGDVMDAGSI-RFNQQVS
PUR4_SALTY      -----------------------------------------FHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SALTI      -----------------------------------------FHALVACGGFSYGDVLGAGEGWAKSILFN
PUR4_IDILO      -------------------------------------SLEDMQALAACGGFSYGDVLGAGEGWAKSILFN
PUR4_PSEPF      --------------------------------------------LVACGGFSYGDVLGAGESALFNSRAR
PUR4_RALSO      ------------------------------------------------GGFSYGDVLGAGETILFNGMLA
PUR4_MOUSE      --------------------------------------LDTFRGVAFVGGFSYADVLGSAAAVTFNPQAR
PUR4_PSEF5      -----------------------------------AGRVDLNDFMVACGGFSYGDVLGAGESALFNSRAR
PUR4_HAHCH      -------------------------------------SLSQFKALAACGGFSFGDVLGAGEGWAKSILFN
PUR4_NEIMB      ------------------------------------------------GGFSYGDVLGAGEGWAKSILFH
PUR4_XANAC      ------------------------------------------------GGFSYGDVLGAGRLEXXXXXXX
PUR4_NEIMA      ------------------------------------------------GGFSYGDVLGAGKGWAKSILFH
PUR4_NEIG1      ------------------------------------------------GGFSYGDVLGAGEGWAKSILFH
PUR4_XYLFT      ------------------------------------------------GGFSYGDVLGAGRGWATSILER
PUR4_XYLFA      ------------------------------------------------GGFSYGDVLGAGRGWATSILER
PUR4_SHESR      -------------------------------------SLEEFQGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SHESM      -------------------------------------SLEEFQGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_COLP3      -----------------------------------SGRADDFNGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_SHEON      -------------------------------------SLEEFQGLVACGGFSYGDVLGAGEGWAKSILFN
PUR4_METFK      -------------------------------------SLKDFAGFVACGGFSYGDVLGAGEGWAKSILFN
PUR4_CAEEL      ---------GSNGDREMASAFTLAGFQTFDVTMTDGHTLEAYRGVAFVGGFSYADVLGSAAGVQFNESVS
PUR4_SCHPO      --------------------------------------LDDFVGIAACGGFSYGDVLGSGSILLHEDARN
PUR4_MYXXD      -------------------------------------SLEGFKGVLACGGFSYGDVLGAGGGWAKSILFN
PUR4_HUMAN      --------------------------------------LDTFRGVAFVGGFSYADVLGSAAAVTFHPRAG
PUR4_XANCP      ----------------------------------------------------------------------
PURQ_LACCA      ----------------------------------------------------------------------
HIS5_METAC      ------------------------------------------DGIILPGVGAFIDAMKC-----LIPLKG
HIS5_METBF      ------------------------------------------DGLILPGVGAFVDAMKC-----LDPIKG
HIS5_METMA      ------------------------------------------DGIILPGVGAFIDAMKC-----LVPLKK
COBQ_POLSJ      ----VIAYPRIS-NLDEFQPLKNVPGVHLKWV-RSPGELAGVDWIILPGSHTSGDWLRAQGLDR------
HIS5_BACCZ      ------------------------------------------DGVILPG---VGAFPKAMDILEEKDLVR
HIS5_BACC3      ------------------------------------------DGVILPG---VGAFPKAMDILEEKDLVR
HIS5_BACC0      ------------------------------------------DGVILPG---VGAFPKAMDILEEKDLVR
HIS5_BACAN      ------------------------------------------DGVILPG---VGAFPKAMDILEEKDLVR
HIS5_BACAH      ------------------------------------------DGVILPG---VGAFPKAMDILEEKDLVR
HIS5_BACAC      ------------------------------------------DGVILPG---VGAFPKAMDILEEKDLVR
HIS5_BACAA      ------------------------------------------DGVILPG---VGAFPKAMDILEEKDLVR
COBQ_PROA2      ISIAVIYFPHISNFTD-FAVLEREEGVELHYL-HHAKALDGYQAVILPGSKNVRGDIEW---LRQQGWES
HIS5_WOLSU      -----------------------------------------YDRLILPGVGAFGDAMEHLVQ---SGMKE
HIS5_BACCQ      ------------------------------------------DGVILPG---VGAFPKAMDVLEEKDLVR
HIS5_BACC7      ------------------------------------------DGVILPG---VGAFPKAMDVLEEKDLVR
COBQ_CHLTE      ---------------------------------HRPKSLDGYKALILPGSKNVRGDL---AWLETMGWRD
COBQ_BURCM      ----------------------------VEFTYWKSGPVPDADLLILPGSKSVQRDLAWLRDAGWDAVIR
COBQ_SYNFM      ---GVVRLPSNYTDFDCLEHEPDVELLYFD----RPEQVFGFDAVILPGSKNTIEDL---AFLRKNGMAE
HIS5_BACWK      ------------------------------------------DGVILPG---VGTFPKAMGVLEEKDLVC
COBQ_METMJ      ----------------------------VDYV-PPGGTLSGYDCIILPGTKNTVEDL--AALNRHG--VG
GUAA_BORBU      ----------------------------------------------------------------------
COBQ_METPE      ----------------------------VDYLL-PGESLDGYDCIIIPGKNTVNDLLALQA----SGTAA
COBQ_METB6      ------------------------------------GSLAGYDCIIIPGTKNTIEDL---AALREAGTDR
HIS5_BACC1      ------------------------------------------DGVILPG---VGAFPKAMDVLEEKDLVR
COBQ_VIBVY      ----------------------------------KGERLEHADLIILPGSKSVRDDLR---YLREQGWDK
COBQ_VIBVU      ----------------------------------KGERLEHADLIILPGSKSVRDDLR---YLREQGWDK
COBQ_VIBCH      -------------------------------------SLSGADLIILPGSKSTRADL---AYLRSQGWDK
COBQ_VIBC3      -------------------------------------SLSGADLIILPGSKSTRADL---AYLRSQGWDK
COBQ_CHLPB      ----------------------------VHYLHHPKDLAD-YDAVILPGSKNVRGDLDWMI---FMGWKE
COBQ_BURVG      ----------------------------VEFTYWKSGPVPAADLLILPGSKSVQRDLQWLRDAGWDTVIR
COBQ_SHEON      ------------------------------------------DLLILPGSKNVRADL---AFLREQGWDK
HIS5_BACC2      ------------------------------------------DGVILPG---VGAFPKAMEVLEERDLVC
COBQ_TRIEI      ----------------------------IKYI-HPNDSLGDPDAIIIPGTTTINDLL----VLQKSGMAE
COBQ_SHEAM      ----VLVYPRTSNHTD-FDPLRLHPGVDFDYLDIQHASPDGADLVILPGSKNVRADLECLKTKGFDCALR
COBQ_METM7      ------------------------------------------DILILPG-------TRCSTVEKKHGMDK
COBQ_CYAA5      ----------------------------------------GYDAVIIPGSKTTINDL---IALHESGIAK
COBQ_CHLPD      ---------------------------------HFPRSLRGYQALILPGTKNVRDWLTSLGWAE------
HIS5_PYRFU      ------------------------------YITSDPYEIEKADKIVLPGVGNFG-----AVVDKLAPIKD
HIS5_BACCR      ------------------------------------------DGVILPG---VGAFPKAMDVLEERDLVC
HIS5_BACC4      ------------------------------------------DGVILPG---VGAFPKAMDVLEERDLVC
COBQ_VIBPA      ----------------------------------KGEKIDKADLIILPGTKSVRDDL---AYLKSQGWDK
COBQ_VIBFM      ----------------------------------KGESLSGADFIILPGSKSVQADLDYVKSQRWD---K
COBQ_CLOBH      ------------------------------------------DLLIIPGSKNTIEYLRCGLEERIK----
COBQ_CLOB1      ------------------------------------------DLLIIPGSKNTIEYLRCGLEERIK----
COBQ_XANP2      ----------------------------------------------------------------------
COBQ_VIBF1      ----------------------------------KGDSLSGADFIILPGSKSVQEYIKSQGWDK------
COBQ_PYRFU      ----------------------------VDYVT-KAEEIKG-DIIIIPGSKNTVEDL---IWMRENGIED
COBQ_POLNA      ------------------------------------------DWVILPGSKATSADL---AWLRAQGLDQ
COBQ_PELPB      ---------------------------------HYPRSLKGYKALILPGSKNVGDLAWLYSLGWEAEIRA
COBQ_METM5      ------------------------------------------DILILPG-------TRCSTVEKKHGLDK
COBQ_HALHL      ---------------DDLDALDAESGVHVRFA-RQPRELDGADLIVLPGSKHVFSDL---AWLRESGMAE


                         .         .         *         .         .         .         .:140
query           PVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVENDISPFTSLASRGSVIKVPI
PURQ_CARHZ      KVVEFANAGGLVIGICNGFQILLEAGLLPGAMLRNKSINFRCHDVYLRVENNNTPFTSKAHEGQVLKIPI
PURQ_MOOTA      AVIDFARSGGLVLGICNGFQILLEAGLLPGAMMRNACLQFRCQWTCLKVDNNATPFTNRFREGQVVRIPI
PURQ_BACC3      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_SALRD      DVVRFAEDGGLVFGICNGFQVLCEAGLLPGTLMRNESLRFVCKDTPLRVENAGTPFTNALTEGQVITIPV
PURQ_BACCZ      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACCQ      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACHK      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACC7      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACC2      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKNEIINIPI
PURQ_BACC1      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACC0      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACAN      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACAC      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACAA      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPI
PURQ_BACAH      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEIINIPI
PURQ_BACWK      AVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKNEVINIPI
PURQ_BACCR      AVQKAAEQGKPILGVCNGFQILVESGLLPGALIRNENLKFMCRTVQLRVENNETMFTSQYEKDEIINIPI
PURQ_BACCN      AVQKAAEQGKPILGVCNGFQILVESGLLPGVLIRNQNLKFMCRTVPLRVENNETMFTSQYNKGEIIHIPI
PURQ_BACC4      AVQKAAEQGKPILGVCNGFQILVESGLLPGALIRNENLKFMCRTVQLRVENNETMFTSQYEKDEIINIPI
PURQ_BACHD      DVIRAANEGVPVLGVCNGFQVLLEAGLLPGAMLRNEKLTFICKPVELEVQNNDTFFTSEYEQGETITIPV
PURQ_ACAM1      ATMAHAEQGKLVLGICNGFQVLTESGLLPGALVRNRDLHFICDRVPVRVERTNLPWTQAYQAGQVITLPI
PURQ_LISMO      EVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTELYEEGEIIQVPV
PURQ_BREBN      QVVKAADEGKLIMGICNGFQILTEVGLLPGALLRNRSLKFRCKLSELRVENNDTSFTRDFAAGEVIQIPI
PURQ_LISMH      EVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTELYEEGEIIQVPV
PURQ_GEOSW      AVKKAADEGKPVLGVCNGFQILLEAGLLPGAMRRNNSLKFICRPVSLRVENNETMFTSAYKQGEVITIPI
PURQ_ALKMQ      GVKVYAHAGGLVVGICNGFQILTEAGLLPGALVRNKGLKFICDTTPLKVTEANSPFTNQYQKGEVIQIPI
PURQ_LISMF      EVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTGLYKEGEIIQVPV
PURQ_LISMC      EVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTGLYKEGEIIQVPV
PURQ_ANAVT      QVVEHAQKGKLVLGICNGFQVLTEAGLLPGALARNRDLHFICDRVPLTVESTNSLWTQAYNPGEVITLPI
PURQ_ANASP      QVVEHAQKGKLVLGICNGFQVLTEAGLLPGALARNQDLHFICDRVPLTVESTNSLWTQAYNPGEVITLPI
PURQ_LISIN      EVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANADTMFTGLYEEGEIIQVPV
PURQ_LISW6      EVLRFAETGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVVNGNTIFTGLYEDNEVIHVPV
PURQ_ANOFW      AIKKAADEGKPILGVCNGFQILLEAGLLPGAMRRNNTLTFICRPIKLRVENNETMFTSQYEQGEVITIPI
PURQ_LYSSC      EVKKVADAGKPVLGVCNGFQILTEAGLLPGALLRNTNLKFMCRTVQLKVENNNTLFTNQYEQGQIIHIPI
PURQ_ACIBL      AVRKFADKGGLVIGICNGFQILTESGLLPGALLRNEGLKYICKPVNIRVETTDAPFTQGLKKGEVLQVPI
PURQ_THETN      AVREEAEKGKFIIGICNGFQILTEAGLLPGALRKNEGLKFICKTVSIIVENDKTPFTTRLKKGQEILLPI
PURQ_GEOTN      AVKQAAEAGKPVLGVCNGFQILLEAGLLPGAMRRNQGLKFICRPVQLVVENNETMFTSAYGKDEVITIPI
PURQ_SYMTH      AVAEFAARGGLVLGICNGFQILTEAGLLPGGFRPNAHGRYRCGWSRVRVENAATPFTLACRPGQVLKIPV
PURQ_BACSU      AVKQAAAEGKPVLGVCNGFQILQELGLLPGAMRRNKDLKFICRPVELIVQNDETLFTASYEKGESITIPV
PURQ_BACA2      AVKKAAAEGKPVLGVCNGFQILQELGLLPGAMRRNKDLKFICRPVELIVQNGGTLFTSSYEKGQSITIPV
PURQ_LACAC      AVENMAKEGKLVLGVCNGFQILTEMGLLPGALKKNDSLQFVCKTVTLEVENMHTPFTNEYADKEFIQIPI
PURQ_BACP2      AVKKAAAEGKPVLGVCNGFQILQELGILPGAMRRNKDLKFICRPVELIVENNETQFTSGYQKGESISVPV
PURQ_PELLD      EVVDAAGKGLPVLGICNGFQVLLESGLLDGALSRNRDKKFLCRDTYIRPVNSNTMFTGLYREDEVLSIPI
PURQ_LACS1      AVIEFAKNGKPVFGTCNGFQILTEVGLLPGALKQNNSLKFVCKTVELTVENTNTPFTSLYKKGEKINLPI
PURQ_SYNY3      AIIDHANAGKRVLGICNGFQVLTEVGLLPGALIRNRDLHFICDRVTVRVESNQTVWTKGYQSQQVITLPI
PURQ_THELT      SVSKAAENGVLIVGICNGFQILTEAGLLPGVLMKNKDLRFHCHDVYLRVDNNKTPFTLAYSEGEVIKMNI
PURQ_CHLP8      EVIDFAGQGRPVLGICNGFQVLVESGLLEGALIRNAGRKFICRQSTISVVNNSTIFTDRYEKGEVLRVPV
PURQ_GLOVI      AVRRHAERGGLVIGICNGFQVLTEAGLLPGALVRNRDLQFVCDRVALKVERTDLPWVHSYRPGEVITLPI
PURQ_BACSK      AVIQAAEAGKPVLGVCNGFQVLLEAGLLPGAMKRNIDLKFVCRTVELVVENNETMFSSGYEQGQTIRIPV
PURQ_EXISA      EVKRFAEEGRPVLGVCNGFQVLVEAGLLPGVLMRNRDLKFMCKTVDLVVENNETMFTSEYAAQETIRVPI
PURQ_OCEIH      KIREHAAKGKPVLGVCNGFQILTESGLLPGALMRNKHLSFMCHQEELVVEDNQTFFTSLYEKKEVVRFPI
PURQ_GEOKA      XXXXXXXXXXXXLGVCNGFQILLEAGLLPGAMRRNQGLKFICRPVQLTVENHETMFTSAYEKGEVITIPI
PURQ_LACF3      EVKRLADEGKPVFGTCNGFQILTEAGLLPGALKKNDSQNFVCKTTPLEVVNNQTIFTSQYQEHERINLPI
PURQ_EXIS2      EVKRFAAEGKTVLGVCNGFQILVEAGLLPGVLHRNTGLKFMCRTVELKVENNETRFTSDYAAQETITIPI
PURQ_BACLD      AVKKAAEEGKPVLGVCNGFQILQELGLLPGAMRRNKDLKFICRPVELIVQNNETLFTSSYGKGESITIPV
PURQ_LACDA      AIVEMAKAGKPVFGTCNGFQILTEAGLLPGALKRNDSLKFVCKTVELEVANNDTIFTSEYQKGEKINLPI
PURQ_CHLTE      EVIDFAGKGRPVLGICNGFQVLVECGLLEGALIRNAGRRFVSRQTTISVANNATIFTDRYQKGEVLRVPV
PURQ_SYNP6      ATVAFAEAGGLVLGICNGFQILTEVGLLPGALVRNRDLHFRCETTPLRVERSDRPWSRTYQQGQILNLPI
PURQ_SYNE7      ATVAFAEAGGLVLGICNGFQILTEVGLLPGALVRNRDLHFRCETTPLRVERSDRPWSRTYQQGQILNLPI
PURQ_NITWN      AVRAFASDGGLVLGVCNGFQILCESGLLPGILMRNARLKFICHDVHLRVERSDTPFTRGYNAGQVIRVPV
PURQ_NITHX      AVRAFAADGGLVLGVCNGFQILCESGLLPGILMRNARLKFICHDVHLRVERSDTPFTRGYNAGQVIRVPV
PURQ_DEIGD      AVKAHAERGGFVLGVCNGFQVLTEAGLLPGALSRNRDLHFRCAPVHLRVENAQTVFTRAYQPGQILEIPI
PURQ_SYNJB      SLKEHAARGGYVLGICNGFQILTEAGLLPGALVRNANLHFICDRVGIRVERQDLPWTSAYPQGSTLTLPI
PURQ_THERP      AVAREAEAGKPILGICNGFQILTEARLLPGALLRNASLEFVCDWVWVRVEQTRTPWTSQLAPGTLLRLPI
PURQ_BRAJA      AVRDYAAKGGLVLGVCNGFQILCESGLLPGVLMRNAQLKFICRDVHLRVERSDTPFTRGYNAGQVIRVPV
PURQ_PROMT      SLISFVDKGGKVLGICNGFQILTELGLLQGALTRNKNLHFICDRANLSIESTKSTWMKNYKKHDSISLPI
PURQ_METAC      SVKKIAAEGKPVLGICNGFQVLTEARLLAGALTTNEYPKFRCHWTNLRVETADTPFTSKFRKGEVIRMPI
PURQ_METMA      SIKKIASEGKPVLGICNGFQILTEARLLEGALTTNEYPKFRCHWTNLRVETANTPFTSKFRKGEVIKLPI
PURQ_ENTFA      EVIRFATEGKMVFGTCNGFQILTEIGLLPGTLLRNDSLRFICKSVPLKV-NTHTKFTSEYPENVSIHLPV
PURQ_LACLC      EIKRLAKEGKPVFGTCNGFQILVESGLLPGVLIRNEGLKFVSKWQVLKVENNQSNFTTEYAKDALINLPI
PURQ_METBF      SVKKLAAEGKPVLGICNGFQILTEARVLEGALTTNEYPKFRCHWTNLRVETVDTPFTSKFRKGEVIRMPI
PURQ_SYNJA      SLAEHGARGGYVLGICNGFQILTEAGLLPGALVRNANLHFICDRVGIRVERQDLPWTSAYPCGATLTLPI
PURQ_LACPL      AVIAFANAGKPVIGICNGFQVLTEAGLLPGALQANRSAKFICQDSPLRIANHETIFTTAYGSTDQISLPI
PURQ_LACSS      AVVAFAKAGKPVLGICNGFQILTEAGLLPGALLPNRQTHFICETVTLQVENNDTRFTNQYAKGATIALPI
PURQ_LACC3      ALKQFAAAGGYVIGICNGFQILTEAGLLPGALQWNRDLNFICEPVALTVENAGTAFSNQYQVGEHLTLPI
PURQ_CHLCH      EVVEFARKGYPVLGICNGFQVXXXXXXXXXXXXRNRDKKFLCCQTTITPVNCSTRFTEDYHQGEVLRIPI
PURQ_PROMM      SLVEFVARGGRVLGICNGFQVLTELGLLPGALTRNRSLHFICEDALLTVESNRTPWLMGHQRKDSLTLPI
PURQ_LACCB      ALKQFAAAGGYVIGICNGFQILTEAGFLPGALQWNRDLNFICEPVALTVENAGTAFSNQYQVGDHLTLPI
PURQ_LACRJ      AIIKMANEGKPVFGTCNGFQILTEAGLLPGGLKRNDSQRFVCKTVPLEVVNSHTLFTSHYQDHERIALPI
PURQ_LACRD      AIIKMANEGKPVFGTCNGFQILTEAGLLPGGLKRNDSQRFVCKTVPLEVVNSHTLFTSHYQDHERIALPI
PURQ_LACLA      EIKRLAKEGKPVFGTCNGFQILVESGLLPGVLIRNEGLKFVSKWQALKVENNQSNFTTEYAKDALINLPI
PURQ_DEIRA      AVKAHAEAGGYVLGVCNGFQVLTEAGLLPGALSRNKELHFMCKPVHLRVENNATDFSRAYGPGQIIEIPI
PURQ_ANADE      DLVTFAEKGGPVLGICNGFQILCEAGLLPGVLMRNASLKYICKDVTIRVEGQETPVTR-GLAGQSLTMPI
PURQ_AQUAE      AIYDFAQKGKYVIGICNGFQILTEXXXXXXXXXXXXXMRFVCKWVNLRVENERSAFTRKLEKGDVLRIPI
PURQ_RHOP2      AVRKFASDGGLVLGVCNGFQILCESGLLPGVLMRNARLKFICRDVHLRVERNDSPFTRGYAAGQVIKVPV
PURQ_SYNS9      SLMDFASKGGRVLGICNGFQVLTELGLLPGALTRNQNLHFICEDAPLHVSSTRTDWLKAYGNAASLVLPI
PURQ_RHORT      AVRRFAEAGGHVLGVCNGFQILTEAGLLPGALMRNRDLRFICRDVHLRVETIASPYTSAYGLGEVARVPV
PURQ_RHOPA      AVRKFAADGGLVLGVCNGFQILCESGLLPGVLMRNARLKFICRDVHLRVERNDTPFTQGYKAGQVIKVPV
PURQ_PYRHO      EIRELAEEGRPILGICNGFQILTEANLLPGALRPNKIPRFLCKWVHLKVVDVETPFTYLYEEGEVVRMPI
PURQ_PYRAB      EVREFAEEGRPVLGICNGFQVLTEAGLLPGALRPNKIPRFICKWIYLKVNDTNTAFTQLYEEGEIIRMPI
PURQ_SPHAL      AVAEAAGRGVPVLGVCNGFQVLTEAGLLPGALMRNAGLNFVCRTVPLKVENSQSLFTAAYGAGEEIAIPV
PURQ_PROM9      ALDEFVKSGKRVLGICNGFQILTESGFLPGALVANKNLNFICDDVELDIVSTKGGWFNNGDEKQTIKLPI
PURQ_RHIL3      AIIDKASKGVKVLGVCNGFQILVEAGLLPGALMRNSSLKFVCREIKLEVVNAETDFTRAYAQGQVIRCPV
PURQ_RHOPB      AVRKFASDGGLVLGVCNGFQILCESGLLPGVLMRNARLKFICHDVHLRVERSDTPFTRGYNAGQVIRVPV
PURQ_PROMP      SLHDFIKSGRRVLGICNGFQILTESGFLPGALVANKNLNFICDDVDLNVITSKGGWFQKLNENQNIKLPI
PURQ_METJA      GLKKMVEEGKPVLGICNGAQIGLEAGFSKGTLTNNLNAKFICKWVYIRVENNKTPFTQYYKKGEVLKIPI
PURQ_RHIEC      AIIDKAAKGVKVLGVCNGFQILVEAGLLPGALMRNASLKFVCREIKLKVVNAETDFTRAYAQGQVIRCPV
PURQ_PYRKO      EVKEFARDGKPVLGICNGFQVLTEAGLLPGALRPNKVPRFICRWVHLRVADTETPFTQFYEPGEVIRMPI
PURQ_PYRFU      EIRELAEEGRPILGICNGFQILTEAGLLPGALRPNKIPRFLCKWVHLKVVDVRTPFTYLYEEGEVVRMPI
PURQ_SYNSC      SLIDFAAKGGRVLGICNGFQVLTELGLLPGALTRNQNLHFICEDAPLKVVSQRTAWMQ-GYNDRALTLPI
PURQ_RHILO      AVAEKAAKGVTVIGVCNGFQILVEAGLLPGALMRNTSLKFVCRQIKLEITNANTMFTRRYQPGQVIRSPV
PURQ_BRUSU      AVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPV
PURQ_RHIME      AIKAKAEQGVRVLGVCNGFQILVEAGLLPGALMRNASLKFVCREVKLEVVNADTAFTRAYAKGQVIRSPV
PURQ_NOVAD      AVVRAAERGVTVLGVCNGFQVLTEAGLLPGALMRNAGIRFVCRDVKLTVENNQSLFTAGYDAGQQITIPV
PURQ_BARHE      AVREKAQKGVTVIGICNGFQILLEAGLLPGTLMRNTSLKFVCREIKLEVVNVNTKFSRYYSKGQIICCPV
PURQ_RUBXD      PLEAFAREGGPVLGVCNGFQVLCEAHLLPGALLQNXXXXXXXXXXXXXXXXADTPWTAACAPGEELTLPV
PURQ_BRUME      AVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPV
PURQ_BRUAB      AVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPV
PURQ_BRUA2      AVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPV
PURQ_THEEB      AVKDHAAAGKWVLGICNGFQILTEAKLLPGALVRNRDLHFICDRVHLRLEAKERPWLRAYGDKTVIRLPI
PURQ_GLUOX      DVKAFAGKGGHVLGVCNGFQILTESHLLPGALLRNAGLRFLSQDCHLKVENASSPYTQGWTRGDVFRAPL
PURQ_SULDN      AVIKYADDGGKVLGICNGFQVLTESGLLPGALKRNEXXXXXXXXXXXXVINNENIFLEKLDKGDIVNIPI
PURQ_STAHJ      EVKRLANDGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNENLKIANNQTPFTNLYGENEIVVYPV
PURQ_MESSB      AVAEKAAKGVLVIGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLQVANANTAFTRAYAPGQIIRCPV
PURQ_BARQU      AVREKAQKGVTVIGICNGFQILLEARLLPGALMRNTSLKFVCREIKLEVVNANTRFSRYYSKGQIIRCPV
PURQ_STAS1      AVKQFAKEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFVSRNESLRVVNHNTAFTNLYNEDETVVYPV
PURQ_WOLSU      AVIRYAKEGGKVLGICNGFQILVESGLLPGALRRNENLHFVSKFQKLAVVSNNNPFLREYAVSETLNIPI
PURQ_SILST      AVVAHAERGGYALGVCNGFQILTETGVLPGALLRNAGLKYICKTVDLAVATSDSAFTQGYNAGDVIGVPI
PURQ_METKA      EIRECAEDGRPVLGVCNGMQILAEAELIPGTLTVNVGNRFICDWVYLRVERTDTPFTTKYQEDEVIRVPI
PURQ_ZYMMO      AVIKQAERGVPVLGICNGFQILTEAGLLPGALMRNAGLSFICRNVGLEIQNTTSPFLRLYKKNQKIHLPV
PURQ_COREF      SVIEAAGRGMPVLGICNGFQILTEARLLPGALTRNQGLHFHCVDTHLEVVNTDTAWTGTLEQGQKILVPA
PURQ_THET8      AVRRFAEEGRYVVGVCNGFQILTEXXXXXXXXXXXXXXHFTCKEVGVRVERNDLPFTRLYPRGQVLRLPI
PURQ_THET2      AVRRFAEEGRYVVGVCNGFQILTEXXXXXXXXXXXXXXHFTCKEVGVRVERNDLPFTRLYPRGQVLRLPI
PURQ_STAES      EVKRFAKEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNETLKITNNQTPFTHLYVKNENVVYPV
PURQ_STAEQ      EVKRFAKEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNETLKITNNQTPFTHLYVKNENVVYPV
PURQ_PELUB      SVLNFAQGGGKVMGVCNGFQILVESGLLPGVLLRNKYLEFICKNVFVKANNDNSYFKD--DKKNIYEFHI
PURQ_LEIXX      EVVEAAGKGMPVLGICNGFQMLAEAILVPGGLIRNDHGNFICHAQRLTVENAETPWTGGFERGQKIVIPL
PURQ_PROMA      SLLEFVNKGGKVLGICNGFQILTELGLLPGALTRNQELHFICDTVPLLISSQRTQWFKNYNQSKNIFLPI
PURQ_ROSDO      SVAAHAERGGYVIGICNGFQVLTETGLLPGALLRNAGLKYICKTVALKVETSASAFTEGYTAGDTISIPI
PURQ_LEPIN      SVKEHVDKGGKLFGICNGFQILTEAEYLPGALIRNKTLKYICKTVILTKGSAGNPVTASMDVRKELKIPI
PURQ_LEPIC      SVKEHVDKGGKLFGICNGFQILTEAEYLPGALIRNKTLKYICKTVILTKGSAGNPVTASMDVRKELKIPI
PURQ_STAAR      EVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_STAAW      EVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_STAAN      EVKRLATEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_STAAM      EVKRLATEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_STAAC      EVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_STAAB      EVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNHTAFTNLYEQGEKVIYPV
PURQ_STAA8      EVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_STAA3      EVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_HELHP      VIKDFALQGGYVLGICNGFQILCEAGLLPGALKRNINLHFISQMQSLRIVSKNNAFLRSYAPNQEIRLPI
PURQ_SYNPX      XXXXXXXXXXRVLGICNGFQVLTELGLLPGALTRNRDLHFICEDAPLQVVSSRTPWLEHYGTDKALTLPI
PURQ_STAAS      EVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPV
PURQ_CAUCR      EXXXXXXXXXXXXXICNGFQVLTEVGLLPGALLRNAGLKYVCKPVELDIVNGQTRFTAGYGEQRQAVMTV
PURQ_STRAW      TVIEQAKSGMPVLGICNGFQILTEAHLLPGAMLGNNHLHFICRDQKLRVENADTAWTSDYEAGQEIHIPL
PURQ_SILPO      AVVAHTARGGYALGVCNGFQVLTETGILPGALLRNAGLKYICKTVGLKVETSNSVFTEGYNAGDVIGIPI
PURQ_METTH      AVRELVREEKPVLGICNGAQILAEVGLVPGVFTVNEHPKFNCQWTELRVKTTRTPFTGLFKKDEVIRMPV
PURQ_CAMJE      GVFNHAKKGGYILGICNGFQILLESGLLKGAMKHNNNLSFISKNQSLRVVSNDNAFLKNFKKDEIINLPI
PURQ_STRCO      TVIDQAKAGLPVLGICNGFQILTEAHLLPGGMLGNDHLHFICRDQKLRVENADTSWTSDYTAGQEIHIPL
PURQ_CORGL      SVIEQAGKGMPVLGICNGFQILTEARLLPGALTRNKGLHFHCVDAHLVVENNTTAWTNTLEKGQQILIPA
PURQ_RHOSR      KVVQAAQGGMPVLGICNGFQVLCEAGLLPGALTRNEGLHFICRDEWLKVEATSTAWTSRYESGAEILVPL
PURQ_CORAM      SVVDRARQGMPTLGICNGFQILTEAGLLEGALTRNKGLHFHCVDTHLEVVNNNTAWTTEFEAGDKIFVPA
PURQ_NOCFA      EVVRAAEQGMPVLGICNGFQVLCEAGLLPGALTRNEGLHFICRDQWLTVESVSTAWTSRYEPGAQILIPL
PURQ_HALWD      DIQAAAERGIPVLGVCNGAQVGCESGLTPGAFTTNDRARFQCETVHLRVENATTPWTEAYEAGTVIEIPI
PURQ_JANSC      AVADFAGQGGHVLGVCNGFQVLCETRLLPGVLMRNGGIKFVCRAEPLVVASATSPFTDGYSIGDRIAVPV
PURQ_MYCPA      EVVDAARRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPL
PURQ_METST      AIKDFAKKENPVLGICNGAQILGEIDLVPGVFIENENAKFICKSKKLKVNTTRTPFTKLYKKNEVIDLPI
PURQ_NATPD      DVREQAEAGVPVLGVCNGAQIGSEGDLTPGAFTTNRSARFQCEPVYLRVENAETPWTEAYEDGEVIEVPI
PURQ_CORJK      SVVAAAERGTPVLGICNGFQILQEAGLLPGALTRNEGLHFVCRDIYLDVENTSTAWTNQFAEGTKILVPS
PURQ_HALSA      EVRALAADGVPVLGVCNGAQIGCEAGLAPGAFTTNASARFQCERVHLRVENATTPWTAAYSEGDVLEIPI
PURQ_RHOS4      XXXRHAERGGYVLGICNGFQVLTETGLLPGALMRNAGLKFICRRVDLRVATADSAFTSGWAAGDAVRFPI
PURQ_MYCTU      EVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPL
PURQ_MYCBO      EVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPL
PURQ_FRASC      ALVPAARAGLPILGICNGFQVLCEAGLLPGALTRNVGLHFVCRDQRLRVEAPGTAWTRGYQDGEEIVIPV
PURQ_PROAC      SIRRAADGGLPVLGICNGFQVLCESHLLPGTLMRNEKRRFHCSVQQLQVASVDTVWTCDFRPSERIHIAA
PURQ_THEMA      XXXXXXXXGKLIMGICNGFQILIEMGLLKGALLQNSSGKFICKWVDLIVENNDTPFTNAFEKGEKIRIPI
PURQ_MYCLE      EVVDAVQRGMPVLGICNGFQVLCEAGLLPGALIRNVGLHFICRDVWLRVISTSTAWTSRFEPETDLLVSL
PURQ_SULSO      KVKQMAEDGKIVIGICNGFQILVESXXXXXXXXXXXXXRFISKWVYLKVIRADTILTKGLDK-KIIRMPI
PURQ_PYRAE      HVREDAERGVPVLGICNGFQILTEAGLLPGALIPNDPPGFISRWVAVRVVDTRTPFTYLYEEGEVVYMPI
PURQ_METTP      TLREEAANGKPIIGICNGFQILVESGILPFALAQNVMIGYYCAWTMLRAEEKRCSGSYILRRGEILSIPI
PURQ_PICTO      DINKFIDSGRFIIGVCNGFQVLTELGLFFNALTVNESNRFECRFTYIRLSTK-KVLSGLGNRP--FQVPV
PURQ_ARCFU      KDIEFIKMGYPILGICNGFQVLVELGALPGALAMNDSSRFECRPTLLKKESEKCIFVKNLKK-DVVMFPV
PURQ_METMP      DLTEFINSGKLILGICNGFQVMTNLGLLPSALESNTNNRYECRWVHIKENDSVCVFTKGIN---VTHVPI
PURQ_THEVO      KEIEFVDDGKPLIGICNGFQVLMEMGLIYDTLTNNESNRFECRYTYMKMTSRNRIFQSGFYGKGVFQVPV
PURQ_THEAC      KEIDFVDSGRPLIGICNGFQVIMEMGLIGKTLTNNESGRFECRYTYITMTSDNPIFRDAFKGKGSFQVPV
PURQ_METM7      DLKEFINSGKLILGICNGFQVMTNLGLLPSALEANTNNRYECRWVHIKENESICVFTKGID---IIHVPI
PURQ_METM5      DLKEFINSGKLILGICNGFQVMTNLGLLPSALEANTNNRYECRWVHVKENDSICVFTKGIT---ITHVPI
PURQ_TREDE      EVSEFVAAGKPVIGICNGFQVLVKSGILPGTLTYNKQGRFECRFTTMIPQKSNCIWTK-DLKGN-IHCPI
PUR4_ARATH      QFQEFYKRPDTFLGICNGCQLMALLGWVPGPFVHNESGRFECRFTSVTIKD--SPSIMLKGEGSTLGVWA
PUR4_VIBF1      DSTRFKREDTFSLGVCNGCQMLSNLDLIPGAEYRNESERFEARFSLVEVQKSDSVFFN-GMEGSRMPIAV
PUR4_DROME      PQFEFKRRQDVFLGICNGCQLMTLIGFVGSALLHNKSQRFECRWATVKIPSNRSIMLG-SMKDLVLGCWV
PUR4_PHOLL      ERVRFARPDTLALGVCNGCQMMSNLRLIPGAEHRNRSERFEARFSLVEITDSPSLFLQ-DMVGSRIPIAV
PUR4_PASMU      PMLRFANPNTLTLGVCNGCQMVSNAEIIPGTFVRNKSERFEARAALVRI-NETNSLWFQGMAGSHMPIAV
PURQ_DEHE1      KINRFHESGGLIIGICNGFQALVKTGILPGTLTENNSGRFECRWTYLAV----NPFSTCVFTQGILYLPV
PUR4_VIBPA      AQARFNREETFSLGVCNGCQMLSNLKLIPGAFVRNESERFEARFSLVEVQKSDSVFFD-GMAGSRMPIAV
PUR4_PHOPR      NIARFKRNDTFSLGVCNGCQMMSNLSLIPGSFVRNESERFEARFSLVEVQKSDSLFFNEMA-GSRMPIAV
PUR4_SHEDO      QRARFERDLSFALGVCNGCQMLSNLKIIPGSEHRNRSERFEARVSLVEVQQSPSLFFE-GMAGSRMPIAV
PUR4_VIBCH      XXXXXXXKDTFSLGVCNGCQMLSNLDLIPGAFVRNESDRFEARFSLVEVQKSPSLFFSEMA-GSRMPIAV
PUR4_ERWCT      ARVRFLRPQTLALGVCNGCQMMSNLRLIPGAFVRNKSDRFEARFSLVEVDKSPSLFMNDMA-GSRMPIAV
PUR4_VIBVY      AQARFNRENTFSLGVCNGCQMLSNLKLIPGAFVRNESERFEARFSLVEVQKSDSVFFD-GMAGSRMPIAV
PUR4_VIBVU      AQARFNRENTFSLGVCNGCQMLSNLKLIPGAFVRNESERFEARFSLVEVQKSDSVFFD-GMAGSRMPIAV
PUR4_PSESM      DAFQFERSDSFTLGVCNGCQMLSNLHLIPGSFVRNRSEQFEARVAMVQVQESASIFLQ-GMAGSRMPIAI
PUR4_PSEA6      AMARFERNETFSLGVCNGCQMLSNLSLIPGAEHTNQSERFEARVAMLEVKDSPSIFFK-GMQGSKMPIAV
PUR4_SHEFN      DRARFERDSSIALGVCNGCQMLSNLKIIPGSEHRNRSERFEARFSLVEVQQNPSVFFE-GMVGSRMPIAV
PUR4_PSEU2      DAFQFERSDSFTLGVCNGCQMLSNLHLIPGSFVRNRSEQFEARVAMVQVQESASIFLQ-GMAGSRMPIAI
PUR4_PSE14      DAFQFERADSFTLGVCNGCQMLSNLHLIPGSFVRNRSEQFEARVAMVQVQESASIFLQ-GMAGSRMPIAI
PUR4_MANSM      TALRFEREDTLALGVCNGCQMITLADIIPGTENRNTSERFEARAALVRINESNSVFQGMA--GSHMPIAV
PUR4_HAES1      TALRFHRQDTLALGVCNGCQMLSNAEIIPGTENRNKSERFEARVAMVRINNTHSVFDGMA--GSHMPIAV
PUR4_HAEI8      PKLHFINPNTLTLGVCNGCQMISNAEIIPGTENRNKSERFEARVSLVKI-NEVDSVWFAGMAGSHMPIAV
PUR4_ECOL5      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_SODGM      LRVRFHRPQTLALGVCNGCQMMSNLRLIPGAFVRNKSERFEARFSLVEVTQSQSLLLQ-GMVGSRLPIAV
PUR4_ECOUT      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_ECOL6      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_SALPA      PRVRFHRPQTLALGVCNGCQMMSNLRLIPGSFVRNHSDRFEARFSLVEVTQ--SPSLLLQGMGSQMPIAV
PUR4_SALCH      PRVRFHRPQTLALGVCNGCQMMSNLRLIPGSFVRNHSDRFEARFSLVEVTQ--SPSLLLQGMGSQMPIAV
PUR4_HAEIN      PKLHFINPNTLTLGVCNGCQMISNAEIIPGTENRNKSERFEARVSLVKI-NEVDSVWFAGMAGSHMPIAV
PUR4_YERPS      DRVRFHRPTTLALGVCNGCQMMSNLRLIPGAEHRNLSDSFEARFSLVEVASSPSLFMQ-DMVGSRMPIAV
PUR4_YERPN      DRVRFHRPTTLALGVCNGCQMMSNLRLIPGAEHRNLSDSFEARFSLVEVASSPSLFMQ-DMVGSRMPIAV
PUR4_YERPE      DRVRFHRPTTLALGVCNGCQMMSNLRLIPGAEHRNLSDSFEARFSLVEVASSPSLFMQ-DMVGSRMPIAV
PUR4_YERPA      DRVRFHRPTTLALGVCNGCQMMSNLRLIPGAEHRNLSDSFEARFSLVEVASSPSLFMQ-DMVGSRMPIAV
PUR4_YEAST      QFSKFERQDTFAFGACNGCQFLSRLDIIPGSFERNVSEQYEARVCMVQIEKDNSSEESVGMAGSKLPIAV
PUR4_SHISS      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_SHIBS      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_PSEHT      DMARFHREDTFSLGVCNGCQMLTLKELIPGTEHTNKSERFEARFSLVEIQENPSVFFN-GMAGSRMPIAV
PUR4_ECOLI      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_SHIDS      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_PSEAE      ARARFARKDSFALGVCNGCQMMSNLHLIPGTFVRNRSEQFEARVAMVQVQESSSIFLQ-GMAGSRLPIAI
PUR4_ECO57      DRVRFHRPQTLALGVCNGCQMMSNLRLIPGSERFVRNTSDRFEARFSLVEVTQSPSLLLQGMGSQMPIAV
PUR4_PSEPK      DAFQFERTDSFALGVCNGCQMMSNLHLIPGTEYRNRSEQFEARVAMVEVQKSNSIFLQ-GMAGSRMPIAI
PUR4_DICDI      KQFDYGRNDTFSLGLCNGCQLMALLGWVPYRGIEQTHQPRFIHNASGRFESKIMPSPALLLKGSVLGVWS
PUR4_SALTY      HRVRFHRPQTLALGVCNGCQMMSNLRLIPGSFVRNHSDRFEARFSLVEVTQ--SPSLLLQGMGSQMPIAV
PUR4_SALTI      HRVRFHRPQTLALGVCNGCQMMSNLRLIPGSFVRNHSDRFEARFSLVEVTQ--SPSLLLQGMGSQMPIAV
PUR4_IDILO      DRARFKRNDTLALGVCNGCQMLTLKQLIPGTEHTNRSERFEARFSLVEVQESKSIFLGDMA-GSRMPIAV
PUR4_PSEPF      DAFQFERNDSFTLGVCNGCQMMSNLHLIPGSFVRNRSEQFEARVAMVQVQESNSIFLQ-GMAGSRMPIAI
PUR4_RALSO      EQFAFNRADSIALGVCNGCQMMANAPIIPGAFTRNQSEQYEGRLVTVQVEASPSIFYA-GMEGSRIPIVV
PUR4_MOUSE      EELRFRRRPDTFLGVCNGCQLLALLGWVPGLLLRH-NLSGRFESRWATVRVEPGPALMLRGEGSVLPVWS
PUR4_PSEF5      DAFQFERTDSFTLGVCNGCQMMSNLHLIPGSFVRNRSEQFEARVAMVQVQESNSIFLQ-GMAGSRMPIAI
PUR4_HAHCH      ARARFHRKDTFALGVCNGCQMISNLKLIPGAFVRNRSEQYEARVAMVEVLDSPSILLQ-GMAGSMMPIAV
PUR4_NEIMB      PALRFADPDTLTLGVCNGCQMVSNAEIIPGTFKRNLSEQFEARLSMVHVPKSASLILN-EMQGSSLPVVV
PUR4_XANAC      XXXXXXXXXXXXLGVCNGCQMLSQLDIIPGAEHRNRSEQFEARTALLEVVESPSIFLR-GMAGSRIPVAV
PUR4_NEIMA      PALRFTDPNTLTLGVCNGCQMVSNAEIIPGTFKRNLSEQFEARLSMVHVPKSASLILN-EMQGSSLPVVV
PUR4_NEIG1      PALRFADPNTLTLGVCNGCQMVSNAEIIPGAFKRNLSEQFEARLNMVHVPKSASLILN-EMQDSSLPVVV
PUR4_XYLFT      TALRXXXXXXXXLGVCNGCQMLSQLSMIPGAEHRNRSEQFEARTALLEVIQSPSIFLS-GMAGSRLPVAV
PUR4_XYLFA      TALRXXXXXXXXLGVCNGCQMLSQLSMIPGAEHRNRSEQFEARTALLEVIQSPSIFLS-GMAGSRLPVAV
PUR4_SHESR      XXXXXXXXXXXXLGVCNGCQMLSNLKIIPGSEHRNRSERFEARFSLVEVQQSPSLFFQ-GMAGSRMPIAV
PUR4_SHESM      XXXXXXXXXXXXLGVCNGCQMLSNLKIIPGSEHRNRSERFEARFSLVEVQQSPSLFFQ-GMAGSRMPIAV
PUR4_COLP3      ANARFEREDTFTLGVCNGCQMLSNLDIIPGSEHQNKSERFEARFSLVEIQESPSVLFK-GMEGSRMPIAV
PUR4_SHEON      ---ERARNXXXALGVCNGCQMLSNLKIIPGSEHRNRSERFEARFSLVEVQQSPSLFFQ-GMAGSRMPIAV
PUR4_METFK      PRARFNRTDSFALGVCNGCQMMSNLSIIPGAGHRNRSEQFEARVAMVEVLDSPSLFFN-GMAGSRMPIAV
PUR4_CAEEL      KQFEASRPDTFSYGVCNGCQLMAQLGWIGDELDENECGRFDSSFGPVKIEKNVSIMLS-GMENSVLGLWS
PUR4_SCHPO      EFYRFERKDTFGLGICNGCQLFSRLSLIPGAFTFNESAQYEGRAVMLKIDETSSIFTE-SMAGSSLPVVV
PUR4_MYXXD      XXXXXXXXXXXXLGVCNGCQMMSQLDIIPGAEHRNASEQYEARLSLVEVSKTPSLFYQ-GMEGSRMLIVT
PUR4_HUMAN      AELRRFRKDTFSLGVCNGCQLLALLGWVPGLLLRH-NLSGRYESRWASVRVGPGPALMLRGEGAVLPVWS
PUR4_XANCP      ------------LGVCNGCQMLSQLDIIPGAEHRNRSEQFEARTALLEVVE--SPSILLRGMGSRIPVAV
PURQ_LACCA      ----------------------------------------------------------------------
HIS5_METAC      VIAEFAESGKPMLGICLGQQVLSEEGRLTGGLDLIQGRVLRFPKSELKVPHMGWNNIRIKQDHPLFK-GI
HIS5_METBF      TIEEYARSGKPMLGICLGQQVLSEEGKLTDGL-------------------DLISGKVLRFPKSELKVPI
HIS5_METMA      TIAEFAESGKPMLGICLGQQVLSEEGRLTDGLDLIQGRVLRFPKSELKVPNNIR-----VKQDHPLFKGI
COBQ_POLSJ      AVAAHAEQGGAVLGVCGGLQMLGEALIDPHGIDGN-----------------------------------
HIS5_BACCZ      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
HIS5_BACC3      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
HIS5_BACC0      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
HIS5_BACAN      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
HIS5_BACAH      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
HIS5_BACAC      MLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
HIS5_BACAA      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
COBQ_PROA2      RLEDFRRNGGVIAGICGGYQMLGRSIADPGVPGRTAGLDLLPVETVLQQEKTL-----------------
HIS5_WOLSU      AVLEFAKSGKPLLGICLGMQLLFE-----------KSYXXXXXXXXXXXXXXIIPFDK-TRMGEGYKIP-
HIS5_BACCQ      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
HIS5_BACC7      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
COBQ_CHLTE      EIEKFRKRGGIIVGLCGGYQML------------------------------------------------
COBQ_BURCM      ---RHLRYGGKVIGICGGMQMLDDPLGLEGAPASVPGLGLLDFDTTLQPDKTLKNVTGLALPGAA----A
COBQ_SYNFM      AVVAFYKSGGTVVGLCGGYQMMSDPHGVESSIREIAGLGLLDMETEMFQDKVTSQVTALNIGGSGLEV--
HIS5_BACWK      VLKEVGSLGKPLLGICLGMQLLFEKSLLPGVIRKLKVPYKIPHMGWLKKEGEISLWNGVEDGSFVYYVH-
COBQ_METMJ      EELRLARRGVPIIGICGGYQML------------------------------------------------
GUAA_BORBU      -----------ILGICYGMQIIVK--LFGGLVSKDSKQEYGSSEIFLRDEKSLL-FSELPNKFQII---M
COBQ_METPE      AIRDARGQGVPVIGICGGYQML------------------------------------------------
COBQ_METB6      EILSAREQGIPVIGICGGYQML------------------------------------------------
HIS5_BACC1      VLQEIGRSRKPLLGICLGMQLLFELSLLPGVIRKLKVPYKIPHMGWLKKEGEIALWNGVEDGSFVYYV--
COBQ_VIBVY      DILRHLRFGGKVLGICGGYQMLGES---------------------------------------------
COBQ_VIBVU      DILRHLRFGGKVLGICGGYQMLGES---------------------------------------------
COBQ_VIBCH      EILRHLRLGGKVMGICGGFQMLGE----------------------------------------------
COBQ_VIBC3      EILRHLRLGGKVMGICGGFQMLGE----------------------------------------------
COBQ_CHLPB      RLAEYRKRGGIIAGICGGYQML------------------------------------------------
COBQ_BURVG      ---RHLRYGGKVIGICGGMQML------------------------------------------------
COBQ_SHEON      QIAKHLRYGGKVLGICGGYQMLGERIADPLAIETSQGLGYLPISTEFKAEKQLGELTLIGQTVAVKGYEI
HIS5_BACC2      VLKEVCDIGKPLLGICLGMQLLFELGLLPGEIRKLKVSYKIPHMGWLRKEREFPLWNGLVDGSFVYYV--
COBQ_TRIEI      AIKSYQSSGGIVMGICGGFQMLGE----------------------------------------------
COBQ_SHEAM      ---KHVRYGGKLVGICGGYQML------------------------------------------------
COBQ_METM7      KIMEFIERGGIILGICGGYQTL------------------------------------------------
COBQ_CYAA5      QLQDYVAAGGIVLGICGGFQMLGEMVFDPDQLEGN-NVSY------------------------------
COBQ_CHLPD      KIREFRRDGGLIMGICGGYQML------------------------------------------------
HIS5_PYRFU      IIIEGINEGKPFLGICLGMQLLFELGIFKGKVVKLKNVR-TPHIGWNQVKKECKLFEGLKN---------
HIS5_BACCR      VLKEVCDIGKPLLGICLGMQLLFELGLLPGEIRKLKVSYKIPHMGWLRKEREFPLWNGLVDGSFVYYV--
HIS5_BACC4      VLKEVCDIGKPLLGICLGMQLLFELGLLPGEIRKLKVSYKIPHMGWLRKEREFPLWNGLVDGSFVYYV--
COBQ_VIBPA      DILRHIRLGGKVMGICGGYQML------------------------------------------------
COBQ_VIBFM      DIERHLRYGGKVMGICGGYQMLGEYLADPGAPCSIKGLGYLSISTELQKQKQLT----------------
COBQ_CLOBH      ---EYSREGKII-GICGGYQVLTDLGEIDGLNLLDMETTFEKEKVTTRVS---AKLLNEETKNTVYGYEI
COBQ_CLOB1      ---EYSREGKII-GICGGYQVLTDLGEIDGLNLLDMETTFEKEKVTTRVS---AKLLNEETKNTVYGYEI
COBQ_XANP2      -ILAFARRGGHVMGLCGGYQMLGE----------------------------------------------
COBQ_VIBF1      DIERHLRYGGKVMGICGGYQMLGEHLADPGVPCRVKGLGYLSISTELQKQKQLT----------------
COBQ_PYRFU      AIIEAHREGSFIVGICGGFQMLGE----------------------------------------------
COBQ_POLNA      AIAAHAGRGGAVLGICGGLQMLGEALIDPHGIDGN-----------------------------------
COBQ_PELPB      ----FRAEGGIIMGICGGYQMLGNSIADPGSAGTTKALALLDVETVLEQDKCLA-----NARGTVI----
COBQ_METM5      KILEFVENGGIVLGICGGYQTL------------------------------------------------
COBQ_HALHL      ALYRHCRYGGRVVGLCGGLQMLGE----------------------------------------------


                         +         .         .         .         .         *         .:210
query           AHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNPNGSVNNIAGICNEQGNVLGMMPHPERCAEE
PURQ_CARHZ      AHGEGNYYCEPDTLKKLIANGQVVFRYCNSRGEVTEDANPNGSLYNIAGIINEKGNVLGMMPHPERCSEN
PURQ_MOOTA      AHGEGNYYADAATLAQLEANRQIIFRYCSPDGEVTPAANPNGSVGNIAGIINREGNVLGMMPHPERCAEG
PURQ_BACC3      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_SALRD      SHGEGRYYADEDVLARIEANDQVLLRYSTADGAVTDEANPNGSVHGIAGLVNEAGNVCGLMPHPERCVES
PURQ_BACCZ      AHGEGNYYCDEETLKKLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACCQ      AHGEGNYYCDEETLKKLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACHK      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACC7      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACC2      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACC1      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACC0      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACAN      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACAC      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACAA      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACAH      AHGEGNYYCDEETLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACWK      AHGEGNYYCDEATLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACCR      AHGEGNYYCDEATLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACCN      AHGEGNYYCDEATLKKLEQKNQIVFRYVD---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVNE
PURQ_BACC4      AHGEGNYYCDEATLKQLEENNQIAFRYVE---------NPNGSVSDIAGIVNEKGNVLGMMPHPERAVDE
PURQ_BACHD      AHGEGNYYCDDETLKQLEANNQVVFRYTD---------RVNGSRNHIAGIVNKAGNVLGMMPHPERAVEQ
PURQ_ACAM1      AHGEGCYYADPETLKQLQANQQILFRYCQPNGEITPDSNPNGSVENIAGICNRQGNVVGMMPHPERASDP
PURQ_LISMO      AHGEGNYYCDDETLLKLKENNQIVFTY--------DSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEE
PURQ_BREBN      AHGEGNYYCDEETLAKLKANKQIVFRY--------HGENPNGSLEDIAGICNERGNVLGMMPHPERAVHS
PURQ_LISMH      AHGEGNYYCDDETLLKLKENNQIVFTY--------DSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEE
PURQ_GEOSW      AHGEGNYYCDEQTLKRLIENRQIVFRY--------HGENPNGSLDDIAGIVNEKGNVLGMMPHPERAVDS
PURQ_ALKMQ      AHGEGNYVVDEVTLAEMKTKGQILFTY---------GENPNGSTGDIAGICNEGKNVMGLMPHPERASEA
PURQ_LISMF      AHGEGNYYCDDETLLKLKDNNQIVFTY--------DSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEE
PURQ_LISMC      AHGEGNYYCDDETLLKLKDNNQIVFTY--------DSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEE
PURQ_ANAVT      AHGEGRFYADEATLSEIEDNGQVLFRYA--------GENPNGSLNNIAGICDRQGNVLGMMPHPERASDP
PURQ_ANASP      AHGEGRFYADEATLSEIEDNGQVLFRYA--------GENPNGSLNNIAGICDRQGNVLGMMPHPERASDP
PURQ_LISIN      AHGEGNYYCDDETLLKLKDNNQIVFTY--------DSVNPNGSRADIAGIVNERGNVLGMMPHPERAVED
PURQ_LISW6      AHGEGNYYCDDETLLKLKENNQIVFTY--------DSVNPNGSRADIAGIVNERGNVLGMMPHPERAVED
PURQ_ANOFW      AHGEGNYYCDEQTLQQLIANNQIVFRY--------EGENPNGSLFNIAGIVNEKGNVLGMMPHPERAVHE
PURQ_LYSSC      AHGEGNYYCDEETLQSLKDNNQIVFTY--------SGDNPNGSLEDIAGIINERGNVLGMMPHPERAVDA
PURQ_ACIBL      GHMEGNYVCDDATLAELKKQDRIVFRYATPDGQITREANPNGSIENIAGICNEGRNVLGMMPHPERASEN
PURQ_THETN      AHGEGNYYVDDKTLKELKGNNQIVFRYKE---------NINGSVERIAGVINKKGNVLGMMPHPERAYDS
PURQ_GEOTN      AHGEGNYYCDEQTLNRLVENRQIVFRY--------HGENPNGSLADIAGIVNERGNVLGMMPHPERAVDA
PURQ_SYMTH      SHGMGNYQADPDTLRALSENQQVLFRYCTPEGAVTPGANPNGSAENIAGIVNRTGNVAGVMPHPERATEQ
PURQ_BACSU      AHGEGNFYCDDETLATLKENNQIAFTY---------GSNINGSVSDIAGVVNEKGNVLGMMPHPERAVDE
PURQ_BACA2      AHGEGNFYCDDETLERLKENNQIAFTY---------GGDINGSVSGIAGVVNEKGNVLGMMPHPERAVDE
PURQ_LACAC      AHGDGSYYADENVLEELEDNHQVVFRY--------HGENPNGSLHDIAGICNKEGNVLGMMPHPERAVEE
PURQ_BACP2      AHGEGNFYCDEDTLAKLIENNQIAFTY---------GDDINGSVNRIAGITNEEGNVLGMMPHPERAVDS
PURQ_PELLD      AHGEGNYFAPPEVIESLEEHDQVVFRYTDREGHVSDEANPNGSVGNIAGIMNRNGNVLGLMPHPERASEK
PURQ_LACS1      AHADGSYYADXXXXXXXXXNGQVVFRY--------SKENPNGSLNDIAGITNKQGNVLGMMPHPERAVEM
PURQ_SYNY3      AHGEGRYFADGDTLKALEDNEQILFRYSNAQGELTTDSNPNGSLHNIAGITNVQGNVLGMMPHPERAADR
PURQ_THELT      AHGEGNYYFD----HCKEIEDKIVLRYCDRNGNITEDSNPNGSVLNIAGIVSKNGNVFGLMPHPERCSEK
PURQ_CHLP8      AHGEGNYYASVETIDSLESNGQVVFRYTDAEGNATAEANFNGSLNNIAGITNKQGNVLGLMPHPERASEE
PURQ_GLOVI      AHGEGCYYXXXXXXXXXXXNRQVVFRYCRPDGTIDAVGNPNGSLHNIAGLCNRHGNVLGMMPHPERASDP
PURQ_BACSK      AHGEGNYECDDETLAKLRENKQIVFRYNEH---------VNGSKGDIAGITNERGNVLGMMPHPERATET
PURQ_EXISA      AHGEGNYYCDDATLAALKANGQIAFTYKE---------NPNGSVENIAGITNEAGNVLGMMPHPERAVEA
PURQ_OCEIH      AHGEGSYFCDEATLKELQANNQIVFTYKN---------NPNGSIENIAGIRNKQGNVLGMMPHPERAVEE
PURQ_GEOKA      AHGEGNYYCDEQTLERLVENRQIVFRY--------HGENPNGSLADIAGIVNEQGNVLGMMPHPERAVDA
PURQ_LACF3      AHADGSYFADQATLDELEANHQVVFRYAE--------ENPNGSLNNIAGICNRAGNVLGMMPHPERAVEA
PURQ_EXIS2      AHGEGNYYCDDATYAMLQTNRQIAFTYTD---------NPNGSRGDIAGITNKAGNVLGMMPHPERAVEL
PURQ_BACLD      AHGEGNFYCDEETLAGLQENNQIAFTY---------GTDINGSVADIAGVVNEKGNVLGMMPHPERAVDS
PURQ_LACDA      AHADGSFYADPETLQKIEDNGQVVFRY--------SKENPNGSLNNIAGITNERGNVLGMMPHPERAVEA
PURQ_CHLTE      AHGEGNYYASPETIESLESNGQVVFRYTDAWGNATAEANFNGSMNNIAGIVNKQGNVLGLMPHPERASEK
PURQ_SYNP6      AHGEGRYHADPATLAALEANGQVLFRYLD---------NPNGSCNDIAGITNVAGNVLGMMPHPERAAEA
PURQ_SYNE7      AHGEGRYHADPATLAALEANGQVLFRYLD---------NPNGSCNDIAGITNVAGNVLGMMPHPERAAEA
PURQ_NITWN      AHGEGNYAADEDTIRRLEGEGRVLYRYCSASGEVGDTHNINGAAQSIAGIVNERGNVLGMMPHPENHVED
PURQ_NITHX      AHGEGNYAADEETIRRLEGEGRVLYRYCSATGEIGDTHNINGAAQSIAGIVNVRGNVLGMMPHPENHVED
PURQ_DEIGD      AHGEGNYYADPETIARLEAEGRVVFRYVD---------NPNGSLNDIAGIVNERGNVLGMMPHPERAVEA
PURQ_SYNJB      AHGEGRYTCDPDTLKQLQDRGQIVFRYAP--------VAPNGSVDNIAGICDPSGRILGLMPHPERAADP
PURQ_THERP      AHGEGRYYVEAEELVALETNGQVVFRYVDADGLPTADANPNGSVANIAGVCNERGNVVGLMPHPERAYDR
PURQ_BRAJA      AHGEGNYEADEETIQRLEGEGRVLYRYCSAEGVVDEAANINGAAHSIAGIVNDKGNVLGMMPHPENHVED
PURQ_PROMT      AHGEGRYQCSSDVLKKLQDDDSVALRYAD---------NPNGSIHDIAGITNKKGNVLGMMPHPERACDD
PURQ_METAC      AHMEGKFYAEESTLAELDENEQVVFRYVDEKGRVTDEANPNGSLENIAGILNASRNILGLMPHPERASES
PURQ_METMA      AHMEGKFYAEEATLAELDENEQVVFRYVDEKGRLTDKANPNGSLENIAGIVNSSRNVLGLMPHPERASES
PURQ_ENTFA      AHGEGNYYCDEKTLKELKEKNQIVFTYQE---------KVNGSLANIAGICNEQGNVLGMMPHPERAMEE
PURQ_LACLC      AHGEGQYVADEATLAELKENGQIVFTYAD--------ENPNGSVENIAGIINKEGNVLGMMPHPERAMEE
PURQ_METBF      AHMEGQFYAEEKTLAELDENEQVVFRYVDENGKVTDEANPNGSLENIAGIVNTSRNIFGLMPHPERASES
PURQ_SYNJA      AHGEGRYVCDADTLKQLQDRGQIVFRYAP--------VAPNGSVDNIAGICDPSGRILGLMPHPERAADP
PURQ_LACPL      AHGEGNYYCDEATLAQLRANHQIIFEYVE---------NPNGSTANIAGITNEAGNVLGMMPHPERAVEM
PURQ_LACSS      AHGEGNYYCDPETLAQLHANHQIAFTYT---------TDVNGSLDNIAGITNEAGNVLGMMPHPERAVEV
PURQ_LACC3      AHGEGNYYADPETLAALETNGQVVFRYAN---------NPNGSMHDIAGVTNETGNVLGMMPHPERAVEA
PURQ_CHLCH      AHGEGNYFAPPEVLESLQEHNQIAFQYCNAQGEVTVEANPNGSLLNIAGIVNRAGNVLGLMPHPERASDA
PURQ_PROMM      AHGEGRYQCSDETLCQLQDDDAIALRYVN---------NPNGSVADIAGITNKTGNVLGLMPHPERACDP
PURQ_LACCB      AHGEGNYYADPETLAALETNGQVVFRYAN---------NPNGSMHDIAGVTNETGNVLGMMPHPERAVEA
PURQ_LACRJ      AHADGSYYADEKTLDELEANNQVVFRYAT--------ENPNGSLHNIAGITNKHGNVLGMMPHPERAVET
PURQ_LACRD      AHADGSYYADEKTLDELEANNQVVFRYAT--------ENPNGSLHNIAGITNKHGNVLGMMPHPERAVET
PURQ_LACLA      AHGEGQYVADEAQLAELKANGQIIFTYAD--------ENPNGSVENIAGIVNKEGNVLGMMPHPERAMEE
PURQ_DEIRA      AHGEGNYYADAATIAELEEGGRVVFRYAD---------NPNGSLNDIAGIVNERGNVLGMMPHPERAVEL
PURQ_ANADE      AHAEGNYFADPETLDRLEGEGRVVFRYV--------GGAPNGSARDIAGISGGPANVVGLMPHPDRASES
PURQ_AQUAE      AHHDGRYYVPEEELRKMEENGQILFRYCDEQGEVKEEVNPNGSVSNIAGVMNKEGNVFGMMPHPERASED
PURQ_RHOP2      AHGEGNYEADEETVKRLEGDGRVLYRYCSPEGEIGESHXXXXXXXXXXXXVSERGNVLGMMPHPENHVED
PURQ_SYNS9      AHGEGRYQCSNDTLKQLQDQDCIALRY---------GSNPNGSVDDIAGITNPSGNVLGLMPHPERACDP
PURQ_RHORT      AHHDGNYFADDATLAQLADEDRVAFRYCAADGTVGEASTPNGSRDAIAGILSANRRVLGMMPHPENLVEP
PURQ_RHOPA      AHGEGNYEADEDTVKRLEGDGRVLYRYCSPEGEVGESHXXXXXXXXXXXXVSERGNVLGMMPHPENHVED
PURQ_PYRHO      AHAEGNYYIDNPSKVR------IVFQYSDEKGSITEEANPNGSVLNIAGVTNKQGNVLGMMPHPERASDR
PURQ_PYRAB      AHAEGNYYVDDPSRIR------IVFQYSDENGNLTEEANPNGSVMNIAGVSNEGGNVLGMMPHPERASDA
PURQ_SPHAL      AHHDGNYFADADTLDRIEGEGRVAFRYLD-------GV--NGSARDIAGVLNDAGNVLGMMPHPERAIDR
PURQ_PROM9      AHGEGRYHCDSDTLKKLVDNELIALRYKN---------NPNGSSFDIAGITNEKGNVLGLMPHPERACDE
PURQ_RHIL3      AHHDGNYFADDATLAAIEGNGQVVFRY-------AEGTNPNGSINDIAAVMNEKGNVLGMMPHPENLIEA
PURQ_RHOPB      AHGEGNYEADEETLQRLEGDGRVLYRYCSASGEVGEXXXXXXXXXXXXXXVSERGNVLGMMPHPENHVEA
PURQ_PROMP      AHGEGCYHCDQDTLKRLVDNDLIALKY---------KTNPNGSTSDIAGITNEKGNVLGLMPHPERACDE
PURQ_METJA      AHAEGRFYADDETLDYMYKNNMIVFKYCDETGEVTEEANPNGSIDNIAGVCNENQNCVLLMPHPERASEK
PURQ_RHIEC      AHHDGNYFADEATLAKIEGNGQVLFRY-------AEGTNPNGSINDIAGVMNEKGNVLGMMPHPENLIEA
PURQ_PYRKO      AHAEGNYYADDPSKVR------IAFQYSDEEGNITEEANPNGSLLNIAAIANENGNVLGTMPHPERASDR
PURQ_PYRFU      AHAEGNYYIDDPSKVR------IVFQYSDEKGSITEEANPNGSVLNIAGVANMEGNILGMMPHPERASHY
PURQ_SYNSC      AHGEGRYQCSDDTLKQLQDDDAIALSY---------GNNPNGSVFNIAGITNASGSVLGLMPHPERACDP
PURQ_RHILO      AHHDGNYFADAETLARLEGEGQVVFRY-------AEGTNPNGSINDIAGIINEQGNVLGLMPHPENLIEA
PURQ_BRUSU      AHHDGNYFADAETLKRLEGEGQVVFRY-------AEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEA
PURQ_RHIME      AHHDGNYFADAETLKAIEGNGQVVFRY-------AEGTNPNGSVNDIAGVLNAKGNVLGMMPHPENLIES
PURQ_NOVAD      AHHDGNYFADDATLDRIEGEGRVAFRYAE---------EVNGSARNIAGVLNDRGNVLGMMPHPERMIEA
PURQ_BARHE      AHHDGNYFVDSETLKQMEENEQIIFRY-------AENTNPNGSVNDIAGIINKAGNILGMMPHPENFIEP
PURQ_RUBXD      AHNEGNYFADPATLARLEEEGRVVLRYLE---------NPNGSANDIAGVCSEGRNVVGLMPHPERASDP
PURQ_BRUME      AHHDGNYFADAETLKRLEGEGQVVFRY-------AEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEA
PURQ_BRUAB      AHHDGNYFADAETLKRLEGEGQVVFRY-------AEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEA
PURQ_BRUA2      AHHDGNYFADAETLKRLEGEGQVVFRY-------AEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEA
PURQ_THEEB      AHGEGCYYADATTLAELEANRQVLFRYADAQGNVTPESNPNGSLXXXXXXXXXXXXVLGMMPHPERAADP
PURQ_GLUOX      AHGDGNYTASPETLKRLEGEGRVAFRYCGADGAVSRTTNPNGSTRSIAGILSENGRVCGLMPHPENLTDP
PURQ_SULDN      AHHDGNYYIDDSGLKELYANNQVLLKYCDENG---NDKNPNGSIDSIAGICNKERNVFGLMPHPERAMEA
PURQ_STAHJ      AHGEGHYYCTDDIYNELVENNQIILTYED---------NPNGSHENIAGIVNKAGNVCGMMPHPERALEK
PURQ_MESSB      AHHDGNFFAAPETLARIEGEGQVAFRY-------AEGTNPNGSINDIAGIVNGAGNVLGLMPHPENLVEA
PURQ_BARQU      AHHDGNYFVDNETLKQMEDNEQIVFRY-------AENTNPNGSIRDIAGIINKAGNILGMMPHPENFIEP
PURQ_STAS1      AHGEGHYYCTQDMYDRLEANNQIILKYVN---------NPNGSFNDIAGIINEQGNVCGMMPHPERAIEP
PURQ_WOLSU      AHADGNYFIDAKGLEELKENDQILLTY--------QGENPNGSIESIAGVCNKEKSVFGLMPHPERAMEP
PURQ_SILST      AHHDGNYYADDATVQMLKDQDRVAFTYVD---------NPNGSVADIAGILSENRRVLGMMPHPERAADE
PURQ_METKA      AHAEGRYYYENP--EEIEDN--VVFRFCGPDGDVSEEYNLNGSVGGITGVVNDDGNVLGMMPHPERAAHR
PURQ_ZYMMO      AHHDGNYTADEATLDQLEDEDRVALRYTE---------SVNGSARNIAGVLNKKGNVLGLMPHPERMIED
PURQ_COREF      KHGEGRFQAEPDTIRMLEEEGRVVFRYTD---------NFNGSINGIAGITNETGRVVGLMPHPEHAVET
PURQ_THET8      AHGEGRYYADPETLARLEGEGLVVFRYAPLKDE--ADYNPNGSLHDIAGIVSEKGNVLGMMPHPERAVDE
PURQ_THET2      AHGEGRYYADPETLARLEGEGLVVFRYAPLKDE--ADYNPNGSLHDIAGIVSEKGNVLGMMPHPERAVDE
PURQ_STAES      AHGEGHYYCTDEIYRELNDNNQIILKYTN---------NPNGSYEDIAGIVNKEGNVCGMMPHPERALET
PURQ_STAEQ      AHGEGHYYCTDEIYRELNDNNQIILKYTN---------NPNGSYEDIAGIVNKEGNVCGMMPHPERALET
PURQ_PELUB      AHNEGNYFCSNDQIKEINDNNQIALFYSDENGNVNEQSNPNGSLQNIAGVFNKQKNVLGMMPHPERMIDP
PURQ_LEIXX      KNGEGSFIASAEELKRLEGEGMVVFRY--------RGVNPNGSLNDIAGVRNERGNVVGLMPHPEHAVEP
PURQ_PROMA      AHGEGRYQCSESILKKLQDEDSIALKYKN---------NPNGSINDIAAITNKSGNVLGMMPHPERAA--
PURQ_ROSDO      AHHDGNYFADDETIARLQGEDRVAFTYED---------TPNGAKADIAGILSSNRRVLGMMPHPERAADA
PURQ_LEPIN      AHADGCYYATSDVLKQLEDEDRILFRY--------SGENPNGSLDSIAGITSKNFKIVGMMPHPERAMNP
PURQ_LEPIC      AHADGCYYATSDVLKQLEDEDRILFRY--------SGENPNGSLDSIAGITSKNFKIVGMMPHPERAMNP
PURQ_STAAR      AHGEGHYYCTDEIYQKLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_STAAW      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_STAAN      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_STAAM      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_STAAC      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_STAAB      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_STAA8      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_STAA3      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNEKGNVCGMMPHPERALET
PURQ_HELHP      AHADGNYFIDERELLELRANEQILLEYTD---------NPNGSVDSIAGICNEKKNVFGLMPHPERAIED
PURQ_SYNPX      AHGEGRYQCSDDTLKQLQDADAIALRY---------QANPNGSVADIAGITNDSGNVLGLMPHPERACDP
PURQ_STAAS      AHGEGHYYCTDEIYQQLKANNQIILKYVN---------NPNGSYDDIAGIVNKKGNVCGMMPHPERALET
PURQ_CAUCR      GNGEGNYFADEETLDRLEGEGQVVFRYKE---------NPNGSARDIAGIVNKGGNVLGLMPHPDRAFDA
PURQ_STRAW      KNMDGRYVADERTLDMLEAEGRVAFRXXXXXXXXXXXXNPNGSLRDIAGITNEAGNVVGLMPHPEHAVEP
PURQ_SILPO      AHHDGNYYADDETLAALKAEDRIAFTYTD---------NPNGARDDIAGILSANRRVLGMMPHPERAADA
PURQ_METTH      AHAEGRYY--HDNISEVWENDQVVLQF--------HGENPNGSLDGITGVCDESGLVCAVMPHPERASEE
PURQ_CAMJE      AHGEGNYYADETTLKELQDKDLIILKY---------EPNPNGSVFDIAGICDENKKIFGLMPHPERACEK
PURQ_STRCO      KNMDGRYVADRRTLDELEAEGRVAFRYLD--------MNPNGSLNDIAGITNAAGNVVGLMPHPEHAVES
PURQ_CORGL      KHGEGRFQADAETIAQLEGEGRVVFRYTD---------NFNGSVNDIAGITNETGRIVGLMPHPEHAVEK
PURQ_RHOSR      KSGEGRYQASENVLDELEGEGRVVFRYV--------GDNPNGSQRGIAGISSANGRVVGLMPHPEHATEA
PURQ_CORAM      KHGEGRFQAAPETIDKLEGEGQVVFRYTD---------NFNGSLNDIAGITNETGRIVGLMPHPEHAIET
PURQ_NOCFA      KSGEGRYQAAPAVLDELEGEGRVVFRY--------SGDNPNGSQRGIAGISSANGRVVGLMPHPEHATEA
PURQ_HALWD      AHGEGRFEITENEYEMLKNDNQILFRYCDASGNITDDANPNGSRGNVAGITGNYDTVAVLMPHPERATLP
PURQ_JANSC      AHHDGNYQIDDEGLSALRSEDRIAFTYAD---------NPNGSRADIAGVLSANRRVLGMMPHPERAVDV
PURQ_MYCPA      KSGEGRYVAPADVLDELEGEGRVVFRYHE---------NLNGSQRDIAGVSSADGRVVGLMPHPEHAIEA
PURQ_METST      AHKEGRYY--TDNLETLYDNNQIVLTFED--------GNPNGSLDNITGVCNVDGNVVAVMPHPERAVEK
PURQ_NATPD      AHGEGRFEIADDELETLVDEDRVIFRYCDADGNVTDAANPNGSKDNVAGVLGEHESVAVLMPHPERASLP
PURQ_CORJK      KHGEGRFQASXXXXXXXXXXXXVVFRYVE---------NHNGSRNSIAGVCSENGRVVGLMPHPEHAVET
PURQ_HALSA      AHGEGRFEIXXXXXXXXXXXXRVLFRYCNADGEVTEAANPNGSTGAVAGVTGDRDHVAVMMPHPERATLP
PURQ_RHOS4      AHHDGNYTADPETLARLRGEDRVAFTYLD---------NPNGSMEDIAGILSANRRVLGLMPHPERAVEE
PURQ_MYCTU      KSGEGRYVAPEKVLDELEGEGRVVFRYHD---------NVNGSLRDIAGICSANGRVVGLMPHPEHAIEA
PURQ_MYCBO      KSGEGRYVAPEKVLDELEGEGRVVFRYHD---------NVNGSLRDIAGICSANGRVVGLMPHPEHAIEA
PURQ_FRASC      KHGDGRYVAAPDVLAELEA--------AXXXXXXXXXXXXXXSAADIAGICNESRTIVGLMPHPEHAVDD
PURQ_PROAC      KHGEGNYVXXXXXXXXXXXNNRVVFRYT---------ANPNGSVHDIAGITNEAGNVVGLMPHPEHSVEE
PURQ_THEMA      AHGFGRYVKIDDV--------NVVLRYVK---------DVNGSDERIAGVLNESGNVFGLMPHPERAVEE
PURQ_MYCLE      KSGEGRYVASENVLDELDGEGRVVFRYHD---------NINGSLRDIAGISSANGRVVGMMPHPEHAIEV
PURQ_SULSO      AHAEGRYYVDDIDYAK----THMVLQYCDENGNISEDVNPNGSLLNIASIANEEGNVIGMMPHPERASTS
PURQ_PYRAE      AHGEGRYVPAGE--------YKAAFKYVD---------NPNGSYDNVAGVYEK--NVLGLMPHPERAVD-
PURQ_METTP      AHAEGNLVADRKVIERLIEDDQIVFRYCSPQGEIINPVNVNGSTENIAGISNPEGNVLGMMPHPER----
PURQ_PICTO      AHLEGRVYCDNKTLDELIENDQIIFRYVDNNGNYSYPWNPNGSIMNIAGITNDSGNVIGMMPHPER----
PURQ_ARCFU      AHAEGKVVFPSEYLERLTSNDQIVFRYVDEKGDYAYPWNPNGSFYNIAGICNATHTVFGLMPHPERAVGR
PURQ_METMP      AHGEGRFYCDEKTYHELKENKQIVFSYCDSEGNPANGLNPNGAYQDIAGICDKTGRIFGLMPHPER----
PURQ_THEVO      AHAEGRIVSERSVLKKLYENDQVVFKYSNEN-DVTDEYNPNGSIDSVASLSNEAGNVIGLMPHPER----
PURQ_THEAC      AHAEGRIAVSGVSVKRLYENDQVLFKYSDTHGVTDEYPNPNGSVDSIASLTNEHGNVIGLMPHPER----
PURQ_METM7      AHGEGRFYCDEKTYLELKENKQIVFTYCDSEGNPANPLNPNGAYYDIAGICDKSGRIMGLMPHPER----
PURQ_METM5      AHGEGRFYCDEKTYFELKENKQIVFSYCDSEGNSANPLNPNGAYYDIAGICDKTGRIMGLMPHPER----
PURQ_TREDE      AHGEGRFLTDSQTLDDLFEKGQIALVYIPANGEYP--FNPNGSLADIAGICNTKGNVLGLMPHPE-----
PUR4_ARATH      AHGEGRYFPDEGVLDHMLHSDLAPLRYCDDDGNVTEAYNLNGSPLGIAAICSPDGRHLAMMPHPERC---
PUR4_VIBF1      SHGEGRVVRDNDHLNAIENSGTVALRYVDNHGNPTQQYNPNGSPNAITGLTTTDGRVTIMMPHPER----
PUR4_DROME      AHGEGRFFRDEKLISHLQSEQLVTLQYVDDVGKPTEPLNPNGSPQGIAGLCSSDGRHLALMPHPERCS--
PUR4_PHOLL      SHGEGQVFRNRQHLEMLESNQLVALRYVNNYGQVTENANPNGSVNGITAVTSLDGRATVMMPHPERVSRT
PUR4_PASMU      SHGEGRVFKHDQQLQMLKDQNLIVAQYIDNNLNPTEPANPNGSVEGITALSNQDGRVAIMMPHPER----
PURQ_DEHE1      AHGEGKLLGSPEVINKL---NSVVY-YTDKDGKRNSPANPAGTLMDIAGIADESGRIFALMPHPERFAEG
PUR4_VIBPA      SHGEGRVVRDGEHLNAIEASGTVALRYVDNNGNPTQQYNPNGSPNAITGLTTADGRVTIMMPHPER----
PUR4_PHOPR      SHGEGRVVRNGEHLNAIEQSGTVALRYLDNFGNVTQNANPNGSPNGITGLTTMDGRVTIMMPHPER----
PUR4_SHEDO      SHGEGAEFASMQAMTAAESTGTVALRYVTGTGEIATQYNPNGSPNGLSGICSTDGKVTIMMPHPER----
PUR4_VIBCH      SHGEGRVVRDAQHLAAIEQSGTVAIRFVDNFGQPTQAYNPNGSPNAITGLTTQDGRVTIMMPHPER----
PUR4_ERWCT      SHGEGQVEVRDDALAAIEEHGLVALRYINHYGQVTENANPNGSSNGITAVTSTSGRATVMMPHPER----
PUR4_VIBVY      SHGEGRVVRDAQHLAAIEASGTVAVRFVDNLGNPTQQYNPNGSPNAITGLTTKDGRVTIMMPHPER----
PUR4_VIBVU      SHGEGRVVRDAQHLAAIEASGTVAVRFVDNLGNPTQQYNPNGSPNAITGLTTKDGRVTIMMPHPER----
PUR4_PSESM      AHGEGHAFRNDDALLEADVSGTVALRFVDNHGKVTESANPNGSPRGIGGMTTLDGRVTIMMPHPER----
PUR4_PSEA6      SHGEGRAFAQTTGLEAALDSNTIALQYVDNYGKVTEQANPNGSPAGISGLTSKDGRATIMMPHPER----
PUR4_SHEFN      SHGEGLVFXXXXXXXXXXXSGTIALRYVDGHGQIATQYNPNGSANGLTGICTTDGRVTIMMPHPER----
PUR4_PSEU2      AHGEGHAFRNDDALLEADVSGTVALRFVDNHGKVTETANPNGSPRGIGGMTTLDGRVTIMMPHPER----
PUR4_PSE14      AHGEGHAFRNDDALLEADVSGTVALRFVDNHGKVTETANPNGSPRGIGGMTTLDGRVTIMMPHPER----
PUR4_MANSM      SHGEGRVFKNDSQLQGLRDQGLIIAQYVDNNIRPTEPANPNGSVDGITALSNTNGRVAIMMPHPER----
PUR4_HAES1      SHGEGRIFKHDQQLQALKAQNLIAAQYIDSQLNPTEPANPNGSAEGITALSNSNGRVAIMMPHPER----
PUR4_HAEI8      SHGEGQVFKSVEQFAGLKAQGIIAAQYIDNNGSPTEPANPNGSAEGITAITNLDGRVAIMMPHPER----
PUR4_ECOL5      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_SODGM      SHGEGRVVRDAAHLAAIEHAGLVALRYVDNYGKVTENANPNGSPNGITAVTNASGRVTLTMPHPER----
PUR4_ECOUT      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_ECOL6      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_SALPA      SHGEGRVEVRDDALAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTENGRVTIMMPHPER----
PUR4_SALCH      SHGEGRVEVRDDALAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTENGRVTIMMPHPER----
PUR4_HAEIN      SHGEGQVFKSVEQFAGLKAQGIIAAQYIDNNGSPTEPANPNGSSEGITAITNLDGRVAIMMPHPER----
PUR4_YERPS      SHGEGQVVRDAAHLAALEQSHLVALRFVNNHGVVTEQANPNGSANGITAVTSVSGRATVMMPHPER----
PUR4_YERPN      SHGEGQVVRDAAHLAALEQSHLVALRFVNNHGVVTEQANPNGSANGITAVTSVSGRATVMMPHPER----
PUR4_YERPE      SHGEGQVVRDAAHLAALEQSHLVALRFVNNHGVVTEQANPNGSANGITAVTSVSGRATVMMPHPER----
PUR4_YERPA      SHGEGQVVRDAAHLAALEQSHLVALRFVNNHGVVTEQANPNGSANGITAVTSVSGRATVMMPHPER----
PUR4_YEAST      AHGEGKFSKSAEQLEKFEKDGLCCIRYVDNYGNVTERFNPNGSTNGIAGIKSPNGRVLAMMPHPER----
PUR4_SHISS      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_SHIBS      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_PSEHT      SHGEGHAFANDNAVKAALDSGTVAVKFVDYGNPTTQPANPNGSPEGITGITSTDGRATVMMPHPER----
PUR4_ECOLI      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_SHIDS      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_PSEAE      AHGEGHXXXXXXXXXXXXXXSGCVLRFVDNHGKVTEAANPNGSPRGITGLSSRDGRVTIMMPHPER----
PUR4_ECO57      SHGEGRVVRDAAHLAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTESGRVTIMMPHPER----
PUR4_PSEPK      AHGEGHXXXXXXXXXXXXDSGCVALRYVDNHGKVTEAANPNGSPRGITGLTSRDGRVTIMMPHPER----
PUR4_DICDI      QHGEGRFWSDQSIVNDIKANNLSPIRYVDDDGEITESYNPSGTQEGFASLCSKDGRHLAIMPHPER----
PUR4_SALTY      SHGEGRVEVRDDALAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTENGRVTIMMPHPER----
PUR4_SALTI      SHGEGRVEVRDDALAALESKGLVALRYVDNFGKVTETANPNGSPNGITAVTTENGRVTIMMPHPER----
PUR4_IDILO      SHGEGRAFANPXXXXXXXXXXXVALRYIDNWGEVAEQANPNGSPKGITAVTSDDGRVTAMMPHPER----
PUR4_PSEPF      AHGEGHXXXXXXXXXXXXXXSGVAMRFVDNHGKVTEAANPNGSPRGITGLTSRDGRVTIMMPHPER----
PUR4_RALSO      AHGEGYAFSQQGDIGKVA----VGLRYVDNRGEVTQTLNPNGSPQGIASVTTHDGRFTVLMPHPER----
PUR4_MOUSE      AHGEGYMFSSPELQAKIEAKGLVPLHWADDDGNPTEQLNPNGSPGGIAGICSQDGRHLALMPHPER----
PUR4_PSEF5      AHGEGHXXXXXXXXXXXXXXSGVALRFVDNHGKVTERANPNGSPRGITGLTSRDGRVTIMMPHPER----
PUR4_HAHCH      AHGEGLAEVGPEGAAALMAQKNVALRFVDNYGRPTMSFNPNGSPLGITSVCNDDGRITVMMPHPER----
PUR4_NEIMB      SHGEGRAFALHGG--NISADLGIALQYIDGQNQVTQTLNPNGSPQGIAGVTNADGRITIMMPHPER----
PUR4_XANAC      AHGEGRAEFDSAVDQAAA---RVALRYIDGDGAVASQLNPNGSPDGITGLTSSDGRVTILMPHPER----
PUR4_NEIMA      SHGEGRAFALHGG--NISADLGIALQYVDGQNQITQTLNPNGSPQGIAGVTNADGRVTIMMPHPER----
PUR4_NEIG1      SHGEGRAFALHGG--NISADLGIALQYVDGQNQVTQTLNPNGSPQGIAGITNADGRVTIMMPHPER----
PUR4_XYLFT      AHGEGYAMFDTPADQAAAH---VALRYINGHGQAATHLNPNGSPNGITGLTTTDGRITILMPHPERTPRT
PUR4_XYLFA      AHGEGYAMFDTPADQAAAH---VALRYINGHGQAATHLNPNGSPNGITGLTTTDGRITILMPHPERTPRT
PUR4_SHESR      SHGEGHXXXXXXXXXXXXXXGTIALRFVNGNGEIATQYNPNGSPNGLTGICTTDGRVTLMMPHPER----
PUR4_SHESM      SHGEGHXXXXXXXXXXXXXXGTIALRFVNGNGEIATQYNPNGSPNGLTGICTTDGRVTLMMPHPER----
PUR4_COLP3      SHGEGHAFXXXXXXXXXXXXGTVSMRYVNNYGDVTETANPNGSVDGITSLTTTDGRVTIMMPHPER----
PUR4_SHEON      SHGEGHXXXXXXXXXXXXXXGTIALRFVNGKGEIATQYNPNGSPNGLTGICTTDGRVTLMMPHPER----
PUR4_METFK      AHGEGYAFXXXXXXXXXXXXXLVTLRYVDNSGLPTEPFNPNGSPQGITGLTTADGRFSIMMPHPER----
PUR4_CAEEL      SHGEGRFYRNLQNFQNLKTNGQVCIRFCDDRGKLPYPWNPNGSIDDVAAICSRDGRHLAMMPHADR----
PUR4_SCHPO      AHGEGRFDSESDYEQFKKEGLDLIYYVNNYNERTSRPFNPNGSRDAIAGVRSPCGRFLAMMPHPER----
PUR4_MYXXD      SHGEGRAFPSVEDAARVNGLGLVTTRWVDNHGRVAESANPNGSPHGIAGLTTRDGRFTITMPHPER----
PUR4_HUMAN      AHGEGYVFSSPELQAQIEARGLAPLHWADDDGNPTEQLNPNGSPGGVAGICSCDGRHLAVMPHPER----
PUR4_XANCP      AHGEGR--AEFDTAVD-QAAARVALRFIDGDGAVASQLNPNGSPDGITGLTSTDGRATILMPHPERTPRS
PURQ_LACCA      -------------------------------------------MHDIAGVTNETGNVLGMMPHPERAVEA
HIS5_METAC      SDGSFVYFVHSYYVDTTAEN---TLASCEYGLDFS------------ASVVNSKGNVMGTQFHPEK----
HIS5_METBF      GWNNIKIKQDHPLFEGIPDNSFVYFVHSFYVDTASENASCNYGLDFSASVVNSKGNVMGTQFHPEK----
HIS5_METMA      PDGSFVYFVHSYYVDTAAEN---TLASCEYGLEYA------------ASVVNSKGNVMGTQFHPEK----
COBQ_POLSJ      ----------------------------------------------------------------------
HIS5_BACCZ      ----HSYYADCP--------NEIVYGISDY------GVKVPGFV--------AKGNIYGAQFHPEKS---
HIS5_BACC3      ----HSYYADCP--------NEIVYGISDY------GVKVPGFV--------AKGNIYGAQFHPEKS---
HIS5_BACC0      ----HSYYADCP--------NEIVYGVSDYGVEVPGFV--------------AKGNIYGAQFHPEKS---
HIS5_BACAN      ----HSYYADCP--------NEIVYGISDY------GVKVPGFV--------AKGNIYGAQFHPEKS---
HIS5_BACAH      ----HSYYADCP--------NEIVYGISDY------GVKVPGFV--------AKGNIYGAQFHPEKS---
HIS5_BACAC      ----HSYYADCP--------NEIVYGISDY------GVKVPGFV--------AKGNIYGAQFHPEKS---
HIS5_BACAA      ----HSYYADCP--------NEIVYGISDY------GVKVPGFV--------AKGNIYGAQFHPEKS---
COBQ_PROA2      ----------------------------------------------------------------------
HIS5_WOLSU      QMGWNRFYAKSPLLKGLEEGHAVAKREEDVLGESVYGYPFVSAI--------ERDNVAGFQPHPEK----
HIS5_BACCQ      ----HSYYADCP--------NEIVYGISEY------GVKVPGFV--------AKGNIYGAQFHPEKS---
HIS5_BACC7      ----HSYYADCP--------NEIVYGISEY------GVKVPGFV--------AKGNIYGAQFHPEKS---
COBQ_CHLTE      ----------------------------------------------------------------------
COBQ_BURCM      VHGYEIHMGDT------RGXXXXXXXXXXXXGDASGGVRPDGAVSADGQILATY--VHGLFDAPDACA--
COBQ_SYNFM      ----------------------------------------------------------------------
HIS5_BACWK      -----SYYADCP--------NEIVYGASEY------GVKVPGFV--------AKGNIFGAQFHPEKSGER
COBQ_METMJ      ----------------------------------------------------------------------
GUAA_BORBU      SHG--------DSIEKIPDNKQLAF-----------------TKNCIASISNETQKIYGLQFHPEVTHSE
COBQ_METPE      ----------------------------------------------------------------------
COBQ_METB6      ----------------------------------------------------------------------
HIS5_BACC1      ----HSYYADCP--------NEIVYGISDY------GVKVPGFV--------AKENIYGAQFHPEKS---
COBQ_VIBVY      ----------------------------------------------------------------------
COBQ_VIBVU      ----------------------------------------------------------------------
COBQ_VIBCH      ----------------------------------------------------------------------
COBQ_VIBC3      ----------------------------------------------------------------------
COBQ_CHLPB      ----------------------------------------------------------------------
COBQ_BURVG      ----------------------------------------------------------------------
COBQ_SHEON      HCGESQYLTSSDAAKPLRLINELT---CDEQAE----------KSFADGCLSEDGQVLGTYLHPDAC---
HIS5_BACC2      ----HSYYADCP--------DEIVCGVSDYGMQVPGFV--------------AKGNVFGAQFHPEKSGEQ
COBQ_TRIEI      ----------------------------------------------------------------------
COBQ_SHEAM      ----------------------------------------------------------------------
COBQ_METM7      ----------------------------------------------------------------------
COBQ_CYAA5      ----------------------------------------------------------------------
COBQ_CHLPD      ----------------------------------------------------------------------
HIS5_PYRFU      ----GSYFYFVHSYHAVPQDPDIIATTTDYE-----------NAEFVSSVCFE--NIFGVQFHPEKSSK-
HIS5_BACCR      ----HSYYADCP--------DEIVCGVSDYGMQVPGFV--------------AKGNVFGAQFHPEKSGEQ
HIS5_BACC4      ----HSYYADCP--------DEIVCGVSDYGMQVPGFV--------------AKGNVFGAQFHPEKSGEQ
COBQ_VIBPA      ----------------------------------------------------------------------
COBQ_VIBFM      ----------------------------------------------------------------------
COBQ_CLOBH      HMGISKY----------GENIKPLFKIYDKNGE---------KVDYFDGAINEKGNVMGTYIH-------
COBQ_CLOB1      HMGISKY----------GENIKPLFKIYDKNGE---------KVDYFDGAINEKGNVMGTYIH-------
COBQ_XANP2      ----------------------------------------------------------------------
COBQ_VIBF1      ----------------------------------------------------------------------
COBQ_PYRFU      ----------------------------------------------------------------------
COBQ_POLNA      ----------------------------------------------------------------------
COBQ_PELPB      ----------------------------------------------------------------------
COBQ_METM5      ----------------------------------------------------------------------
COBQ_HALHL      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ILGNIDGQLIFKSLLETWQRRxx
PURQ_CARHZ      ILGGEDGRVIWESIIAYLER---
PURQ_MOOTA      ILGGSDGRELLASIVDWWER---
PURQ_BACC3      LLGGAEGLKVFQSILKQWR----
PURQ_SALRD      LLGGDDGRLIFESLL--------
PURQ_BACCZ      LLGGAEGLKVFQSILKQWR----
PURQ_BACCQ      LLGGAEGLKVFQSILKQWR----
PURQ_BACHK      LLGGAEGLKVFQSILKQWR----
PURQ_BACC7      LLGGAEGLKVFQSILKQWR----
PURQ_BACC2      LLGGAEGLKVFQSILKQWR----
PURQ_BACC1      LLGGAEGLKVFQSILKQWR----
PURQ_BACC0      LLGGAEGLKVFQSILKQWR----
PURQ_BACAN      LLGGAEGLKVFQSILKQWR----
PURQ_BACAC      LLGGAEGLKVFQSILKQWR----
PURQ_BACAA      LLGGAEGLKVFQSILKQWR----
PURQ_BACAH      LLGGAEGLKVFQSILKQWR----
PURQ_BACWK      LLGGAEGLKVFQSILKQWR----
PURQ_BACCR      LLGGAEGLKVFQSILKQWR----
PURQ_BACCN      ILGGAEGLKVFQSILKYWR----
PURQ_BACC4      LLGGAEGLKVFQSILKQWR----
PURQ_BACHD      LVGGEDGLRLFKSILRNWR----
PURQ_ACAM1      TLGYTDGLLLFQGVLNS------
PURQ_LISMO      IIGGTDGLRLFESVVKAWK----
PURQ_BREBN      WMTSDDGRRMFTSILKTWREQ--
PURQ_LISMH      IIGGTDGLRLFESVVKAWK----
PURQ_GEOSW      LLGSADGLKLFQSIVKYWR----
PURQ_ALKMQ      LLGNVDGKKFFQSIM--------
PURQ_LISMF      IIGGTDGLRLFESVVKAWK----
PURQ_LISMC      IIGGTDGLRLFESVVKAWK----
PURQ_ANAVT      VLGGSDGLKLFQGLLE-------
PURQ_ANASP      VLGGSDGLKLFQGLLE-------
PURQ_LISIN      IIGGTDGLRLFESVVKAWK----
PURQ_LISW6      IIGGTDGLRLFQSIVQAWK----
PURQ_ANOFW      LLGGADGLKLFQSIVTYWR----
PURQ_LYSSC      LVGGADGLAVFKSIVKQWR----
PURQ_ACIBL      ELGMTDGFRIFESMVGAMAKR--
PURQ_THETN      LLGNTDGLYILGSIVDNF-----
PURQ_GEOTN      LLGSADGLKLFRSIVNYWR----
PURQ_SYMTH      VLGSADGRLLFASMVQ-------
PURQ_BACSU      LLGSADGLKLFQSIVKNWR----
PURQ_BACA2      LLGSADGLTLFRSIVKNWR----
PURQ_LACAC      ILGGIDGLPLFKSLLK-------
PURQ_BACP2      LLGSADGLKLFQSIVKNWR----
PURQ_PELLD      LLGSEDGRRLFASL---------
PURQ_LACS1      LLGNEDGLRVFKSLLE-------
PURQ_SYNY3      LLKATDGLAMFIS----------
PURQ_THELT      LLGSDNGKKIFESVALYLERR--
PURQ_CHLP8      LLGSGDGRRVFESL---------
PURQ_GLOVI      ILGGSDGRRLFESLV--------
PURQ_BACSK      LLGNDQGLAVFTSILRNWR----
PURQ_EXISA      LLGGEDGKRLFTSIVK-WGAR--
PURQ_OCEIH      LLGSDDGLKLFKSMIANWR----
PURQ_GEOKA      LLGSADGLKLFRSIVNYWR----
PURQ_LACF3      ILGNTDGLRVFKSLLE-------
PURQ_EXIS2      LTGGTDGLKLFTSLVK-------
PURQ_BACLD      LLGSADGLKLFQSIVKNWR----
PURQ_LACDA      LLGNTDGLRLFKSIL--------
PURQ_CHLTE      LLGSEDGRRLFESL---------
PURQ_SYNP6      IAGSVDGLGLFAGLLE-------
PURQ_SYNE7      IAGSVDGLGLFAGLLE-------
PURQ_NITWN      IMGCTDGRGLFAGLVAHLER---
PURQ_NITHX      IMGCTDGRGLFAGLVAHLER---
PURQ_DEIGD      LLGSEDGRGIFESL---------
PURQ_SYNJB      DLPGQDGIPFWQSILRSF-----
PURQ_THERP      FVGGDDGLRILASVL--------
PURQ_BRAJA      IMGCTDGRGLFAGLAQ-------
PURQ_PROMT      ALGDIDGKSILSTLL--------
PURQ_METAC      ILGSDDGRKVFESMAD-------
PURQ_METMA      ILGSDEGRKVFESMAD-------
PURQ_ENTFA      LLGSTDGRSFFASIIKNF-----
PURQ_LACLC      LLGGADGRKMFASLLKNF-----
PURQ_METBF      ILGSDDGLRVFESMVD-------
PURQ_SYNJA      DLPGQDGIPFWQSIVQS------
PURQ_LACPL      ILGSTDGLGIFQSVI--------
PURQ_LACSS      LLGSADGLGVFQSILTT------
PURQ_LACC3      LLGGTDGLGVFQSLI--------
PURQ_CHLCH      ALGSVDGRLLFESLFRS------
PURQ_PROMM      VIGGVDGRGLLQSLL--------
PURQ_LACCB      LLGGTDGLGVFQSLI--------
PURQ_LACRJ      ILGSTDGLRLFESLLE-------
PURQ_LACRD      ILGSTDGLRLFESLLE-------
PURQ_LACLA      LLGGADGVDLFASVLKNF-----
PURQ_DEIRA      LLGSEDGKGVFESL---------
PURQ_ANADE      ILGLEEGKRMFAALL--------
PURQ_AQUAE      ILGSHDGLMLWYSLL--------
PURQ_RHOP2      IMGCTDGRGLFAGLVE-------
PURQ_SYNS9      ATGGTDGRSMLKALL--------
PURQ_RHORT      ALGGIGGRALFQSIVES------
PURQ_RHOPA      IMGCTDGRGLFAGLAQ-------
PURQ_PYRHO      FLGSEDGLKVFKSIVE-WMKK--
PURQ_PYRAB      FLGSEDGLKVFRSMVEYAKR---
PURQ_SPHAL      AHGGTDGLRLFEAAL--------
PURQ_PROM9      TIGGTDGLFTLKSLI--------
PURQ_RHIL3      AHGGSDGRGLFASALD-------
PURQ_RHOPB      IMGCTDGRGLFAGLVE-------
PURQ_PROMP      SIGGIDGLYTLRSLI--------
PURQ_METJA      ILGSDDGLKMFKGMIDYAKR---
PURQ_RHIEC      AHGGSDGRGLFASALD-------
PURQ_PYRKO      FLGSEDGLKLFRSMVE-WARK--
PURQ_PYRFU      FLGSEDGLKVFKGMVE-WVR---
PURQ_SYNSC      AIGGTDGRRMLEALL--------
PURQ_RHILO      AHGGSDGRALFEGAL--------
PURQ_BRUSU      AHGGDDGRALFAGAL--------
PURQ_RHIME      AHGGADGRGLFASALD-------
PURQ_NOVAD      AHGGSDGRALFESVV--------
PURQ_BARHE      AHGGTDGRLFFQSALE-------
PURQ_RUBXD      LLGSGEGLGILRSVL--------
PURQ_BRUME      AHGGDDGRALFAGAL--------
PURQ_BRUAB      AHGGDDGRALFAGAL--------
PURQ_BRUA2      AHGGDDGRALFAGAL--------
PURQ_THEEB      ALSH-------------------
PURQ_GLUOX      EIGATDGVPLFKGLVE-------
PURQ_SULDN      ILGSDDGIKMLQGFL--------
PURQ_STAHJ      ILGTDSGVKLFEAMVNSWREQ--
PURQ_MESSB      AHGGTDGRALFESVL--------
PURQ_BARQU      AHSGTDGRLLFQSALE-------
PURQ_STAS1      ILGTDSGVKLFQAMVNSWREQ--
PURQ_WOLSU      LLGSVDGARMLRGL---------
PURQ_SILST      GHGGTDGVAMFRAL---------
PURQ_METKA      LLNSDDGLRLFESLVE-WCR---
PURQ_ZYMMO      AHGGKDGYNMFASLMQ-------
PURQ_COREF      LTGSVDGLELFLSAIGT------
PURQ_THET8      VLGNTDGLPFFLGLVK-------
PURQ_THET2      VLGNTDGLPFFLGLV--------
PURQ_STAES      LLGTNSGVKLFESMVKSWREQ--
PURQ_STAEQ      LLGTNSGVKLFESMVKSWREQ--
PURQ_PELUB      ALSGEDGSIFFQNLI--------
PURQ_LEIXX      GFG--------------------
PURQ_PROMA      -----------------------
PURQ_ROSDO      GHGGTDGQALFRAL---------
PURQ_LEPIN      ITGEMDGKVVLDLIL--------
PURQ_LEPIC      ITGEMDGKVVLDLIL--------
PURQ_STAAR      LLGTDSGVKLFEAMVKSWREQ--
PURQ_STAAW      LLGTDSGVKLFEAMVKSWREQ--
PURQ_STAAN      LLGTDSGVKLFEAMVKSWREQ--
PURQ_STAAM      LLGTDSGVKLFEAMVKSWREQ--
PURQ_STAAC      LLGTDSGVKLFEAMVKSWREQ--
PURQ_STAAB      LLGTDSGVKLFEAMVKSWREQ--
PURQ_STAA8      LLGTDSGVKLFEAMVKSWREQ--
PURQ_STAA3      LLGTDSGVKLFEAMVKSWREQ--
PURQ_HELHP      MLGSCDGKAMLDNLL--------
PURQ_SYNPX      ATGGTDGRVLLQGLL--------
PURQ_STAAS      LLGTDSGVKLFEAMVKSWREQ--
PURQ_CAUCR      DLGSEDGAVLFRSIFQS------
PURQ_STRAW      LIGRTDGLPFFTSILK-------
PURQ_SILPO      GHGGTDGVALFRAL---------
PURQ_METTH      ILGSVDGFKFFRGILK-------
PURQ_CAMJE      VLGNDVGLKMLKGFL--------
PURQ_STRCO      LIGRTDGLPFFTSILK-------
PURQ_CORGL      LTGSIDGLELFLSAVGT------
PURQ_RHOSR      LTGSDDGLGMFYSVLDS------
PURQ_CORAM      LTGSTDGLGLFVSAI--------
PURQ_NOCFA      LTGSDDGLGLFLSVLDT------
PURQ_HALWD      ELGSTDGKGILQA----------
PURQ_JANSC      AHGGTDG----------------
PURQ_MYCPA      LTGSDDGLGLFYSVLD-------
PURQ_METST      LLRSEDGLKFFKSFLD-------
PURQ_NATPD      DIGPTDGQ---------------
PURQ_CORJK      LTGSLDGLGLFQSVLST------
PURQ_HALSA      ALGATDGQ---------------
PURQ_RHOS4      AQGGADGMGLFRALL--------
PURQ_MYCTU      LTGSDDGLGLFYSALD-------
PURQ_MYCBO      LTGSDDGLGLFYSALD-------
PURQ_FRASC      LTGGVDGLRMFTSVL--------
PURQ_PROAC      LTGGTDGLGFFRSLM--------
PURQ_THEMA      LIGGEDGKKVFQSILNYLKR---
PURQ_MYCLE      LTGSDDGLGLFYSALDS------
PURQ_SULSO      IDGTVDGLILLRRLGE-------
PURQ_PYRAE      -----------------------
PURQ_METTP      -----------------------
PURQ_PICTO      -----------------------
PURQ_ARCFU      REGYGDGYCIFRSVVD-------
PURQ_METMP      -----------------------
PURQ_THEVO      -----------------------
PURQ_THEAC      -----------------------
PURQ_METM7      -----------------------
PURQ_METM5      -----------------------
PURQ_TREDE      -----------------------
PUR4_ARATH      -----------------------
PUR4_VIBF1      -----------------------
PUR4_DROME      -----------------------
PUR4_PHOLL      V----------------------
PUR4_PASMU      -----------------------
PURQ_DEHE1      LKEEGDGLKIFTNAVK-WARQ--
PUR4_VIBPA      -----------------------
PUR4_PHOPR      -----------------------
PUR4_SHEDO      -----------------------
PUR4_VIBCH      -----------------------
PUR4_ERWCT      -----------------------
PUR4_VIBVY      -----------------------
PUR4_VIBVU      -----------------------
PUR4_PSESM      -----------------------
PUR4_PSEA6      -----------------------
PUR4_SHEFN      -----------------------
PUR4_PSEU2      -----------------------
PUR4_PSE14      -----------------------
PUR4_MANSM      -----------------------
PUR4_HAES1      -----------------------
PUR4_HAEI8      -----------------------
PUR4_ECOL5      -----------------------
PUR4_SODGM      -----------------------
PUR4_ECOUT      -----------------------
PUR4_ECOL6      -----------------------
PUR4_SALPA      -----------------------
PUR4_SALCH      -----------------------
PUR4_HAEIN      -----------------------
PUR4_YERPS      -----------------------
PUR4_YERPN      -----------------------
PUR4_YERPE      -----------------------
PUR4_YERPA      -----------------------
PUR4_YEAST      -----------------------
PUR4_SHISS      -----------------------
PUR4_SHIBS      -----------------------
PUR4_PSEHT      -----------------------
PUR4_ECOLI      -----------------------
PUR4_SHIDS      -----------------------
PUR4_PSEAE      -----------------------
PUR4_ECO57      -----------------------
PUR4_PSEPK      -----------------------
PUR4_DICDI      -----------------------
PUR4_SALTY      -----------------------
PUR4_SALTI      -----------------------
PUR4_IDILO      -----------------------
PUR4_PSEPF      -----------------------
PUR4_RALSO      -----------------------
PUR4_MOUSE      -----------------------
PUR4_PSEF5      -----------------------
PUR4_HAHCH      ---------VFRAVANSWR----
PUR4_NEIMB      -----------------------
PUR4_XANAC      -----------------------
PUR4_NEIMA      -----------------------
PUR4_NEIG1      -----------------------
PUR4_XYLFT      I----------------------
PUR4_XYLFA      I----------------------
PUR4_SHESR      -----------------------
PUR4_SHESM      -----------------------
PUR4_COLP3      -----------------------
PUR4_SHEON      -----------------------
PUR4_METFK      -----------------------
PUR4_CAEEL      -----------------------
PUR4_SCHPO      -----------------------
PUR4_MYXXD      -----------------------
PUR4_HUMAN      -----------------------
PUR4_XANCP      V----------------------
PURQ_LACCA      LLGGTDGLGVFQSLI--------
HIS5_METAC      -----------------------
HIS5_METBF      -----------------------
HIS5_METMA      -----------------------
COBQ_POLSJ      -----------------------
HIS5_BACCZ      --GDIGMQILFKGVVETWK----
HIS5_BACC3      --GDIGMQILFKGVVETWK----
HIS5_BACC0      --GDIGMQMLFKGVVETWK----
HIS5_BACAN      --GDIGMQMLFKGVVETWK----
HIS5_BACAH      --GDIGMQILFKGVVETWK----
HIS5_BACAC      --GDIGMQMLFKGVVETWK----
HIS5_BACAA      --GDIGMQMLFKGVVETWK----
COBQ_PROA2      -----------------------
HIS5_WOLSU      -----------------------
HIS5_BACCQ      --GDIGMQMLFKGVVETWK----
HIS5_BACC7      --GDIGMQMLFKGVVETWK----
COBQ_CHLTE      -----------------------
COBQ_BURCM      -----------------------
COBQ_SYNFM      -----------------------
HIS5_BACWK      MLKN------FKGVVEAWK----
COBQ_METMJ      -----------------------
GUAA_BORBU      FGDQIIKNFVFK-----------
COBQ_METPE      -----------------------
COBQ_METB6      -----------------------
HIS5_BACC1      --GDIGMQMLFKGVVESWK----
COBQ_VIBVY      -----------------------
COBQ_VIBVU      -----------------------
COBQ_VIBCH      -----------------------
COBQ_VIBC3      -----------------------
COBQ_CHLPB      -----------------------
COBQ_BURVG      -----------------------
COBQ_SHEON      -----------------------
HIS5_BACC2      ILKN------FQGVVEAWK----
COBQ_TRIEI      -----------------------
COBQ_SHEAM      -----------------------
COBQ_METM7      -----------------------
COBQ_CYAA5      -----------------------
COBQ_CHLPD      -----------------------
HIS5_PYRFU      -----------------------
HIS5_BACCR      ILKN------FQGVVEAWK----
HIS5_BACC4      ILKN------FQGVVEAWK----
COBQ_VIBPA      -----------------------
COBQ_VIBFM      -----------------------
COBQ_CLOBH      -----------------------
COBQ_CLOB1      -----------------------
COBQ_XANP2      -----------------------
COBQ_VIBF1      -----------------------
COBQ_PYRFU      -----------------------
COBQ_POLNA      -----------------------
COBQ_PELPB      -----------------------
COBQ_METM5      -----------------------
COBQ_HALHL      -----------------------