[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50885.1

[Show Plain Result]


## Summary of Sequence Search
    1::513
    5::509       0.0  69%  509 aa  GUAA_CARHZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::516       0.0  68%  516 aa  GUAA_MOOTA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  66%  513 aa  GUAA_HELMI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  64%  510 aa  GUAA_CLOTE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  65%  510 aa  GUAA_ALKMQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  63%  510 aa  GUAA_CLOB6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  63%  510 aa  GUAA_CLOBL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  63%  510 aa  GUAA_CLOBK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  64%  510 aa  GUAA_GEOKA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  63%  510 aa  GUAA_CLOBH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  63%  510 aa  GUAA_CLOB1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  63%  510 aa  GUAA_CLOBM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  63%  510 aa  GUAA_CLOBJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  63%  510 aa  GUAA_CLOAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::509       0.0  63%  509 aa  GUAA_CLOPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  63%  510 aa  GUAA_CLOB8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::511       0.0  65%  511 aa  GUAA_CLOTH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::513       0.0  62%  513 aa  GUAA_BACHD RecName: Full=Putative GMP synthase
    4::513       0.0  65%  513 aa  GUAA_SYMTH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  64%  510 aa  GUAA_HALOH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  63%  512 aa  GUAA_CLONN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::511       0.0  63%  511 aa  GUAA_CALS8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::511       0.0  62%  511 aa  GUAA_CLOCE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::515       0.0  63%  515 aa  GUAA_BACSK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::513       0.0  63%  513 aa  GUAA_BACSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  61%  510 aa  GUAA_CLOK5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  61%  510 aa  GUAA_CLOK1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  62%  512 aa  GUAA_BACCN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  62%  512 aa  GUAA_BACC2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::513       0.0  63%  513 aa  GUAA_BACLD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515       0.0  62%  515 aa  GUAA_BACCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::513       0.0  62%  513 aa  GUAA_BACA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515       0.0  62%  515 aa  GUAA_BACHK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  62%  512 aa  GUAA_BACWK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515       0.0  62%  515 aa  GUAA_BACCZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  62%  512 aa  GUAA_BACC4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515       0.0  62%  515 aa  GUAA_BACC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  62%  512 aa  GUAA_BACC0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  62%  512 aa  GUAA_BACAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515       0.0  62%  515 aa  GUAA_BACAH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515       0.0  62%  515 aa  GUAA_BACAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515       0.0  62%  515 aa  GUAA_BACAA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  62%  510 aa  GUAA_NATTJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  62%  512 aa  GUAA_BACC1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::513       0.0  63%  513 aa  GUAA_BACP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::516       0.0  61%  516 aa  GUAA_LACAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512       0.0  61%  512 aa  GUAA_THETN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::511       0.0  61%  511 aa  GUAA_ANATD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::511       0.0  60%  511 aa  GUAA_OCEIH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::514       0.0  61%  514 aa  GUAA_EXIS2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  60%  513 aa  GUAA_STACT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::517       0.0  60%  517 aa  GUAA_LACGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::517       0.0  59%  517 aa  GUAA_LACJO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAA9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAA8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAA3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAEQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517       0.0  59%  517 aa  GUAA_LACRJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517       0.0  59%  517 aa  GUAA_LACRD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAES RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::513       0.0  59%  513 aa  GUAA_CLOBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::517       0.0  58%  517 aa  GUAA_LACDB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::517       0.0  58%  517 aa  GUAA_LACDA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::510       0.0  60%  510 aa  GUAA_SYNWW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_MACCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::518       0.0  58%  518 aa  GUAA_LISMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::513       0.0  59%  513 aa  GUAA_CLOBB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::514       0.0  58%  514 aa  GUAA_LISMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::518       0.0  58%  518 aa  GUAA_LISIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::510       0.0  58%  510 aa  GUAA_FINM2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::518       0.0  58%  518 aa  GUAA_LISW6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513       0.0  59%  513 aa  GUAA_STAHJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::514       0.0  59%  514 aa  GUAA_BRAHW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::535       0.0  59%  535 aa  GUAA_THEEB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   35::551     e-180  58%  551 aa  GUAA_GLOVI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::540     e-180  58%  540 aa  GUAA_ANAVT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::540     e-180  58%  540 aa  GUAA_ANASP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::540     e-180  58%  540 aa  GUAA_NOSP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   27::542     e-178  57%  542 aa  GUAA_SYNY3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::517     e-177  57%  517 aa  GUAA_PEDPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::542     e-177  56%  542 aa  GUAA_CYAP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::534     e-176  61%  534 aa  GUAA_FRASN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::542     e-176  57%  542 aa  GUAA_CYAA5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::528     e-176  58%  528 aa  GUAA_SYNPX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::527     e-176  59%  527 aa  GUAA_THERP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::533     e-175  56%  533 aa  GUAA_DEHSC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::533     e-175  56%  533 aa  GUAA_DEHE1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::511     e-175  58%  511 aa  GUAA_CLOD6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::528     e-175  58%  528 aa  GUAA_SYNS9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::528     e-174  58%  528 aa  GUAA_SYNSC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-174  57%  520 aa  GUAA_ENTFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-173  56%  517 aa  GUAA_STRMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::518     e-173  56%  518 aa  GUAA_LACPL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::527     e-173  55%  527 aa  GUAA_STRT2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::528     e-173  57%  528 aa  GUAA_PROM3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::527     e-172  55%  527 aa  GUAA_STRT1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::530     e-172  59%  530 aa  GUAA_PROAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-171  58%  528 aa  GUAA_PROM1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   80::587     e-171  56%  587 aa  GUAA_RHOBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::528     e-171  57%  528 aa  GUAA_PROMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-171  58%  528 aa  GUAA_PROM5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::528     e-171  58%  528 aa  GUAA_THEFY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-171  58%  528 aa  GUAA_PROMT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-171  57%  528 aa  GUAA_PROMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::518     e-171  56%  518 aa  GUAA_LACS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::510     e-171  57%  510 aa  GUAA_AQUAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::525     e-171  58%  525 aa  GUAA_STRAW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::534     e-170  55%  534 aa  GUAA_SYNP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-170  56%  528 aa  GUAA_PROM0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-170  54%  520 aa  GUAA_STRPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-170  55%  520 aa  GUAA_STRA5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-170  55%  520 aa  GUAA_STRA3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-170  55%  520 aa  GUAA_STRA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-170  57%  528 aa  GUAA_PROMP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-170  57%  528 aa  GUAA_PROM2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-170  57%  528 aa  GUAA_PROMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::542     e-170  55%  542 aa  GUAA_CYAP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::516     e-169  58%  516 aa  GUAA_NITSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRPZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRPM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRPF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::525     e-169  58%  525 aa  GUAA_RHORT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::515     e-169  56%  515 aa  GUAA_DESAD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::517     e-169  55%  517 aa  GUAA_LACCB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::517     e-169  55%  517 aa  GUAA_LACC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::517     e-169  54%  517 aa  GUAA_LACRH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::524     e-169  57%  524 aa  GUAA_EUBR3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::529     e-169  59%  529 aa  GUAA_CORJK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-169  54%  520 aa  GUAA_STRPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::526     e-169  58%  526 aa  GUAA_STRCO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::533     e-168  57%  533 aa  GUAA_GLUOX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-168  56%  528 aa  GUAA_SYNS3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-168  54%  520 aa  GUAA_STRS7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::540     e-167  54%  540 aa  GUAA_SYNP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRZP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::516     e-167  55%  516 aa  GUAA_DESPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::535     e-167  57%  535 aa  GUAA_BIFLO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-167  56%  520 aa  GUAA_PHEZH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::518     e-167  54%  518 aa  GUAA_BARHE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRZT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRR6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRPN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRPI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRP4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-167  55%  520 aa  GUAA_STRPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-167  56%  520 aa  GUAA_RHIEC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-167  56%  520 aa  GUAA_BRUSI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-167  56%  520 aa  GUAA_BRUAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-167  56%  520 aa  GUAA_BRUA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-167  56%  520 aa  GUAA_BRUA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  56%  520 aa  GUAA_BRUSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  56%  520 aa  GUAA_BRUC2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-166  54%  520 aa  GUAA_STRU0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::518     e-166  55%  518 aa  GUAA_BARQU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::520     e-166  54%  520 aa  GUAA_STRE4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  56%  520 aa  GUAA_RHIE6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::524     e-166  56%  524 aa  GUAA_EUBE2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  56%  520 aa  GUAA_BRUMB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  55%  520 aa  GUAA_AGRVS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-166  56%  520 aa  GUAA_GEOSF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  56%  520 aa  GUAA_BRUO2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  56%  520 aa  GUAA_RHILW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-166  55%  520 aa  GUAA_STRZJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-166  55%  520 aa  GUAA_STRPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-166  56%  520 aa  GUAA_RHIL3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::524     e-166  57%  524 aa  GUAA_NOCFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-166  56%  520 aa  GUAA_GEOMG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-165  54%  517 aa  GUAA_ALISL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-165  56%  520 aa  GUAA_AGRRK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-165  55%  517 aa  GUAA_VIBF1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-164  56%  520 aa  GUAA_RHISN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-164  55%  520 aa  GUAA_RHIME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::517     e-164  53%  517 aa  GUAA_LACSS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::515     e-164  55%  515 aa  GUAA_DESVM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-164  54%  517 aa  GUAA_VIBFM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   41::551     e-164  55%  551 aa  GUAA_BRAJA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::520     e-164  55%  520 aa  GUAA_PELPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::513     e-164  53%  513 aa  GUAA_LACLM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::515     e-164  54%  515 aa  GUAA_DESVV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::515     e-164  54%  515 aa  GUAA_DESVH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::525     e-164  58%  525 aa  GUAA_CORDI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-164  56%  521 aa  GUAA_AZOSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::516     e-163  55%  516 aa  GUAA_SULDN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-163  55%  520 aa  GUAA_GEOSL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-163  55%  520 aa  GUAA_SINMW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-163  54%  517 aa  GUAA_VIBVU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::540     e-163  56%  540 aa  GUAA_RHOPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::513     e-163  53%  513 aa  GUAA_LACLS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-163  54%  517 aa  GUAA_VIBVY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::523     e-163  57%  523 aa  GUAA_CORGL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::518     e-163  57%  518 aa  GUAA_RHOS5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-163  55%  520 aa  GUAA_PELCD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::513     e-163  53%  513 aa  GUAA_LACLA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::523     e-163  57%  523 aa  GUAA_COREF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::523     e-163  57%  523 aa  GUAA_CORGB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::518     e-163  54%  518 aa  GUAA_BARBK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   16::531     e-163  56%  531 aa  GUAA_OLICO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::521     e-163  55%  521 aa  GUAA_NEIMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::521     e-163  55%  521 aa  GUAA_NEIMB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::522     e-162  56%  522 aa  GUAA_ROSDO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::521     e-162  55%  521 aa  GUAA_NEIMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::521     e-162  55%  521 aa  GUAA_NEIM0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::535     e-162  56%  535 aa  GUAA_BRASO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::520     e-162  56%  520 aa  GUAA_CAUCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::520     e-162  56%  520 aa  GUAA_CAUCN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::521     e-162  55%  521 aa  GUAA_NEIG2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::521     e-162  55%  521 aa  GUAA_NEIG1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::516     e-162  54%  516 aa  GUAA_DESDG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::512     e-162  54%  512 aa  GUAA_FUSNN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::528     e-162  55%  528 aa  GUAA_PROM9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-162  55%  525 aa  GUAA_ALTMD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-161  54%  517 aa  GUAA_VIBSL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-161  54%  517 aa  GUAA_VIBPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::519     e-161  55%  519 aa  GUAA_SILPO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::540     e-161  56%  540 aa  GUAA_RHOP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::527     e-161  54%  527 aa  GUAA_PHOPR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::535     e-161  55%  535 aa  GUAA_NITWN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::518     e-161  57%  518 aa  GUAA_RHOSK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::518     e-161  57%  518 aa  GUAA_RHOS4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::526     e-161  55%  526 aa  GUAA_SALRD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::520     e-161  55%  520 aa  GUAA_RHILO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::525     e-160  55%  525 aa  GUAA_CHRVO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-160  53%  517 aa  GUAA_VIBHB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-160  53%  517 aa  GUAA_VIBCM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-160  53%  517 aa  GUAA_VIBCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::517     e-160  53%  517 aa  GUAA_VIBC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::520     e-160  55%  520 aa  GUAA_SILST RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::540     e-160  55%  540 aa  GUAA_NITHX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::518     e-160  57%  518 aa  GUAA_RHOS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::526     e-159  53%  526 aa  GUAA_THICR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::525     e-159  55%  525 aa  GUAA_AGRT5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::521     e-159  54%  521 aa  GUAA_WOLSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::550     e-159  54%  550 aa  GUAA_ACIAD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::526     e-159  55%  526 aa  GUAA_ZYMMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-159  54%  525 aa  GUAA_SHEPW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-159  54%  525 aa  GUAA_SHELP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  53%  525 aa  GUAA_PROMH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::529     e-158  54%  529 aa  GUAA_AERHH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-158  53%  525 aa  GUAA_SHEDO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-158  54%  525 aa  GUAA_SHEAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  53%  525 aa  GUAA_MARAV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_KLEP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SHISS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALPK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALNS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-158  53%  525 aa  GUAA_LEGPL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_KLEP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-158  53%  525 aa  GUAA_LEGPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-158  53%  523 aa  GUAA_ALCBS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SHIB3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO27 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::524     e-158  56%  524 aa  GUAA_CORAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SHIBS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-158  53%  525 aa  GUAA_SHESW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-158  53%  525 aa  GUAA_SHEPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-158  53%  525 aa  GUAA_SHEB9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-158  53%  525 aa  GUAA_SHEB8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-158  53%  525 aa  GUAA_SHEB5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALTY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALTI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALHS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALG2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALEP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALDC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SALA4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ESCF3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOUT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOSM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOLC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOL6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOL5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOK1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOHS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO8A RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO81 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO7I RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO5E RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO57 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO55 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECO45 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_SHIFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::535     e-158  54%  535 aa  GUAA_RHOPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOLI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECODH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_ECOBW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::527     e-158  55%  527 aa  GUAA_BURPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  53%  525 aa  GUAA_ENTS8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-158  54%  525 aa  GUAA_CITK8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-158  54%  511 aa  GUAA_ARCB4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  54%  525 aa  GUAA_SHIF8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  54%  525 aa  GUAA_ECOLU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-157  54%  525 aa  GUAA_SHEWM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  54%  525 aa  GUAA_SHIDS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  54%  525 aa  GUAA_SALSV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  54%  525 aa  GUAA_SALAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-157  55%  525 aa  GUAA_MYCTU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-157  55%  525 aa  GUAA_MYCTA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-157  55%  525 aa  GUAA_MYCBT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-157  55%  525 aa  GUAA_MYCBP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-157  55%  525 aa  GUAA_MYCBO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  54%  525 aa  GUAA_ECO24 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::510     e-157  54%  510 aa  GUAA_CAMFF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-157  53%  525 aa  GUAA_SHEB2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::526     e-157  54%  526 aa  GUAA_METFK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-157  53%  525 aa  GUAA_LEGPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::521     e-157  54%  521 aa  GUAA_AZOSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  53%  525 aa  GUAA_ALHEH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::526     e-157  54%  526 aa  GUAA_AERS4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  53%  525 aa  GUAA_TERTT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-157  53%  525 aa  GUAA_SHEFN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-157  51%  511 aa  GUAA_CAMHC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-157  52%  525 aa  GUAA_TOLAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-157  53%  525 aa  GUAA_SHESM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-157  53%  525 aa  GUAA_SHESA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::525     e-157  53%  525 aa  GUAA_LEGPH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::525     e-156  53%  525 aa  GUAA_PECCP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::525     e-156  53%  525 aa  GUAA_EDWI9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-156  52%  525 aa  GUAA_PSEPW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-156  53%  525 aa  GUAA_MARMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::520     e-156  52%  520 aa  GUAA_THIDA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::512     e-156  52%  512 aa  GUAA_SPIKU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-156  53%  525 aa  GUAA_SHEON RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-156  52%  525 aa  GUAA_PSEA6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-156  55%  525 aa  GUAA_MYCPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-156  53%  525 aa  GUAA_SHESR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::525     e-156  54%  525 aa  GUAA_MYCMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::529     e-156  55%  529 aa  GUAA_MYCLE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::529     e-156  55%  529 aa  GUAA_MYCLB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::525     e-156  53%  525 aa  GUAA_ERWCT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::544     e-156  55%  544 aa  GUAA_DECAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::527     e-156  55%  527 aa  GUAA_BURXL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::535     e-156  54%  535 aa  GUAA_POLSQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-156  53%  525 aa  GUAA_SHEPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::512     e-156  52%  512 aa  GUAA_OPITP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-156  52%  525 aa  GUAA_PSESM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-156  53%  523 aa  GUAA_HAEDU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-156  53%  525 aa  GUAA_SHEHH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   16::536     e-156  51%  536 aa  GUAA_PSYA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-156  53%  525 aa  GUAA_IDILO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::509     e-156  52%  509 aa  GUAA_CYTH3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-156  53%  511 aa  GUAA_CAMLR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::513     e-155  53%  513 aa  GUAA_SULNB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSE14 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::524     e-155  53%  524 aa  GUAA_METCA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::513     e-155  55%  513 aa  GUAA_GEMAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::523     e-155  53%  523 aa  GUAA_TREDE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-155  52%  521 aa  GUAA_XANCP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-155  52%  521 aa  GUAA_XANCB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-155  52%  521 aa  GUAA_XANC8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-155  52%  523 aa  GUAA_HAEIE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSEPK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  51%  525 aa  GUAA_PSEPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSEPF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-155  52%  511 aa  GUAA_CAMJR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSEU2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-155  52%  523 aa  GUAA_HAEIG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::535     e-155  54%  535 aa  GUAA_POLNS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::516     e-155  54%  516 aa  GUAA_CHLTE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSEP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSEMY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::514     e-155  54%  514 aa  GUAA_CHLT3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-155  51%  521 aa  GUAA_XANC5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSEF5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-155  52%  525 aa  GUAA_PSEE4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-155  54%  508 aa  GUAA_HELPY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-154  51%  525 aa  GUAA_YERE8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-154  52%  521 aa  GUAA_XANOR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-154  52%  521 aa  GUAA_XANOM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-154  52%  523 aa  GUAA_HAEIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::511     e-154  54%  511 aa  GUAA_CHLCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::527     e-154  55%  527 aa  GUAA_BURP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-154  52%  521 aa  GUAA_XANOP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-154  52%  525 aa  GUAA_SERP5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-154  52%  511 aa  GUAA_CAMJE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-154  52%  523 aa  GUAA_HAEI8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-154  52%  525 aa  GUAA_PSEFS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::520     e-154  55%  520 aa  GUAA_DINSH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::507     e-154  53%  507 aa  GUAA1_BACTN RecName: Full=GMP synthase [glutamine-hydrolyzing] 1;  
    1::503     e-154  56%  503 aa  GUAA_LEIXX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-154  55%  539 aa  GUAA_RALEH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-154  54%  508 aa  GUAA_HELPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-154  52%  511 aa  GUAA_CAMJJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-154  52%  511 aa  GUAA_CAMJ8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-154  51%  521 aa  GUAA_XANAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::522     e-154  53%  522 aa  GUAA_NITMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-154  54%  513 aa  GUAA_CHLL2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::507     e-154  53%  507 aa  GUAA_BACFR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::507     e-154  53%  507 aa  GUAA_BACFN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_YERP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::526     e-153  52%  526 aa  GUAA_PSYIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-153  54%  513 aa  GUAA_PELPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-153  52%  523 aa  GUAA_ACTPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::507     e-153  52%  507 aa  GUAA_PETMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-153  53%  513 aa  GUAA_PELLD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::516     e-153  51%  516 aa  GUAA_DESMR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::506     e-153  53%  506 aa  GUAA_PORGI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-153  52%  523 aa  GUAA_PASMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::511     e-153  53%  511 aa  GUAA_DEIDV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-153  55%  539 aa  GUAA_CUPTR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-153  55%  539 aa  GUAA_BURM1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-153  55%  530 aa  GUAA_BORBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  51%  525 aa  GUAA_SODGM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::525     e-153  51%  525 aa  GUAA_PHOLL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::511     e-153  52%  511 aa  GUAA_CAMJD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::506     e-153  53%  506 aa  GUAA_PORG3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-153  54%  508 aa  GUAA_HELP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-153  55%  539 aa  GUAA_BURS3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-153  51%  521 aa  GUAA_STRMK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::521     e-153  51%  521 aa  GUAA_STRM5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::511     e-153  54%  511 aa  GUAA_MYCPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-153  54%  508 aa  GUAA_HELPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::525     e-153  51%  525 aa  GUAA_HAMD5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-153  55%  539 aa  GUAA_BURCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-153  55%  539 aa  GUAA_BURCC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-153  55%  539 aa  GUAA_BURCA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-153  52%  523 aa  GUAA_ACTP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-153  52%  523 aa  GUAA_ACTP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-153  54%  539 aa  GUAA_RALEJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-153  53%  525 aa  GUAA_ENT38 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-153  51%  523 aa  GUAA_ACTSZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-152  54%  539 aa  GUAA_RALME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-152  54%  508 aa  GUAA_HELAH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-152  55%  530 aa  GUAA_BORPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::525     e-152  52%  525 aa  GUAA_SHESH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-152  54%  508 aa  GUAA_HELPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-152  55%  530 aa  GUAA_BORPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-152  52%  525 aa  GUAA_PSEHT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::526     e-152  52%  526 aa  GUAA_HAHCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-152  52%  525 aa  GUAA_COLP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-152  51%  523 aa  GUAA_MANSM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-152  51%  523 aa  GUAA_HAEPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::510     e-152  54%  510 aa  GUAA_ELUMP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-152  52%  525 aa  GUAA_CELJU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::522     e-152  51%  522 aa  GUAA_XYLFM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::524     e-152  51%  524 aa  GUAA_COXBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-152  51%  523 aa  GUAA_HAES1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::547     e-152  54%  547 aa  GUAA_BURPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-152  55%  539 aa  GUAA_BURP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::547     e-152  54%  547 aa  GUAA_BURP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-152  55%  539 aa  GUAA_BURP0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-152  55%  539 aa  GUAA_BURMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-152  55%  539 aa  GUAA_BURMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-152  55%  539 aa  GUAA_BURM9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-152  55%  539 aa  GUAA_BURM7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-151  52%  513 aa  GUAA_THEM4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-151  50%  525 aa  GUAA_PSEAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-151  50%  525 aa  GUAA_PSEA8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::539     e-151  54%  539 aa  GUAA_MICLC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::508     e-151  53%  508 aa  GUAA_HELPH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-151  55%  539 aa  GUAA_BURVG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-151  54%  539 aa  GUAA_BURCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-151  54%  539 aa  GUAA_BURA4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-151  55%  539 aa  GUAA_RALPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::525     e-151  50%  525 aa  GUAA_PSEAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-151  52%  539 aa  GUAA_JANMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-151  54%  539 aa  GUAA_BURCM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::523     e-151  51%  523 aa  GUAA_HAES2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-151  54%  513 aa  GUAA_CHLPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::531     e-151  53%  531 aa  GUAA_BORPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::517     e-151  53%  517 aa  GUAA_BACV8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::522     e-151  51%  522 aa  GUAA_XYLFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::547     e-150  54%  547 aa  GUAA_RALSO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-150  52%  513 aa  GUAA_PROVI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::524     e-150  52%  524 aa  GUAA_NITOC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::539     e-150  52%  539 aa  GUAA_HERAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::522     e-150  51%  522 aa  GUAA_XYLFT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::522     e-150  51%  522 aa  GUAA_XYLF2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::506     e-150  53%  506 aa  GUAA_DEIRA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::530     e-149  53%  530 aa  GUAA_BORA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::513     e-149  51%  513 aa  GUAA_THEAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::530     e-149  53%  530 aa  GUAA_CANAL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::501     e-148  53%  501 aa  GUAA_THESQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::501     e-148  53%  501 aa  GUAA_THEMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::527     e-148  52%  527 aa  GUAA_YARLI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::501     e-148  53%  501 aa  GUAA_THEP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   16::529     e-148  52%  529 aa  GUAA_DEBHA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::524     e-147  52%  524 aa  GUAA_KLULA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::524     e-147  50%  524 aa  GUAA_COXBU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::524     e-147  50%  524 aa  GUAA_COXB2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::525     e-146  51%  525 aa  GUAA_YEAST RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::506     e-146  51%  506 aa  GUAA_PARD8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::524     e-146  50%  524 aa  GUAA_COXBN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::525     e-146  52%  525 aa  GUAA_ASHGO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::514     e-146  52%  514 aa  GUAA_CHLPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::524     e-146  50%  524 aa  GUAA_COXB1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::519     e-145  50%  519 aa  GUAA_NITEU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::505     e-145  51%  505 aa  GUAA_DEIGD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::536     e-145  52%  536 aa  GUAA_RHOFD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::526     e-145  53%  526 aa  GUAA_EHRCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::534     e-144  52%  534 aa  GUAA_METPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::526     e-144  53%  526 aa  GUAA_EHRCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::525     e-144  50%  525 aa  GUAA_CANGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::521     e-143  49%  521 aa  GUAA_VESOH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::542     e-143  53%  543 aa  GUAA_USTMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   16::541     e-143  53%  541 aa  GUAA_PHANO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-142  50%  516 aa  GUAA_FRATT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-142  50%  516 aa  GUAA_FRAT1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-142  50%  516 aa  GUAA_FRATM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-142  50%  516 aa  GUAA_FRATW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-142  50%  516 aa  GUAA_FRAP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-142  50%  516 aa  GUAA_FRATN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::509     e-142  49%  509 aa  GUAA_GRAFK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::513     e-140  49%  513 aa  GUAA_MESFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     e-140  52%  520 aa  GUAA_WOLWR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     e-140  52%  520 aa  GUAA_WOLPM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-140  49%  516 aa  GUAA_FRATH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::506     e-139  52%  506 aa  GUAA_BDEBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-139  49%  516 aa  GUAA_FRATO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::516     e-139  49%  516 aa  GUAA_FRATF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::539     e-139  50%  539 aa  GUAA_SCHPO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::453     e-139  55%  507 aa  GUAA_BRUME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::533     e-138  50%  533 aa  GUAA_EMENI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::519     e-138  48%  519 aa  GUAA_NITEC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::521     e-138  47%  521 aa  GUAA_RUTMC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::529     e-136  52%  529 aa  GUAA_ANAMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::529     e-136  52%  529 aa  GUAA_ANAMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::528     e-136  47%  528 aa  GUAA_BORGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::509     e-135  47%  509 aa  GUAA_FLAJ1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::525     e-132  47%  525 aa  GUAA_BLOPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::526     e-132  46%  526 aa  GUAA_BAUCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::541     e-131  49%  541 aa  GUAA_ASPOR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::503     e-131  47%  505 aa  GUAA_PYRAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::509     e-130  47%  509 aa  GUAA_FLAPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::512     e-129  49%  512 aa  GUAA_AERPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     e-129  49%  520 aa  GUAA_WOLPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::528     e-129  49%  528 aa  GUAA_EHRRW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::503     e-128  48%  503 aa  GUAA_TROW8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::503     e-128  48%  503 aa  GUAA_TROWT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::528     e-128  49%  528 aa  GUAA_EHRRG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::528     e-128  45%  528 aa  GUAA_BORBU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512     e-126  47%  512 aa  GUAA_CHLFF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::557     e-126  48%  557 aa  GUAA_ASPFU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512     e-126  47%  512 aa  GUAA_CHLMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::512     e-126  47%  512 aa  GUAA_CHLCV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::521     e-125  45%  521 aa  GUAA_PELUB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::526     e-125  43%  526 aa  GUAA_BLOFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::522     e-120  42%  522 aa  GUAA_WIGBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::520     e-119  47%  520 aa  GUAA_WOLTR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::522     e-116  48%  522 aa  GUAA_GIBZE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::503     e-115  45%  503 aa  GUAA_THET2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::503     e-115  45%  503 aa  GUAA_THET8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::80      e-112  52%  435 aa  GUAA2_BACTN RecName: Full=Putative GMP synthase
    7::310     7e-97  58%  310 aa  GUAAB_METJA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::307     1e-96  59%  307 aa  GUAAB_PYRKO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    8::130     3e-96  57% 1375 aa  GUAA_HELHP RecName: Full=Probable GMP synthase
    4::308     1e-94  57%  308 aa  GUAAB_PYRHO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::308     2e-93  57%  308 aa  GUAAB_PYRAB RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::313     4e-91  58%  313 aa  GUAAB_PYRFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::307     3e-90  55%  308 aa  GUAAB_METTH RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::310     5e-90  53%  310 aa  GUAAB_METVS RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::310     6e-90  54%  310 aa  GUAAB_METM7 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::310     5e-89  54%  310 aa  GUAAB_METMP RecName: Full=GMP synthase [glutamine-hydrolyzing]
   42::584     4e-87  40%  718 aa  GUAA_DICDI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::562     1e-84  41%  693 aa  GUAA_PONAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::562     1e-84  41%  693 aa  GUAA_HUMAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::482     5e-84  43%  603 aa  GUAA_LEPIN RecName: Full=Probable GMP synthase
    7::482     5e-84  43%  603 aa  GUAA_LEPIC RecName: Full=Probable GMP synthase
   28::562     8e-84  40%  693 aa  GUAA_MOUSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::562     2e-83  41%  693 aa  GUAA_RAT RecName: Full=GMP synthase [glutamine-hydrolyzing];       
    6::305     1e-82  54%  305 aa  GUAAB_UNCMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::303     1e-82  54%  303 aa  GUAAB_ARCFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
  106::662     1e-81  41%  792 aa  GUAA_CAEEL RecName: Full=Probable GMP synthase
    7::305     3e-80  54%  305 aa  GUAAB_METBF RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::305     3e-80  53%  305 aa  GUAAB_METB6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::305     1e-79  53%  305 aa  GUAAB_METMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::305     2e-79  52%  305 aa  GUAAB_METAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
    2::310     2e-78  50%  310 aa  GUAAB_THEAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::305     2e-78  51%  305 aa  GUAAB_METMJ RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::310     2e-78  50%  310 aa  GUAAB_THEVO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::305     7e-78  52%  305 aa  GUAAB_PICTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::305     3e-76  51%  305 aa  GUAAB_METPE RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::305     1e-75  51%  305 aa  GUAAB_HALSA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::305     1e-75  51%  305 aa  GUAAB_HALS3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::304     3e-75  49%  304 aa  GUAAB_METBU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::305     1e-74  51%  305 aa  GUAAB_NATPD RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::305     7e-72  51%  305 aa  GUAAB_HALMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::314     6e-71  47%  314 aa  GUAAB_METKA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   20::305     1e-70  51%  305 aa  GUAAB_HALLT RecName: Full=GMP synthase [glutamine-hydrolyzing]
   11::221     6e-61  48%  429 aa  GUAA_CHLPN RecName: Full=Putative GMP synthase
    6::367     2e-54  44%  367 aa  GUAAB_SULSO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::367     7e-51  44%  367 aa  GUAAB_SULIY RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::367     7e-51  44%  367 aa  GUAAB_SULIN RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::367     7e-51  44%  367 aa  GUAAB_SULIM RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::367     7e-51  44%  367 aa  GUAAB_SULIL RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::367     7e-51  44%  367 aa  GUAAB_SULIK RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::367     7e-51  44%  367 aa  GUAAB_SULIA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    2::370     1e-48  44%  370 aa  GUAAB_SULTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     1e-36  39%  188 aa  GUAAA_PYRKO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    2::187     1e-36  41%  189 aa  GUAAA_PYRHO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     1e-36  40%  188 aa  GUAAA_PYRFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::186     3e-35  40%  188 aa  GUAAA_PYRAB RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::183     2e-33  41%  188 aa  GUAAA_SULAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::184     2e-33  40%  188 aa  GUAAA_METJA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::179     5e-33  34%  186 aa  GUAAA_METST RecName: Full=GMP synthase [glutamine-hydrolyzing]
    8::183     1e-32  43%  188 aa  GUAAA_SULSO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::184     3e-32  36%  186 aa  GUAAA_METTH RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::184     2e-30  41%  189 aa  GUAAA_METVS RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::186     2e-30  38%  189 aa  GUAAA_METBU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::186     9e-30  39%  189 aa  GUAAA_METBF RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::183     1e-29  40%  188 aa  GUAAA_SULTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::179     3e-29  38%  189 aa  GUAAA_METMP RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::180     6e-29  36%  184 aa  GUAAA_HALWD RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::179     8e-29  37%  189 aa  GUAAA_METM6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::183     1e-28  33%  190 aa  GUAAA_METS3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::179     2e-28  38%  189 aa  GUAAA_METM7 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::179     2e-28  35%  189 aa  GUAAA_METM5 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::186     4e-28  37%  189 aa  GUAAA_METMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::185     4e-28  39%  187 aa  GUAAA_METKA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::186     4e-28  38%  189 aa  GUAAA_METAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
   10::181     6e-28  34%  183 aa  GUAAA_ARCFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::179     9e-27  38%  181 aa  GUAAA_METTP RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::181     1e-26  38%  184 aa  GUAAA_NATPD RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::185     2e-26  33%  189 aa  GUAAA_UNCMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    1::187     2e-26  34%  188 aa  GUAAA_META3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::178     2e-25  37%  189 aa  GUAAA_HALMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    3::183     7e-25  33%  188 aa  GUAAA_PICTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::178     1e-24  35%  184 aa  GUAAA_METB6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::179     7e-24  36%  183 aa  GUAAA_HALSA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    5::185     3e-23  31%  202 aa  GUAAA_THEVO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::186     2e-22  34%  188 aa  GUAAA_IGNH4 RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::178     4e-20  31%  184 aa  GUAAA_METMJ RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::184     1e-19  28%  200 aa  GUAAA_THEAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
   32::182     4e-17  32%  188 aa  GUAAA_METHJ RecName: Full=GMP synthase [glutamine-hydrolyzing]
   47::232     1e-16  29%  589 aa  TRPG_THEMA RecName: Full=Anthranilate synthase component II;       
    1::186     2e-15  27%  196 aa  TRPG_AZOBR RecName: Full=Anthranilate synthase component 2;        
    1::186     2e-13  26%  190 aa  TRPG_CYAPA RecName: Full=Anthranilate synthase component II;       
    2::193     8e-13  26%  197 aa  TRPG_METJA RecName: Full=Anthranilate synthase component II;       
    1::185     8e-13  27%  194 aa  PABA_BACSU RecName: Full=Para-aminobenzoate/anthranilate synthase
   43::172     5e-12  33%  178 aa  TRPG_ARCFU RecName: Full=Anthranilate synthase component 2;        
    1::185     7e-12  26%  187 aa  PABA_SALTY RecName: Full=Para-aminobenzoate synthase glutamine
   34::185     8e-12  34%  187 aa  PABA_ECOLI RecName: Full=Para-aminobenzoate synthase glutamine
   72::184     3e-11  29%  194 aa  TRPG_HELPY RecName: Full=Anthranilate synthase component II;       
   72::184     4e-11  28%  194 aa  TRPG_HELPJ RecName: Full=Anthranilate synthase component II;       
  197::376     4e-11  29%  395 aa  CARA_GRATL RecName: Full=Carbamoyl-phosphate synthase small chain; 
  203::370     1e-10  34%  388 aa  CARA_CAUCR RecName: Full=Carbamoyl-phosphate synthase small chain; 
   42::204     2e-10  29%  207 aa  TRPG1_HALMA RecName: Full=Anthranilate synthase component II;      
   26::186     3e-10  26%  192 aa  TRPG_PYRKO RecName: Full=Anthranilate synthase component II;       
    1::186     4e-10  25%  189 aa  TRPG_PORYE RecName: Full=Anthranilate synthase component II;       
   18::187     6e-10  27%  765 aa  TRPG_PHYBL RecName: Full=Anthranilate synthase component 2;        
  203::371     6e-10  31%  390 aa  CARA_MARMM RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::194     1e-09  28%  196 aa  TRPG_METTH RecName: Full=Anthranilate synthase component II;       
    1::186     2e-09  27%  189 aa  TRPG_PORPU RecName: Full=Anthranilate synthase component II;       
    1::198     2e-09  28%  201 aa  TRPG_PSEAE RecName: Full=Anthranilate synthase component II;       
    1::185     2e-09  24%  198 aa  TRPG_LACLA RecName: Full=Anthranilate synthase component II;       
    1::190     2e-09  26%  194 aa  TRPG_ACIAD RecName: Full=Anthranilate synthase component 2;        
   76::185     2e-09  32%  723 aa  PABS_STRGR RecName: Full=Para-aminobenzoate synthase;       
  211::391     2e-09  29%  399 aa  CARA_BARHE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   46::205     3e-09  29%  484 aa  TRPG_YEAST RecName: Full=Anthranilate synthase component 2;        
  212::347     3e-09  34%  372 aa  CARA_METS5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   40::192     4e-09  24%  367 aa  TRPG_PICAN RecName: Full=Anthranilate synthase component 2;        
  210::390     4e-09  29%  398 aa  CARA_BARQU RecName: Full=Carbamoyl-phosphate synthase small chain; 
   48::200     5e-09  28%  204 aa  TRPG_THET8 RecName: Full=Anthranilate synthase component II;       
   34::200     5e-09  26%  204 aa  TRPG_HALVO RecName: Full=Anthranilate synthase component II;       
    3::194     7e-09  25%  196 aa  TRPG_METTM RecName: Full=Anthranilate synthase component II;       
  181::345     7e-09  32%  367 aa  CARA_SULSO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  204::377     7e-09  30%  398 aa  CARA_RHILO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  184::355     7e-09  29%  372 aa  CARA_AKKM8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   46::199     9e-09  32%  201 aa  TRPG_LEPBI RecName: Full=Anthranilate synthase component II;       
    2::191     2e-08  26%  198 aa  TRPG_PSEPU RecName: Full=Anthranilate synthase component II;       
  194::360     2e-08  31%  382 aa  CARA_SALTY RecName: Full=Carbamoyl-phosphate synthase small chain; 
  202::375     2e-08  29%  389 aa  CARA_RHOBA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    9::51      2e-08  53%  163 aa  Y221A_HAEIN RecName: Full=Putative uncharacterized protein
    3::185     3e-08  26%  193 aa  Y1171_HAEIN RecName: Full=Putative anthranilate synthase component
  530::703     3e-08  27%  732 aa  TRPE_AZOBR RecName: Full=Anthranilate synthase;       
  172::345     3e-08  29%  358 aa  CARA_STRA5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  172::345     3e-08  29%  358 aa  CARA_STRA3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::360     3e-08  31%  382 aa  CARA_ECOLI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::360     3e-08  31%  382 aa  CARA_ECOL6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::360     3e-08  31%  382 aa  CARA_ECO57 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   62::214     4e-08  28%  759 aa  TRPG_SCHPO RecName: Full=Anthranilate synthase component 2;        
   16::193     4e-08  26%  752 aa  TRPG_CRYNE RecName: Full=Anthranilate synthase component 2;        
  208::381     4e-08  29%  401 aa  CARA_RHIME RecName: Full=Carbamoyl-phosphate synthase small chain; 
  210::383     4e-08  30%  407 aa  CARA_OCHA4 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    2::192     6e-08  26%  195 aa  TRPG_SULSO RecName: Full=Anthranilate synthase component II;       
    4::184     6e-08  25%  193 aa  TRPG_HAEIN RecName: Full=Anthranilate synthase component II;       
  194::360     6e-08  32%  382 aa  CARA_SALTI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUSU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUSI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUO2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUME RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUMB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUC2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUAB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUA2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::383     6e-08  31%  407 aa  CARA_BRUA1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  209::389     6e-08  28%  399 aa  CARA_BARBK RecName: Full=Carbamoyl-phosphate synthase small chain; 
  531::706     7e-08  21%  729 aa  TRPE_RHIME RecName: Full=Anthranilate synthase;       
   18::214     1e-07  27%  752 aa  TRPG_PENCH RecName: Full=Anthranilate synthase component 2;        
  187::360     1e-07  30%  387 aa  CARA_PHOLL RecName: Full=Carbamoyl-phosphate synthase small chain; 
  193::368     1e-07  25%  388 aa  CARA_ANASP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   81::192     1e-07  30%  198 aa  TRPG_HALSA RecName: Full=Anthranilate synthase component II;       
   16::193     1e-07  26%  752 aa  TRPG_CRYNV RecName: Full=Anthranilate synthase component 2;        
  186::367     1e-07  30%  394 aa  CARA_DEIGD RecName: Full=Carbamoyl-phosphate synthase small chain; 
  172::347     2e-07  29%  363 aa  CARA_SYMTH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  184::348     2e-07  33%  371 aa  CARA_SULAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
  186::367     2e-07  29%  394 aa  CARA_DEIRA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  169::349     2e-07  26%  359 aa  CARX_BACHD RecName: Full=Carbamoyl-phosphate synthase
  191::367     2e-07  28%  386 aa  CARA_HYPNA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::370     3e-07  26%  393 aa  CARA_CORGL RecName: Full=Carbamoyl-phosphate synthase small chain; 
   44::185     4e-07  25%  187 aa  PABA_KLEAE RecName: Full=Para-aminobenzoate synthase glutamine
  188::368     5e-07  27%  374 aa  CARA_ZYMMO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::183     6e-07  26%  196 aa  TRPG_VIBPA RecName: Full=Anthranilate synthase component II;       
    1::183     6e-07  24%  190 aa  TRPG2_HALMA RecName: Full=Anthranilate synthase component II;      
  173::347     6e-07  28%  363 aa  CARA_LISMO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::347     8e-07  28%  363 aa  CARA_LISIN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  190::354     1e-06  27%  374 aa  CARA_DESAD RecName: Full=Carbamoyl-phosphate synthase small chain; 
  191::347     1e-06  32%  366 aa  CARA_CHLTE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  266::442     1e-06  27% 2275 aa  PYR1_EMENI RecName: Full=Protein pyrABCN;Includes:  RecName:
   26::188     1e-06  28%  277 aa  NADE_CHLPD RecName: Full=NH(3)-dependent NAD(+) synthetase;        
  205::365     1e-06  25%  376 aa  CARA_MYCTU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::365     1e-06  25%  376 aa  CARA_MYCBO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::347     1e-06  28%  363 aa  CARA_LISMF RecName: Full=Carbamoyl-phosphate synthase small chain; 
  209::382     2e-06  28%  396 aa  CARA_BRAJA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  265::438     2e-06  30% 2244 aa  PYR1_SCHPO RecName: Full=Protein ura1;Includes:  RecName:
   77::186     2e-06  28%  200 aa  PHNB_PSEAE RecName: Full=Anthranilate synthase component II,
    6::192     2e-06  26%  259 aa  NADE_METJA RecName: Full=Probable NH(3)-dependent NAD(+)
  186::360     2e-06  28%  379 aa  CARA_VIBCH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::375     2e-06  29%  384 aa  CARA_PORPU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  216::375     2e-06  25%  400 aa  CARA_COREF RecName: Full=Carbamoyl-phosphate synthase small chain; 
  175::335     2e-06  28%  358 aa  CARA_ARCFU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  208::381     2e-06  26%  401 aa  CARA_AGRT5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   34::189     3e-06  23%  191 aa  PABA_SERMA RecName: Full=Para-aminobenzoate synthase glutamine
  260::408     3e-06  33%  453 aa  CARA_NEUCR RecName: Full=Carbamoyl-phosphate synthase
  173::338     3e-06  29%  357 aa  CARA_LACLA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  220::395     3e-06  33%  430 aa  CARA_CANAL RecName: Full=Carbamoyl-phosphate synthase
  210::390     3e-06  28%  398 aa  CARA_BART1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::190     4e-06  22%  195 aa  TRPG_CYACA RecName: Full=Anthranilate synthase component II;       
   29::194     4e-06  34%  196 aa  HIS5_BACFN RecName: Full=Imidazole glycerol phosphate synthase
  194::360     4e-06  29%  391 aa  CARA_YERPS RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::360     4e-06  29%  391 aa  CARA_YERPE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  177::265     4e-06  33%  392 aa  CARA_THEMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  203::369     4e-06  27%  380 aa  CARA_STRCO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  167::342     4e-06  25%  349 aa  CARA_CLOPE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  205::303     4e-06  32%  397 aa  CARA_BUCBP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   58::215     5e-06  27%  762 aa  TRPG_NEUCR RecName: Full=Anthranilate synthase component 2;        
   53::216     5e-06  25%  768 aa  TRPG_EMENI RecName: Full=Anthranilate synthase component 2;        
  229::402     5e-06  30% 2214 aa  PYR1_YEAST RecName: Full=Protein URA1;Includes:  RecName:
   10::183     5e-06  36%  257 aa  NADE_WOLSU RecName: Full=NH(3)-dependent NAD(+) synthetase;        
   74::201     5e-06  33%  204 aa  HIS5_BDEBA RecName: Full=Imidazole glycerol phosphate synthase
   29::194     5e-06  33%  196 aa  HIS5_BACFR RecName: Full=Imidazole glycerol phosphate synthase
  194::360     5e-06  27%  379 aa  CARA_VIBVY RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::346     5e-06  29%  360 aa  CARA_STRP6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::346     5e-06  29%  360 aa  CARA_STRP3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::346     5e-06  29%  360 aa  CARA_STRP1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::373     5e-06  31%  382 aa  CARA_ERWCT RecName: Full=Carbamoyl-phosphate synthase small chain; 
  219::394     5e-06  33%  429 aa  CARA_DEBHA RecName: Full=Carbamoyl-phosphate synthase
  171::338     5e-06  30%  365 aa  CARA_BACCR RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::190     7e-06  30%  372 aa  MNMA_MYCH7 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    3::182     7e-06  36%  358 aa  MNMA_CHLTR RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   87::225     7e-06  34%  229 aa  HIS5_ZYMMO RecName: Full=Imidazole glycerol phosphate synthase
  194::360     7e-06  27%  379 aa  CARA_VIBVU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  185::349     7e-06  29%  372 aa  CARA_SULTO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::346     7e-06  29%  360 aa  CARA_STRP8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::360     7e-06  27%  384 aa  CARA_PHOPR RecName: Full=Carbamoyl-phosphate synthase small chain; 
   56::271     9e-06  25%  768 aa  TRPG_ASPAW RecName: Full=Anthranilate synthase component 2;        
   15::182     9e-06  25%  242 aa  NADE_THEVO RecName: Full=NH(3)-dependent NAD(+) synthetase;        
    3::190     9e-06  30%  372 aa  MNMA_MYCHJ RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    3::190     9e-06  30%  372 aa  MNMA_MYCH2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    3::182     9e-06  36%  358 aa  MNMA_CHLTA RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   75::202     9e-06  34%  202 aa  HIS5_LACLA RecName: Full=Imidazole glycerol phosphate synthase
    1::192     9e-06  25%  197 aa  HIS5_ARCFU RecName: Full=Imidazole glycerol phosphate synthase
  185::362     9e-06  28%  374 aa  CARA_XYLFA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  175::331     9e-06  29%  356 aa  CARA_THETN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  197::367     9e-06  25%  384 aa  CARA_SYNY3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::346     9e-06  26%  359 aa  CARA_STRR6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::346     9e-06  26%  359 aa  CARA_STRPN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::253     9e-06  33%  366 aa  CARA_OCEIH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  192::362     9e-06  30%  376 aa  CARA_DESDA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  186::350     9e-06  26%  371 aa  CARA_AQUAE RecName: Full=Carbamoyl-phosphate synthase small chain; 
    6::175     1e-05  30%  193 aa  PDXT_CLOBM RecName: Full=Glutamine amidotransferase subunit pdxT;  
    3::182     1e-05  36%  358 aa  MNMA_CHLTB RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
    3::182     1e-05  36%  358 aa  MNMA_CHLT2 RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   76::205     1e-05  30%  211 aa  HIS5_NOSP7 RecName: Full=Imidazole glycerol phosphate synthase
  200::374     1e-05  25%  391 aa  CARA_SYNP6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  200::374     1e-05  25%  391 aa  CARA_SYNE7 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::187     2e-05  26%  201 aa  TRPG_SHIDY RecName: Full=Anthranilate synthase component II;       
    4::184     2e-05  26%  192 aa  TRPG_BUCBP RecName: Full=Anthranilate synthase component 2;        
   14::179     2e-05  27%  436 aa  TILS_VIBVY RecName: Full=tRNA(Ile)-lysidine synthase;       
   14::179     2e-05  27%  436 aa  TILS_VIBVU RecName: Full=tRNA(Ile)-lysidine synthase;       
   64::203     2e-05  31%  206 aa  HIS53_VIBVY RecName: Full=Imidazole glycerol phosphate synthase
  189::355     2e-05  27%  382 aa  CARA_SYNR3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  170::360     2e-05  25%  364 aa  CARA_LACPL RecName: Full=Carbamoyl-phosphate synthase
  193::376     2e-05  25%  378 aa  CARA_HELHP RecName: Full=Carbamoyl-phosphate synthase small chain; 
  221::364     2e-05  26%  381 aa  CARA_HALER RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::187     2e-05  26%  531 aa  TRPG_ECOLI RecName: Full=Anthranilate synthase component II;       
  195::361     2e-05  22%  383 aa  CARA_SYNPX RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::254     2e-05  38%  362 aa  CARA_STRMU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::348     2e-05  30%  366 aa  CARA_STAHJ RecName: Full=Carbamoyl-phosphate synthase small chain; 
  173::254     2e-05  36%  357 aa  CARA_LACLM RecName: Full=Carbamoyl-phosphate synthase small chain; 
   12::188     3e-05  23%  256 aa  NADE_METAC RecName: Full=NH(3)-dependent NAD(+) synthetase;        
    9::195     3e-05  27%  250 aa  NADE_ALKOO RecName: Full=NH(3)-dependent NAD(+) synthetase;        
  174::348     3e-05  28%  366 aa  CARA_STAES RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::348     3e-05  25%  366 aa  CARA_STAEQ RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::360     3e-05  27%  378 aa  CARA_PSEPK RecName: Full=Carbamoyl-phosphate synthase small chain; 
  224::381     3e-05  31%  409 aa  CARA_KLULA RecName: Full=Carbamoyl-phosphate synthase
    4::187     3e-05  26%  531 aa  TRPG_SALTY RecName: Full=Anthranilate synthase component II;       
   61::194     3e-05  25%  718 aa  PABS_SCHPO RecName: Full=Putative aminodeoxychorismate synthase;   
   30::199     3e-05  29%  268 aa  NADE_HALSA RecName: Full=NH(3)-dependent NAD(+) synthetase;        
   30::199     3e-05  29%  268 aa  NADE_HALS3 RecName: Full=NH(3)-dependent NAD(+) synthetase;        
   74::206     3e-05  35%  212 aa  HIS5_PSEPK RecName: Full=Imidazole glycerol phosphate synthase
  197::277     3e-05  32%  384 aa  CARA_PORYE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  211::365     3e-05  26%  375 aa  CARA_MYCLE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  178::339     3e-05  24%  361 aa  CARA_METKA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  198::372     3e-05  28%  387 aa  CARA_BUCAI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  172::344     3e-05  26%  362 aa  CARA_BACHD RecName: Full=Carbamoyl-phosphate synthase
    4::188     5e-05  30%  238 aa  QUEC_THEAC RecName: Full=Archaeosine biosynthesis protein queC;    
  188::365     5e-05  24%  376 aa  CARA_WIGBR RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::292     5e-05  28%  379 aa  CARA_VIBPA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  193::291     5e-05  29%  378 aa  CARA_RALSO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  209::363     5e-05  25%  373 aa  CARA_MYCPA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  247::325     6e-05  34%  480 aa  Y066_METJA RecName: Full=Uncharacterized protein MJ0066;
   58::216     6e-05  24%  770 aa  TRPG_ASPNG RecName: Full=Anthranilate synthase component 2;        
   10::183     6e-05  24%  241 aa  NADE_FINM2 RecName: Full=NH(3)-dependent NAD(+) synthetase;        
  185::362     6e-05  27%  374 aa  CARA_XYLFT RecName: Full=Carbamoyl-phosphate synthase small chain; 
  203::369     6e-05  26%  380 aa  CARA_STRAW RecName: Full=Carbamoyl-phosphate synthase small chain; 
  179::350     6e-05  25%  371 aa  CARA_PROA2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   19::186     8e-05  23%  273 aa  NADE_GEOUR RecName: Full=NH(3)-dependent NAD(+) synthetase;        
  245::408     8e-05  26%  453 aa  CARA_TRIVE RecName: Full=Carbamoyl-phosphate synthase
  192::370     8e-05  25%  391 aa  CARA_THET8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  192::370     8e-05  25%  391 aa  CARA_THET2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  240::368     8e-05  31%  388 aa  CARA_SILPO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  232::393     8e-05  31%  407 aa  CARA_BIFLI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  171::338     8e-05  28%  365 aa  CARA_BACC1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  435::553     1e-04  28%  614 aa  Y997_RICBR RecName: Full=Putative ankyrin repeat protein RBE_0997;
   56::198     1e-04  23%  788 aa  TRPG_PHACH RecName: Full=Anthranilate synthase component 2;        
   39::170     1e-04  31%  192 aa  PDXT_ACIBL RecName: Full=Glutamine amidotransferase subunit pdxT;  
   17::188     1e-04  27%  277 aa  NADE_PROVI RecName: Full=NH(3)-dependent NAD(+) synthetase;        
    1::206     1e-04  26%  208 aa  HIS5_LISMF RecName: Full=Imidazole glycerol phosphate synthase
    1::206     1e-04  26%  208 aa  HIS5_LISMC RecName: Full=Imidazole glycerol phosphate synthase
    8::184     1e-04  25%  452 aa  TILS_PERMH RecName: Full=tRNA(Ile)-lysidine synthase;       
   80::216     1e-04  33%  223 aa  PURQ_CAMJE RecName: Full=Phosphoribosylformylglycinamidine synthase
   38::190     1e-04  28%  192 aa  PDXT_METST RecName: Full=Glutamine amidotransferase subunit pdxT;  
    1::183     1e-04  27%  205 aa  HIS5_DEHE1 RecName: Full=Imidazole glycerol phosphate synthase
   76::205     1e-04  30%  211 aa  HIS5_ANAVT RecName: Full=Imidazole glycerol phosphate synthase
  166::327     1e-04  27%  354 aa  CARX_BACST RecName: Full=Carbamoyl-phosphate synthase
  174::348     1e-04  24%  366 aa  CARA_STAAW RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::348     1e-04  24%  366 aa  CARA_STAAS RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::348     1e-04  24%  366 aa  CARA_STAAN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::348     1e-04  24%  366 aa  CARA_STAAM RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::348     1e-04  24%  366 aa  CARA_STAAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
  191::365     1e-04  28%  377 aa  CARA_NEIMB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  199::351     1e-04  31%  366 aa  CARA_METM5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  192::345     1e-04  27%  354 aa  CARA_METJA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  171::338     1e-04  28%  365 aa  CARA_BACHK RecName: Full=Carbamoyl-phosphate synthase small chain; 
  171::338     1e-04  28%  365 aa  CARA_BACCZ RecName: Full=Carbamoyl-phosphate synthase small chain; 
  171::338     1e-04  28%  365 aa  CARA_BACAN RecName: Full=Carbamoyl-phosphate synthase small chain; 
  178::349     2e-04  29% 2225 aa  PYR1_MESAU RecName: Full=CAD protein;Includes:  RecName:
   12::168     2e-04  25%  184 aa  PDXT_STAHJ RecName: Full=Glutamine amidotransferase subunit pdxT;  
   75::202     2e-04  30%  210 aa  HIS5_SYNY3 RecName: Full=Imidazole glycerol phosphate synthase
  191::289     2e-04  28%  377 aa  CARA_NEIGO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  186::291     2e-04  27%  372 aa  CARA_CAMJE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  232::393     2e-04  31%  407 aa  CARA_BIFLO RecName: Full=Carbamoyl-phosphate synthase small chain; 
  232::393     2e-04  31%  407 aa  CARA_BIFLD RecName: Full=Carbamoyl-phosphate synthase small chain; 
  170::251     2e-04  33%  364 aa  CARA_BACCL RecName: Full=Carbamoyl-phosphate synthase
  190::346     2e-04  25%  381 aa  THII_METJA RecName: Full=Probable thiamine biosynthesis protein
    3::186     2e-04  28%  239 aa  QUEC_PICTO RecName: Full=Archaeosine biosynthesis protein queC;    
   70::191     2e-04  33%  194 aa  HIS5_MANSM RecName: Full=Imidazole glycerol phosphate synthase
   82::209     2e-04  35%  219 aa  HIS5_GRABC RecName: Full=Imidazole glycerol phosphate synthase
  192::363     2e-04  25%  382 aa  CARA_THEEB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  174::348     2e-04  24%  366 aa  CARA_STAAR RecName: Full=Carbamoyl-phosphate synthase small chain; 
  198::296     2e-04  26%  386 aa  CARA_SHEON RecName: Full=Carbamoyl-phosphate synthase small chain; 
  198::279     2e-04  36%  384 aa  CARA_PSEST RecName: Full=Carbamoyl-phosphate synthase small chain; 
  198::296     2e-04  32%  385 aa  CARA_BUCAP RecName: Full=Carbamoyl-phosphate synthase small chain; 
  178::352     3e-04  30% 2225 aa  PYR1_HUMAN RecName: Full=CAD protein;Includes:  RecName:
    5::36      3e-04  62%  441 aa  MTU1_RAT RecName: Full=Mitochondrial tRNA-specific 2-thiouridylase
    5::36      3e-04  62%  422 aa  MTU1_PONAB RecName: Full=Mitochondrial tRNA-specific
    5::36      3e-04  62%  417 aa  MTU1_MOUSE RecName: Full=Mitochondrial tRNA-specific
    5::36      3e-04  62%  421 aa  MTU1_HUMAN RecName: Full=Mitochondrial tRNA-specific
    5::36      3e-04  59%  416 aa  MTU1_DANRE RecName: Full=Mitochondrial tRNA-specific
    5::193     3e-04  34%  367 aa  MNMA_DESRM RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   24::205     3e-04  31%  210 aa  HIS51_SYNPX RecName: Full=Imidazole glycerol phosphate synthase
   75::198     3e-04  30%  201 aa  HIS51_CAMJJ RecName: Full=Imidazole glycerol phosphate synthase
  177::338     3e-04  21%  356 aa  CARA_METTH RecName: Full=Carbamoyl-phosphate synthase small chain; 
  204::378     3e-04  27%  389 aa  CARA_HAEDU RecName: Full=Carbamoyl-phosphate synthase small chain; 
  172::346     3e-04  30%  351 aa  CARA_CLOAB RecName: Full=Carbamoyl-phosphate synthase small chain; 
  178::235     4e-04  36%  411 aa  Y973_METJA RecName: Full=Uncharacterized protein MJ0973;
   36::173     4e-04  31%  195 aa  PDXT_THELT RecName: Full=Glutamine amidotransferase subunit pdxT;  
  192::374     4e-04  24%  384 aa  CARA_RHOGE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  194::360     4e-04  28%  378 aa  CARA_PSEAE RecName: Full=Carbamoyl-phosphate synthase small chain; 
  191::365     4e-04  28%  377 aa  CARA_NEIMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
  193::360     4e-04  24%  379 aa  CARA_ACIAD RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::187     5e-04  32%  241 aa  QUEC_THEVO RecName: Full=Archaeosine biosynthesis protein queC;    
   43::178     5e-04  35%  203 aa  PDXT_FRASN RecName: Full=Glutamine amidotransferase subunit pdxT;  
   58::191     5e-04  36%  196 aa  HIS5_IDILO RecName: Full=Imidazole glycerol phosphate synthase
   76::205     5e-04  29%  211 aa  HIS5_ANASP RecName: Full=Imidazole glycerol phosphate synthase
  199::351     5e-04  30%  366 aa  CARA_METM7 RecName: Full=Carbamoyl-phosphate synthase small chain; 
  187::275     5e-04  31%  375 aa  CARA_HELPY RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::86      7e-04  30%   91 aa  TRPG_CLOTM RecName: Full=Anthranilate synthase component 2;      
    4::187     7e-04  24%  200 aa  TRPG_BUCAI RecName: Full=Anthranilate synthase component 2;        
    1::179     7e-04  29%  221 aa  QUEC_GEOKA RecName: Full=Queuosine biosynthesis protein queC;      
   12::169     7e-04  27%  192 aa  PDXT_STACT RecName: Full=Glutamine amidotransferase subunit pdxT;  
   40::176     7e-04  29%  195 aa  PDXT_DEHSC RecName: Full=Glutamine amidotransferase subunit pdxT;  
   21::75      7e-04  42%  409 aa  MNMA_CAUSK RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   76::202     7e-04  29%  212 aa  HIS5_MICAN RecName: Full=Imidazole glycerol phosphate synthase
    4::201     7e-04  31%  205 aa  HIS5_ACIAD RecName: Full=Imidazole glycerol phosphate synthase
  167::334     7e-04  22%  355 aa  CARX_LACPL RecName: Full=Carbamoyl-phosphate synthase
  199::351     7e-04  29%  366 aa  CARA_METMP RecName: Full=Carbamoyl-phosphate synthase small chain; 
  212::360     7e-04  23%  379 aa  CARA_CORDI RecName: Full=Carbamoyl-phosphate synthase small chain; 
  172::251     7e-04  34%  364 aa  CARA_BACSU RecName: Full=Carbamoyl-phosphate synthase
  374::575     9e-04  25% 1786 aa  YCF1_ARATH RecName: Full=Putative membrane protein ycf1;
   62::334     9e-04  28%  484 aa  THII_PSEFS RecName: Full=Thiamine biosynthesis protein thiI;
   51::199     9e-04  30%  204 aa  PDXT_RUBXD RecName: Full=Glutamine amidotransferase subunit pdxT;  
   18::193     9e-04  27%  278 aa  NADE_SULSO RecName: Full=NH(3)-dependent NAD(+) synthetase;        
   28::212     9e-04  34%  382 aa  MNMA_SPHAL RecName: Full=tRNA-specific 2-thiouridylase mnmA;       
   78::210     9e-04  31%  214 aa  HIS5_PSYA2 RecName: Full=Imidazole glycerol phosphate synthase
  191::296     9e-04  29%  386 aa  CARA_TERTT RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::513

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLAEQELILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTV
GUAA_CARHZ      --------VIVLDFGGQYSQLIARRIRELKVYCEMLPYNTPLEKIVQENPGGIVFSGGPSSVYGEGAPTV
GUAA_MOOTA      ------EIVLVLDFGGQYNQLIARRVREAGVYSEMIPYNTPLEKILARRPRGIIFSGGPASVYSLGAPRI
GUAA_HELMI      ------ETILVLDFGGQYNQLIARRVRELHVYCEMHPYTISVDAIREMNPKGIIFTGGPASVYEEKAPAV
GUAA_CLOTE      ----KKELVFIIDFGGQYSQLIARRVRENNVYCEIIPYSTSIEKIKEKNPKGIIFSGGPNSVYGENSPRI
GUAA_ALKMQ      ----KQELVLILDFGGQYNQLIARRVREHNIYCEVVPYKITAEEIKLKNPKGLILTGGPSSVYGESTPRC
GUAA_CLOB6      -----KELVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRV
GUAA_CLOBL      -----KELVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRV
GUAA_CLOBK      -----KELVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRV
GUAA_GEOKA      -----QEMIVVLDFGSQYNQLITRRIREFGVYSELHPHTIRAEEIRALNAKGIIFSGGPNSVYDEQAFTC
GUAA_CLOBH      -----KELVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRV
GUAA_CLOB1      -----KELVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRV
GUAA_CLOBM      -----KELVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRV
GUAA_CLOBJ      -----KELVLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAPRV
GUAA_CLOAB      ----DKQLVLVIDFGGQYNQLIARRVREHNVYCEIVPYTYSIDKIKEKKPSAVIFTGGQNSVYGEDSPRM
GUAA_CLOPE      -----RDLVLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTPTL
GUAA_CLOB8      ----KRDLVLVVDFGGQYNQLIARRVRECGVYCEIIPYDYTIEKIKAKNPKGIIFTGGPNSVYGEDTPTV
GUAA_CLOTH      ------ELILVLDFGGQYNQLIARRVREANVYCEVLPYNSSIDKIKSKNPKGIIFTGGPASVLDPKAPIC
GUAA_BACHD      MEQLSEEMIVVLDFGGQYNQLITRRIRDLGVYSELHPNTITAEQLKEMKPKGIIFSGGPNSAYAEGAPKC
GUAA_SYMTH      ----QRDLIVVVDFGGQYSHLIARRVREAQVYCEIWPFTAPVQRYREAGVKGIIFSGGPASVEQADAPRI
GUAA_HALOH      ----KEDKILVLDFGGQYSQLIARRVRECNVYSIIKPYNISIDQIKDINPAGIIFSGGPKSVTGPEAPMI
GUAA_CLONN      ----ERELVLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSVEDIKKKNPKAIIFTGGPNSVYGEGTPRV
GUAA_CALS8      ----QHEIVIVLDFGGQYNQLIARRVRECGVYCEIWPYDTPLEKIIEKNPKGIIFTGGPSSVYEENAPVV
GUAA_CLOCE      ------EMILVLDFGGQYNQLIARRVREANVYCEVIPYNASLERIKSYNAKGIIFTGGPNSVLDEGAPKC
GUAA_BACSK      MQVTNHETIVVLDFGGQYNQLITRRIRDLGVYSELHSHKLTADELKEMNPIGIIFSGGPNSAYVEGSPKC
GUAA_BACSU      MTKLVNEMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPNSVYDENSFRC
GUAA_CLOK5      ----ERELVIVVDFGGQYNQLIARRVRENNVYCEIVPYTYSVDKIKEKNPRGIIFTGGPNSVYDDNAPKI
GUAA_CLOK1      ----ERELVIVVDFGGQYNQLIARRVRENNVYCEIVPYTYSVDKIKEKNPRGIIFTGGPNSVYDDNAPKI
GUAA_BACCN      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGENAFHC
GUAA_BACC2      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACLD      MTKLVNEMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNPKGIILSGGPNSVYDEGSFRC
GUAA_BACCR      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACA2      MTKLVNEMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKEMNPKGIILSGGPNSVYDEGSFRC
GUAA_BACHK      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACWK      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACCZ      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACC4      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACC3      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACC0      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACAN      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACAH      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACAC      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_BACAA      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNSVYGEGALHC
GUAA_NATTJ      -----RELVIVLDFGGQYSRLIARRIREHNVYCEIYPYNISINKLKQLSPAAIVLSGGPSSVYQEGSPDL
GUAA_BACC1      ----QHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKEINPKGIIFSGGPNSVYGEGALHC
GUAA_BACP2      ------EMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKEMAPKGIILSGGPNSVYDEGSFRC
GUAA_LACAC      -NLEDFDKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKEMNPKGIIFSGGPNSVYDDGALKV
GUAA_THETN      ----KRETILILDFGGQYTQLIARRIREANVYCEIVPYDISPEEIKKIDPKGIVLSGGPASVYVKNAPKC
GUAA_ANATD      ----QHEIVIVLDFGGQYNQLIARRVRECGVYCEIWPYDTPLEKIISKNPKGIIFTGGPSSVYEPNAPMI
GUAA_OCEIH      --MENNELVLVLDFGSQYNQLITRRIREFGVYSELHSHKLTAEEIKEMNPKGIILSGGPHSVYDENSFRC
GUAA_EXIS2      ----DQEMILVLDFGGQYNQLITRRIRDLGVYSELHSHKITAAEVKDIAPAGIIFSGGPRSVYAEDAYRC
GUAA_STACT      ----EQEMILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSYTI
GUAA_LACGA      -NLNDFDKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKKMAPKGIIFSGGPNSVYDEGALKV
GUAA_LACJO      -NLNDFDKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSIEKIKEMAPKGIIFSGGPNSVYDKGALKV
GUAA_STAAR      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAN      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAM      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAA9      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAA2      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAA1      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAW      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAT      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAS      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAE      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAC      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAA8      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAA3      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAEQ      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGPNSVYEEGSFTI
GUAA_STAAB      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIGEIKKMNPKGIILSGGPNSVYEEGSFTI
GUAA_LACRJ      --------IIALDFGSQYNQLITRRLRDFGIYSELLSHKLTADEIKEINPKGIIFSGGPNSVYDPNAFKV
GUAA_LACRD      --------IIALDFGSQYNQLITRRLRDFGIYSELLSHKLTADEIKEINPKGIIFSGGPNSVYDPNAFKV
GUAA_STAES      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKRMNPKGIILSGGPNSVYEEGSFTI
GUAA_CLOBA      ----KRDLVLVIDFGGQYNQLIARRVRECNVYCEVHPYNLSVDEIKQMNPKGIIFTGGPNSVYGENSPLC
GUAA_LACDB      IDLSNFDKIIVLDFGSQYNQLITRRIRDFGIYSELLPHTITAEEVKKIAPKGIIFSGGPNSVYDENALDV
GUAA_LACDA      IDLSNFDKIIVLDFGSQYNQLITRRIRDFGIYSELLPHTITAEEVKKIAPKGIIFSGGPNSVYDENALDV
GUAA_STAS1      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISMEEIKRLNPKGIILSGGPNSVYEEDSFTI
GUAA_SYNWW      -----KETVVVLDFGGQYNQLIARRVRELSVYSEMLPYDTSYEEIVAKKPQAIILTGSPASVHGGEAPGC
GUAA_MACCJ      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEEIKKMNPKGIILSGGPNSVYEEGSFTV
GUAA_LISMO      ----EQEKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRA
GUAA_CLOBB      ----KRDLVLVIDFGGQYNQLIARRVRECNVYCEVHPYNLSVDEIKQMNPKGIIFTGGPNSVYGENSPLC
GUAA_LISMF      ----EQEKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRA
GUAA_LISIN      ----EQEKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDEDAFRA
GUAA_FINM2      ----KHQLVIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALDVIKEKQPIGIIFTGGPNSVYEENSPQI
GUAA_LISW6      ----EQEKIIVLDFGSQYNQLITRRIREFGVYSELHPHTITVEEMKALNPTGIIFSGGPNSVYDKDAFRA
GUAA_STAHJ      ----EQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISVDEIKRMNPKGIILSGGPNSVYEEGSFTI
GUAA_BRAHW      --------VLILDFGSQFTQLITRRIRELNVYSEIHPFHVSIDFIKEFKPKAIILSGGPSSVYEEDAPKV
GUAA_THEEB      ----QRQLIVILDFGSQYSELIARRIRETQVYSEVISYRTTAEQLAQLAPKGIILSGGPNSVYDENAPQC
GUAA_GLOVI      -----REMVAILDFGSQYSELIARRIRETKVYSEVLSYQTPIAEIRRLAPKGIILSGGPNSVYEAYAPQC
GUAA_ANAVT      ----ERQIIIILDFGSQYSELIARRIRETQVYSEVLSYRTSAEHLRQLNPKGIILSGGPSSVYSDRAPHC
GUAA_ANASP      ----ERQIIIILDFGSQYSELIARRIRETQVYSEVLSYRTPAEHLRQLNPKGIILSGGPSSVYSDRAPHC
GUAA_NOSP7      ----DRPLIIILDFGSQYSELIARRIRETQVYSEVLSYRTTSEQLRQLNPKGIILSGGPSSVYGDNAPHC
GUAA_SYNY3      ------QIIVILDFGSQYSELIARRIRETEVYSEVLSYRTTAQQLREIKPKGIILSGGPNSVYDQGAPEC
GUAA_PEDPA      --LSNFDKIIVLDFGSQYNQLITRRIREFGIYSELLSHKITAEEIKKINPKGIIFSGGPNSVYDKDAFRI
GUAA_CYAP7      -----RQMIVILDFGSQYSELIARRIRETNVYSEVLSYRTSAEQLRQLAPKGIILSGGPNSVYDKNAPQC
GUAA_FRASN      --------VLVIDFGAQYAQLIARRVRECHVYSEIVPWDMPVAEILARRPAALILSGGPKSVYSPGAPRV
GUAA_CYAA5      ----DRQMIVILDFGSQYSELIARRIRETQVYSEVLSYRTTAQKLRQLNPKGIILSGGPNSVYDDRAPQC
GUAA_SYNPX      -----QPAIVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRAMQPKGIVLSGGPSSVYAEHAPLC
GUAA_THERP      --------VVILDYGSQYAQLIARRVRDAHVYCELVPYDTDWSALKHLSPKGIILSGGPASVYEPDAPQL
GUAA_DEHSC      -----RESIVIFDFGSQYSLLIARRIREMHVYCELVSHDTPWEKIAHLNPRGFILSGGPSSVYEPEAPLA
GUAA_DEHE1      -----RESIVIFDFGSQYSLLIARRIREMHVYCELVSHDTPWEKIAHLNPRGFILSGGPSSVYEAGAPLA
GUAA_CLOD6      ----KHELVLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSPTI
GUAA_SYNS9      -----QPAIVILDFGSQYSELIARRVRETEVFSVVIGYSTTADELRRMAPKGIILSGGPSSVYAEHAPVC
GUAA_SYNSC      -----QPAIVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRRMAPKGIILSGGPSSVYAEHAPLC
GUAA_ENTFA      --LTSVEKIIVLDFGSQFNQLITRRIREFGVFSELLSHRTTAEEIRKIAPKGIIFSGGPNSVYDKDAFSI
GUAA_STRMU      --------IIVLDYGSQYNQLIARRIREFGIFSELRSHKVTADEVRAINPIGIVLSGGPSSVYAEDAFDI
GUAA_LACPL      ---ASFDSILVLDFGSQYNQLITRRIRDFGVYSELLPNTITAEEIKARHPKGIIFSGGPNSVYDDGAFRV
GUAA_STRT2      -TLNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEVRAINPIGIILSGGPNSVYAEDAFGI
GUAA_PROM3      -----QPAIVILDFGSQYSELIARRVRETEVYSLVMSYSTSADELRQLAPKGIILSGGPSSVYAERAPLC
GUAA_STRT1      -TLNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEVRAINPIGIILSGGPNSVYAEDAFGI
GUAA_PROAC      ------DVVLVVDFGAQYAQLIARRVREANVYSEIVPHNMPVRDMLAKEPAAIILSGGPASVYVEGAPSV
GUAA_PROM1      --------IVILDFGSQYSELIARRIRETEVYSLVMSYTTSADKLRSLKPKGIILSGGPGSVYEEGAPYC
GUAA_RHOBA      --------ILVLDFGSQYAQLIARRVREQNVYCQIVRHDISAERIAELAPKGIILSGGPNSVYEEGAPKC
GUAA_PROMM      -----QPAIVILDFGSQYSELIARRVRETEVYSLVMSYCTSADELRQLAPKGIILSGGPSSVYAERAPLC
GUAA_PROM5      --------ILILDFGSQYSELIARRIREANVFSLVVSNFISTKEIQDINPQGIILSGGPNSVYEDNAPKC
GUAA_THEFY      ------DTVLVVDFGAQYAQLIARRVRECHVYSEIVPPTMPVEEMLAKKPKAIILSGGPSSVYADGAPQA
GUAA_PROMT      --------IVILDFGSQYSELIARRIRETEVYSLVMSYTTSADQLRSLKPKGIILSGGPGSVYEEGAPYC
GUAA_PROMA      --------IVILDFGSQYSELIARRIRETEVYSMVLGYNSSVEELKKLSPQGIILSGGPSSVYEEKAPLC
GUAA_LACS1      --------IIVLDFGSQYNQLITRRIREFGVYSELLSHKLTAAQIKEMNPKGIIFSGGPNSVYDDGAFQI
GUAA_AQUAE      --------ILVVNFGSQYVQLIARRVRELGVYSEIVHWDTPVEEIKKKNPYGIIFSGGPASVYAEGAPLP
GUAA_STRAW      -SAAAPDTVLVVDFGAQYAQLIARRVREARVYSEIVPSTMPVAEMLAKNPAAIILSGGPSSVYAEGAPRL
GUAA_SYNP6      -----REMLIILDFGSQYSELIARRIRETQVYSEVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYAPVC
GUAA_PROM0      --------ILILDFGSQYSELIARRIRETNVFSLVVSNCISIEDINDINPKGIILSGGPNSVYEQNAPKC
GUAA_STRPG      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_STRA5      --LNDIQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGI
GUAA_STRA3      --LNDIQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGI
GUAA_STRA1      --LNDIQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITADEIRDINPIGIVLSGGPNSVYADGAFGI
GUAA_PROMP      --------ILILDFGSQYSELIARRIREADVFSLVVSNFTSVKEIQDINPKGIILSGGPSSVYEDNAPKC
GUAA_PROM2      --------ILILDFGSQYSELIARRIRETNVFSLVVSNCISIKEINNINPKGIILSGGPNSVYEQNAPKC
GUAA_PROMS      --------ILILDFGSQYSELIARRIRETNVFSLVVSNFISIEDINRINPKGIILSGGPNSVYEQNAPRC
GUAA_CYAP8      -----RQMLVILDFGSQYSELIARRIRETQVYSEVLSYRTTIEQIRQLNPRGIILSGGPNSVYDNRAPQC
GUAA_NITSB      --------IVILDFGSQYTQLIARRLREVGVYCEIYPFFEPIENIRAKKPQGIILSGGPASVYEPDAPRV
GUAA_STRPZ      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_STRPM      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_STRPF      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_STRP8      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_STRP6      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_STRP1      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_RHORT      -SVSATDRILIIDFGSQVTQLIARRVRESGVYSEIQPFNVTAASIAAFAPKGVILSGGPASVTAADTPRA
GUAA_STRP3      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELHEINPIGIVLSGGPNSVYADNAFGI
GUAA_STRPC      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_STRPB      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQELREINPIGIVLSGGPNSVYADNAFGI
GUAA_DESAD      --------VIILDFGSQFTQLIARRIREAGVYSEIHPCNVDPQKIKDLNPGALILSGGPSSVLEDESPQL
GUAA_LACCB      ----DYDKIIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGV
GUAA_LACC3      ----DYDKIIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGV
GUAA_LACRH      ----DYDKIIVLDYGSQYNQLITRRIREFGIYSELKPHTITAAEVKKIAPKGIIFSGGPNSVYDEGALGV
GUAA_EUBR3      ----DQEKVIVIDFGGQYNQLVARRVRECNVYCEIYSYKIDIEKIKEMNPKGIILTGGPNSCYEENSPSY
GUAA_CORJK      ------------DFGAQYAQLIARRVREVNLYSEVIPHTMPADEVAAKNPAALILSGGPSSVYADDAPSL
GUAA_STRPD      --LNDVQKIIVLDYGSQYNQLIARRIREFGVLSELKSHKITAQELHEINPIGIVLSGGPNSVYADNAFGI
GUAA_STRCO      -------------FGAQYAQLIARRVREARVYSEIVPSSMPVEEILAKNPAAIILSGGPSSVYEAGAPTL
GUAA_GLUOX      -----EDRILILDFGSQVTQLIARRVRESGVYCEIWPFTATEEKIRAFNPRGIILSGSPASVHDENAPPI
GUAA_SYNS3      --------IVILDFGSQYSELIARRVRETEVFSVVLGYSTSAEELRALAPRGIILSGGPSSVYADEAPLC
GUAA_STRS7      --LNDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHNITAQELRDINPIGIVLSGGPNSVYADDAFGI
GUAA_SYNP2      ----QRQIIVILDFGSQYSELIARRIRETEVYSEVISYRTSAEQLRQLNXXXXXXXXXXXXVYDDYAPAC
GUAA_STRZP      --LQDVEKIIVLDYGSQYNQLISRRIRDIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_DESPS      -----KEKIIILDFGSQTTQLIARRVREMKVYSEIHPFSLPLEKLKELNPTGIILSGGPCSVYDDDAPHS
GUAA_BIFLO      --------VLVVDFGAQYAQLIARRVREAGVYSELVPHSMPVDEILAKDPKAIILSGGPASVFEPGAPTI
GUAA_PHEZH      ---ADHEHVLIVDFGSQVTQLIARRLRESGVYCEIHPYDKVDAVLDSFRPKAVILSGGPASVHEAESPAA
GUAA_BARHE      MSISHSDTVLIIDFGSQVTQLIARRVRAMGVYCEVVPFQLALEGMQRIKPKAVILSGSPYSVIDEGSPRA
GUAA_STRZT      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRR6      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRPN      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRPI      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRP7      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRP4      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRP2      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRPS      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_RHIEC      ---AHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLQPKAVILSGSPASTVDEGSPRA
GUAA_BRUSI      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_BRUAB      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_BRUA2      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_BRUA1      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_BRUSU      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_BRUC2      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_STRU0      --LKDVQKIIVLDYGSQYNQLIARRIREFGVFSELKSHKITAQEIREINPIGIVLSGGPNSVYADNAFGI
GUAA_BARQU      MSISHPDTVLIIDFGSQVTQLIARRVRAMGVYCEIVPFQLALEGVKRLRPQAVILSGSPYSVIDDGSPRA
GUAA_STRE4      --LNDIQKIIVLDYGSQYNQLIARRIREFGVFSELKSHHITAQELRDINPIGIVLSGGPNSVYATDAFGI
GUAA_RHIE6      ---AHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLQPKAVILSGSPASTVDEGSPRA
GUAA_EUBE2      ----DQEKVIVIDFGGQYNQLVARRVRECNVYCEIYSYKTDLAQIKAMNPKGIILTGGPNSCYEDGAPTC
GUAA_BRUMB      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_AGRVS      ---AHPDSVLIIDFGSQVTQLIARRVRETGVYCEIVPFQSSEEGFARLKPKAVILSGSPASALDEGSPRV
GUAA_GEOSF      ------EKILILDFGSQYTQLIARRVREAHVYCELHPFDLELAAIRSFAPSGIILSGGPKSVYEEGAPAV
GUAA_BRUO2      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_RHILW      ---AHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFNRLQPKAVILSGSPASTVDEGSPRA
GUAA_STRZJ      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_STRPJ      --LQDVEKIIVLDYGSQYNQLISRRIREIGVFSELKSHKISAAEVREVNPVGIILSGGPNSVYEDGSFDI
GUAA_RHIL3      ---AHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFHRLQPKAVILSGSPASTVDEGSPRA
GUAA_NOCFA      -----QRPVLVVDFGAQYAQLIARRVREASVYSEVVPHTATVEEIAAKKPLAVILSGGPASVYAEGAPQL
GUAA_GEOMG      ------EKILILDFGSQYTQLIARRVREAHVYCELHPFDMDLAAIRAFAPRGIILSGGPKSVYEEGAPAV
GUAA_ALISL      --------ILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEANSPRA
GUAA_AGRRK      ---AQPDTVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSADAGFKRLQPKAVILSGSPASTVDEGSPRA
GUAA_VIBF1      --------ILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENSPRA
GUAA_RHISN      ---AHPDTVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLKPKAVILSGSPASTLDIGSPRA
GUAA_RHIME      ---AHPDTVLIVDFGSQVTQLIARRVRESGVYCEIVPFQSAEEGFHRLKPKAVILSGSPASTLDTGSPRA
GUAA_LACSS      --------IIVLDYGSQYNQLITRRIREFGIFSELLPNTTTAAEIKKIAPKGIIFSGGPMSVYDGGAFSV
GUAA_DESVM      -----QTKVIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTADQVRAMKPAAVILSGGPASVGEADAPTL
GUAA_VIBFM      --------ILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENSPRA
GUAA_BRAJA      --------ILIVDFGSQVTQLIARRVREDGVYCEIVPFNKAEEAFKEMKPKAVILSGGPESVHEAGSPRA
GUAA_PELPD      --------ILILDFGSQYTQLIARRVREAHVFCELHPFDMEMAAIRAFNPSGIILSGGPKSVYEPGAPAV
GUAA_LACLM      MSDTTLEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDI
GUAA_DESVV      -----QTKVIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTAEQVRAMKPAAIILSGGPASVGEKDAPAL
GUAA_DESVH      -----QTKVIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTAEQVRAMKPAAIILSGGPASVGEKDAPAL
GUAA_CORDI      --------VLVVDFGAQYAQLIARRVREANIYSEVVPHTATVEEIKAKNPAALILSGGPSSVYADGAPSL
GUAA_AZOSB      --------ILILDFGSQVSQLIARRVREQHVYCELHPYDVSEAFIRDFKPQGIILSGGPNSVYEAVDWRA
GUAA_SULDN      --------IIVLDFGSQYTQLIARRLREDKIYCEILPYHTKVADIKAKNPQGIILSGGPSSVYNKDAYEV
GUAA_GEOSL      ------EKILILDFGSQYTQLIARRVREAHVYCELHPFDMGLEAIRAFAPKGIILSGGPKSVYEEGAPAV
GUAA_SINMW      ---AHPDTVLIVDFGSQVTQLIARRVRESGVYCEIVPFQSAEDGFHRLKPKAVILSGSPASTLDVGSPRA
GUAA_VIBVU      --------ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRA
GUAA_RHOPA      ---AIHEKILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDDNAPSA
GUAA_LACLS      MSDTTLEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDI
GUAA_VIBVY      --------ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRA
GUAA_CORGL      --------VLVVDFGAQYAQLIARRVREAGIYSEVIPHTATADDVRAKNAAALVLSGGPSSVYAEGAPSL
GUAA_RHOS5      --MTQHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYNVTEAFLKGFAPKAVIFSGGPSSVFAEGAPMP
GUAA_PELCD      ------EKILILDFGSQYTQLIARRVREAHVYCELHPFDMDLDAIRAFGPKGIILSGGPKSVYEEGAPVV
GUAA_LACLA      MSDTTLEKIIVLDYGSQYNQLIARRIREIGVFSELMSHKVTAKEIREINPIGIILSGGPNSVYDEGSFDI
GUAA_COREF      --------VLVVDYGAQYAQLIARRVREAGIYSEVIPHTATPQEIQEKNPVALVLSGGPSSVYAEDAPGI
GUAA_CORGB      --------VLVVDFGAQYAQLIARRVREAGIYSEVIPHTATADDVRAKNAAALVLSGGPSSVYAEGAPSL
GUAA_BARBK      MDTSHSDTVLIIDFGSQVTQLIARRVRAMGVYSEIVPFQSALGGINRIKPKAVILSGSPYSTLDNGSPRA
GUAA_OLICO      ---AAHDKILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEQAFTAMQPKAVILSGGPASVLEAGAPSA
GUAA_NEIMF      -----QDKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQA
GUAA_NEIMB      -----QDKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQA
GUAA_ROSDO      MSTSDHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPFNLVDDALDAFGAKAVIFSGGPSSVFADGAPMP
GUAA_NEIMA      -----QDKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQA
GUAA_NEIM0      -----QDKILILDFGSQVTQLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQA
GUAA_BRASO      --------ILIVDFGSQVTQLIARRVREDGVYCEIVPFQKAEAAFRQMNPKAVILSGGPESVHEEGSPRA
GUAA_CAUCR      ----DHQRVLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAIVDEYAPSAIILSGGPASVLEADSPRI
GUAA_CAUCN      ----DHQRVLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAIVDEYAPSAIILSGGPASVLEADSPRI
GUAA_NEIG2      -----QDKILILDFGSQVTRLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQA
GUAA_NEIG1      -----QDKILILDFGSQVTRLIARRVREAHVYCELHSFDMPLDEIKAFNPKGIILSGGPNSVY-ESDYQA
GUAA_DESDG      --MEKQNKVIIVDYGSQVTQLIARRIREAGVYSEIHPCIVTAAEVAAMSPSAVVLSGGPASVLGEDSPAL
GUAA_FUSNN      --------IVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYAEGAPSL
GUAA_PROM9      --------ILILDFGSQYSELIARRIRETNVFSLVVSNCISIEEINDINPKGIILSGGPNSVYEKNAPKC
GUAA_ALTMD      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPQGIILSGGPESVTEEGSPRA
GUAA_VIBSL      --------ILILDFGSQYTQLVARRIREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRA
GUAA_VIBPA      --------ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEENSPRA
GUAA_SILPO      MSQTSHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYNVTMDFVREMAPRAVIFSGGPDSVTREGSPRA
GUAA_RHOP2      ---AIHEKILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDADAPAA
GUAA_PHOPR      --------ILILDFGSQYTQLIARRIREIGVYCELWSWDVDEADIRDFNPNGIILSGGPESVTGDESPRA
GUAA_NITWN      --------ILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFLAMKPKAVILSGGPASVLDRXXXXX
GUAA_RHOSK      --MTQHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYNVTEAFLKGFAPKAVIFSGGPSSVFAEGAPMP
GUAA_RHOS4      --MTQHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYNVTEAFLKGFAPKAVIFSGGPSSVFAEGAPMP
GUAA_SALRD      --------IVVLDFGSQYTQLIARRVRETGVYSEIRPCTVEADAIDALNPSGVILSGGPCSVYDEAGPAL
GUAA_RHILO      ------DTVLIVDFGSQFTQLIARRIREAGVFSEIVPFQSAEAAFKRINPKAVILSGGPASTSDIGSPRA
GUAA_CHRVO      --------ILILDFGSQVTQLIARRVREAHVYCELHSFDMPIEEIQAFAPKAIILSGGPNSVY-ESDYQA
GUAA_VIBHB      --------ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEDNSPRA
GUAA_VIBCM      --------ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRA
GUAA_VIBCH      --------ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRA
GUAA_VIBC3      --------ILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGPESVTEANSPRA
GUAA_SILST      MTETAHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYNVTMDFVREFAPKAVIFSGGPDSVTREGSPRA
GUAA_NITHX      --------ILIVDFGSQVTQLIARRIREEGVYSEIVPFQKAEAAFLEMKPKAVILSGGPASVLDKDAPAA
GUAA_RHOS1      --MTQHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYNVTEAFLKGFAPKAVIFSGGPSSVFAEGAPMP
GUAA_THICR      --------ILILDFGSQYTQLIARRIREIGVYCEVEPWDIDVEDIVKFGARGIILSGGPETVTGDNAPVA
GUAA_AGRT5      --IAHPDSILIIDFGSQVTQLIARRIREAGVYCEIHPFQNAAEAFEKLQPKGVIFSGGPASVTAEGSPRA
GUAA_WOLSU      IQLHDKVSLLILDFGSQYTQLIARRLREYGIYCEIVPYHEKLEAIKAREPKGIILSGGPASVYEEDAFLI
GUAA_ACIAD      --------ILILDFGSQYSQLIARRVREAGVYSEMYAFDMSEEDIRAFNPNGIILSGGPESVHEEGSPRA
GUAA_ZYMMO      ------ESILIVDFGSQVTQLIARRVREAGVYSEIVPFNRAEEAFQRLQPKGIILSGSPASVVAEGSPRA
GUAA_SHEPW      MSNIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIRGFAPNGIILAGGPESVTADNSPRA
GUAA_SHELP      MSNIHDHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIKAFAPNGIILAGGPESVTADNSPRA
GUAA_PROMH      --------ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESTTEDNSPRA
GUAA_AERHH      -----QHRILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQMREFNPSGIILSGGPESVTEAGSPRA
GUAA_SHEDO      MSNIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFNPQGIILAGGPESVTAENSPRA
GUAA_SHEAM      MSNIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIVLAGGPESVTEDNSPRA
GUAA_MARAV      --------ILILDFGSQYTQLIARRVREIGVYCEIKAFDITDDELNEFNPKGIILAGGPESVTQLGGPRA
GUAA_KLEP7      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRA
GUAA_SHISS      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALPK      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALPC      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALPB      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALPA      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALNS      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALCH      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_LEGPL      --------LLILDFGSQYTQLIARRVREMGVYCEIYPYNINHEQFKKLNPCGVILSGGPSTVTHDANPRA
GUAA_KLEP3      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRA
GUAA_LEGPA      --------LLILDFGSQYTQLIARRVREMGVYCEIYPYNINHEQFKKLNPCGVILSGGPSTVTHDANPRA
GUAA_ALCBS      --------ILILDFGSQYTQLIARRVREIGVYCEIRAFDMTAEELAEFAPKGIILSGGPESVTAAQTPRA
GUAA_SHIB3      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO27      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_CORAM      --------VLVVDFGAQYAQLIARRVREASIYSEVVPHSATVKEIKAKNPAALILSGGPSSVYADGAPQL
GUAA_SHIBS      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SHESW      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRA
GUAA_SHEPC      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRA
GUAA_SHEB9      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRA
GUAA_SHEB8      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRA
GUAA_SHEB5      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRA
GUAA_SALTY      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALTI      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALHS      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALG2      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALEP      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALDC      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALA4      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ESCF3      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOUT      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOSM      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOSE      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOLC      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOL6      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOL5      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOK1      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOHS      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO8A      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO81      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO7I      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO5E      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO57      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO55      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECO45      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SHIFL      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_RHOPB      ---AAHDKILIVDFGSQVTQLIARRVREEGVYSEIVPFNXXXXXXXXXXXXXVILSGGPASVLDDDAPQA
GUAA_ECOLI      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECODH      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOBW      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_BURPP      --------ILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTETDTPRV
GUAA_ENTS8      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEEQIRGFNPNGIILSGGPESTTEENSPRA
GUAA_CITK8      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRA
GUAA_ARCB4      --------IVVLDFGSQYTQIIARKLREAGVYSEIVPYNEPIGDIVARTPKGIILSGGPASVYAVDAYHP
GUAA_SHIF8      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_ECOLU      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SHEWM      --------ILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIKEFAPNGIILAGGPESVTAKDSPRA
GUAA_SHIDS      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALSV      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_SALAR      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENSPRA
GUAA_MYCTU      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKL
GUAA_MYCTA      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKL
GUAA_MYCBT      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKL
GUAA_MYCBP      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKL
GUAA_MYCBO      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVALVLSGGPASVYADGAPKL
GUAA_ECO24      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRA
GUAA_CAMFF      --------ILVLDFGSQYTQLIARRLREQGVYAELMPFNVSIEAIKAKNPKGIILSGGPASVYAKDAYFC
GUAA_SHEB2      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTAENSPRA
GUAA_METFK      -----QQKILILDFGSQYTQLIARRIREANVYCELHSWDVSDAFIREFNPAGVILSGGPNSVYEDETPRA
GUAA_LEGPC      --------LLILDFGSQYTQLIARRVREMGVYCEIYPYHINHEQFKKLNPCGVILSGGPSTVTHDANPRA
GUAA_AZOSE      --------ILILDFGSQVTQLIARRVREQQVYCEIHPFDVSDDFVREFAPAGVILSGGPNSVYEAVGWHA
GUAA_ALHEH      --------ILILDFGSQYTQLIARRVREAGVYCEIYAWDAPETAIRDFGAAGFILSGGPESMTVDNGPRV
GUAA_AERS4      -----QHRILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPSGIILSGGPESVTEAGSPRA
GUAA_TERTT      --------VLILDFGSQYTQLIARRIREVGVFSEIRAFDMTDEEIREYNPKAIILSGGPESVTAGASPRA
GUAA_SHEFN      MSNIHDHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFAPNGIILAGGPESVTADNSPRA
GUAA_CAMHC      --------IIVLDFGSQYTQLIARRLREQGVYTEILPFNAKISQIKEKNPKGLILSGGPASVYAKDAYFP
GUAA_TOLAT      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPDGIILSGGPESVTESDSPRA
GUAA_SHESM      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRA
GUAA_SHESA      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRA
GUAA_LEGPH      --------LLILDFGSQYTQLIARRVREMGVYCEIYPYHINHEQFKKLNPCGVILSGGPSTVTHDANPRA
GUAA_PECCP      -----QHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGPESTTEFGSPRA
GUAA_EDWI9      -----QDRILILDFGSQYTQLLARRVREIGVYCELWAWDVSEAQIRDFNPSGIILSGGPESTTEAGSPRA
GUAA_PSEPW      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRA
GUAA_MARMS      --------ILILDFGSQYTQLIARRVREIGVYCEVRAFDMEDQDVIDFDPKGIILAXXXXXXXXXXXXRA
GUAA_THIDA      --------ILILDFGSQYTQLIARRVREAGVYCELHPNDVSEDFVREFAPQGIILSGGPNSVYEDETPRA
GUAA_SPIKU      --------IIILDFGSQYTQLIARRIRDLEVYCEVWPYNTALEKIKTTSMKGIILSGGPASVYEEDAFLI
GUAA_SHEON      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRA
GUAA_PSEA6      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESVHAKDSPRA
GUAA_MYCPA      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTATIEEIKARQPRALVLSGGPSSVYEPGAPQL
GUAA_SHESR      MSDIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVTEAQIREFAPNGIILAGGPESVTADNSPRA
GUAA_MYCMM      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTTSIEEIKARDPLALVLSGGPASVYAPGAPQL
GUAA_MYCLE      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTTSIEEITARDPLAIVLSGGPASVYTEGAPQL
GUAA_MYCLB      --------VLVVDFGAQYAQLIARRVREARVFSEVIPHTTSIEEITARDPLAIVLSGGPASVYTEGAPQL
GUAA_ERWCT      -----QHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGPESTTEFGSPRA
GUAA_DECAR      --------ILILDFGSQVTQLIARRVREAKVFCEIHPYDVSEEFIRNYGAKGIILSGGPSSVTEGDTPRA
GUAA_BURXL      --------ILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTETDTPRV
GUAA_POLSQ      --------ILILDFGSQVTQLIARRVRDARVYSEIHPYDCDPEFIRKQGGKGIILSGGPNSVTEDGSPRA
GUAA_SHEPA      MSNIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIREFAPNGIILAGGPESVTAENSPRA
GUAA_OPITP      ------QTIAVLDFGSQLTQVIARRIRECQVYSKIYHFSTPAAQLREEGVIGIILSGGPQSVYARKAPHP
GUAA_PSESM      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRC
GUAA_HAEDU      --------ILILDFGSQYTQLIARRIREIGVYCELWAWDVTEKQIREFNPTGIILSGGPESTTETNSPHA
GUAA_SHEHH      MSNIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEEQIREFAPNGIILAGGPESVTAENSPRA
GUAA_PSYA2      ----KEDRILILDFGSQYSQLIARRVRDSGVFCEMFPYDIDTQRITDFGAKGIILSGGPESVHAENSPRI
GUAA_IDILO      --------ILILDFGSQYTQLIARRIREIGVYCELWAWDVDEADIREFAPKGIILSGGPESVAEEGSPRA
GUAA_CYTH3      ------EKILILDFGSQYTQLIARRVRELNVYCEIHPYNKAIDG----TVKGVILSGSPCSVREENAPDI
GUAA_CAMLR      --------ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLDEIKAKEPKGIILSGGPASVYANDAYFC
GUAA_SULNB      ----KQVPILVLDFGSQYTQLIARKLRESGVYTEVVPYRESIEDIKARKPQGIILSGGPASVYAEDAYKP
GUAA_PSE14      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRC
GUAA_METCA      --------ILILDFGSQYTQLIARRVRELGVYSEIHPYDCGDDFITEFAPQGIILSGGPESVTGTGTPRA
GUAA_GEMAT      --------ILILDCGSQFTQLIARRVREARVYSEIHPPTKSLDWIRAWKPTGIILSGGPSSVTDEGAPTI
GUAA_TREDE      ------EKILIVDFGGQYNQLIARRVRDLNVYSDIVPASKALDYIRENKPIGIIFTGGPNSVYEEKAPLP
GUAA_XANCP      MSSLHNDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVA
GUAA_XANCB      MSSLHNDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVA
GUAA_XANC8      MSSLHNDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVA
GUAA_HAEIE      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFAPTGIILSGSPESTTEENSPRA
GUAA_PSEPK      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRA
GUAA_PSEPG      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRA
GUAA_PSEPF      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDEDAIREFAPKGVILAGGPESVHEANSPRC
GUAA_CAMJR      --------ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLTDIKAKEPKGIILSGGPASVYATDAYFC
GUAA_PSEU2      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVVLAGGPESVHEADSPRC
GUAA_HAEIG      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFAPTGIILSGGPESTTEENSPRA
GUAA_POLNS      --------ILILDFGSQVTQLIARRVRDGRVYSEIHPYDCDPELIRKQGGKGIILSGGPSSVTEEGSPRA
GUAA_CHLTE      --------VIVLDFGSQYTQLIARRIREIGIYSEIFPYHTKAETIRAHQPKAIILSGGPNSVYDEKAFMP
GUAA_PSEP1      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRA
GUAA_PSEMY      --------ILILDFGSQYTQLIARRVREIGVYCELHPWDMSDEDIRAFAPRGIILAGGPESVHEANSPRA
GUAA_CHLT3      --------VIVLDFGSQYTQLIARRIRELGIYSEILPYHTSAEALRERNPKALILSGGPTSVYDAFAPMP
GUAA_XANC5      MTNIHTDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTSPGAPVA
GUAA_PSEF5      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRC
GUAA_PSEE4      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFNPRGIILAGGPESVHEANSPRA
GUAA_HELPY      -------MILVLDFGSQYTQLIARRLRERGIYTEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKP
GUAA_YERE8      --------ILILDFGSQYTQLVARRVREIGVYCELWAWDVTEDQIREFNPSGIILSGGPESTTEHDSPRA
GUAA_XANOR      MTNIHTDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVA
GUAA_XANOM      MTNIHTDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVA
GUAA_HAEIN      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFAPTGIILSGSPESTTEENSPRA
GUAA_CHLCH      --------VLVLDFGSQYTQLIARRIRELNIYSEILPYNTPADTIRTHQPKAIILSGGPNSVYDQTAFMP
GUAA_BURP8      --------ILILDFGSQVTQLIARRIREAHVLSEIHPHDVSDEFIRDFKPTGIILSGGPNSVTETDTPRA
GUAA_XANOP      MTNIHTDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVA
GUAA_SERP5      --------ILILDFGSQYTQLVARRVREIGVYCELWAWDVSEEQIREFNPSGIILSGGPESTTEANSPRA
GUAA_CAMJE      --------ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFC
GUAA_HAEI8      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFAPTGIILSGSPESTTEENSPRA
GUAA_PSEFS      --------ILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRC
GUAA_DINSH      MTQFDHDRLLIIDFGSQVTQLIARRLRELNVFCEIHPFQNVTDAFLADAPKAVIFSGGPASVIDANSPRP
GUAA1_BACTN     -----QEKIIILDFGSQTTQLIGRRVRELDTYCEIVPYN----KFPKEDPKGVILSGSPFSVYDKDAFKV
GUAA_LEIXX      -------------------------MREANVYSEIVPHTVTAADIAAKRPAGIILSGGPSSVYEEGAPRL
GUAA_RALEH      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAIILSGSHASTYEDHQLRA
GUAA_HELPS      -------MILVLDFGSQYTQLIARRLRESGIYAEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKP
GUAA_CAMJJ      --------ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFC
GUAA_CAMJ8      --------ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFC
GUAA_XANAC      MTNIHTDKILILDFGAQYTQLIARRIREIGVYCEIWAWDHDPSEIAGFGAKGIILSGGPESTTLPGAPVA
GUAA_NITMU      --------ILILDFGSQYTQLIARRVRESNAYCEIHPFDISSQFIGNFAPAGIILSGGPASVAENETPRA
GUAA_CHLL2      --------VLVLDFGSQYTQLIARRIRELGIYSEILPYNTTPETIREHAPKAIILSGGPTSVYGESAILP
GUAA_BACFR      -----QEKIIILDFGSQTTQLIGRRVRELDTYCEIVPYN-KFPK-GDETVKGVILSGSPFSVYDESAFKV
GUAA_BACFN      -----QEKIIILDFGSQTTQLIGRRVRELDTYCEIVPYN-KFPK-GDETVKGVILSGSPFSVYDESAFKV
GUAA_YERPY      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERPS      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERPP      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERPN      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERPG      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERPE      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERPB      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERPA      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_YERP3      --------ILILDFGSQYTQLLARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSPESTIENGSPRA
GUAA_PSYIN      -----EQRILILDFGSQYTQLIARRIREIGVYCELWSWDVDEQDIKDFAPNGIILAGGPESVTAEGSPRA
GUAA_PELPB      --------VLVLDFGSQYTQLIARRIRELGIYSEILPYNTTPESIREHNPKAIILSGGPTSVYDASAILP
GUAA_ACTPJ      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRA
GUAA_PETMO      ------EKILVIDYGSQYTQLLAKRIRDLGVFSEVIQYD---DNISLSNVKGIILSGGPDSVYNIDAPDI
GUAA_PELLD      --------VLVLDFGSQYTQLIARRIRELGIYSEILPYSTTPEAIREHDPKAIILSGGPTSVYGESAILP
GUAA_DESMR      --MSQPDKVLILDFGSQYTQLIARRVREAGVYSEIHPCTVTAKEVAAMAPKAVILSGGXXXXXXXXXXXX
GUAA_PORGI      ------EKLIILDFGSQTTQLIARRIRELNTYCEVYPYNKLPEDLSGV--RGIILSGSPYSVYDSKAFRI
GUAA_PASMU      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVSEADIREFNPTGIILSGGPESTTEENSPRA
GUAA_DEIDV      --------VVILDFGSQFTRLIARRFRELGAYSVILPGTASLERIGQENPQGIVLSGGPSSVYDERAPRP
GUAA_CUPTR      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAIILSGSHASTYEDHQLRA
GUAA_BURM1      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_BORBR      --------ILILDYGSQVTQLIARRVREAGVYSEIHAGDVDDAFVRAQGLKGIILSGSHASAYEEGSMRV
GUAA_SODGM      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEQDSPRA
GUAA_PHOLL      -----QHRILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPSGIILSGGPESTTAQGSPRA
GUAA_CAMJD      --------ILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAKEPKGIILSGGPASVYATDAYFC
GUAA_PORG3      ------EKLIILDFGSQTTQLIARRIRELNTYCEVYPYNKLPEDLSGV--RGIILSGSPYSVYDSKAFRI
GUAA_HELP2      -------MILVLDFGSQYTQLIARRLRESGIYTEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKP
GUAA_BURS3      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_STRMK      MTNIHNDKILILDFGAQYTQLIARRIRELGVYCEIWAWDHNPAEIAGFGAKGIILSGGPESTTLPGAPAA
GUAA_STRM5      MTNIHNDKILILDFGAQYTQLIARRIRELGVYCEIWAWDHNPAEIAGFGAKGIILSGGPESTTLPGAPAA
GUAA_MYCPE      --------ILILDFGGQYTQLIARRIRDLNVYSEIVDYDISIEEIIKKNPKGIILSGGYDSVYGDRSIKP
GUAA_HELPG      -------MILVLDFGSQYTQLIARRLRESGIYTEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKP
GUAA_HAMD5      ----DRHRILILDFGSQYTQLLARRIREMGVYSELWPWDVAAERIQAFHPQGIILSGGPESATENDTPRA
GUAA_BURCH      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_BURCC      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_BURCA      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_ACTP7      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRA
GUAA_ACTP2      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRA
GUAA_RALEJ      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREYAPKGIILSGSHASTYEDHQLRA
GUAA_ENT38      --------ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEDNSPRA
GUAA_ACTSZ      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFNPTGIILSGGPESTTENDSPRA
GUAA_RALME      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVTDEFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_HELAH      -------MIVVLDFGSQYTQLIARRLRESGIYAEIVPFFESTENIQKKAPKGLILSGGPASVYAKDAYTP
GUAA_BORPE      --------ILILDYGSQVTQLIARRVREAGVYSEIHAGDVDDAFVRAQGLKGIILSGSHASAYEEGSMRV
GUAA_SHESH      MSNIHEHKILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIKGFAPNGIILAGGPESVTADESPRA
GUAA_HELPJ      -------MILVLDFGSQYTQLIARRLRESGIYAEIVPFFESVENIQKKAPKGLILSGGPASVYAKDAYKP
GUAA_BORPA      --------ILILDYGSQVTQLIARRVREAGVYSEIHAGDVDDAFVRAQGLKGIILSGSHASAYEEGSMRV
GUAA_PSEHT      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPQGIILSGGPESTTLENSPRA
GUAA_HAHCH      --------ILILDFGSQYTQLIARRVREIGVYCEIYPFDMSEADIREFNPKGVILAGGPESVTELGSPRA
GUAA_COLP3      --------ILILDFGSQYTQLIARRVREIGVYCELWSWDVTEEQIKGFNPTGIILAGGPESVTEANSPRA
GUAA_MANSM      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIREFNPTGIILSGGPESTTEDNSPRA
GUAA_HAEPS      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEENSPRA
GUAA_ELUMP      --------ILILDFGSQYTQLIARRLREEQIYCEILPFNTKYEDIIALDPAGVILSGGPSSVYGAGAPKP
GUAA_CELJU      --------ILILDFGSQYTQLIARRVREIGVFSEIRAWDMSDDEIRAYKPSGIILAGGXXXXXXXXXXXX
GUAA_XYLFM      --------ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAA
GUAA_COXBR      -----QHRILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRA
GUAA_HAES1      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEANSPRA
GUAA_BURPS      -SAAMHDKILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_BURP6      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_BURP1      -SAAMHDKILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_BURP0      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_BURMS      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_BURMA      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_BURM9      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_BURM7      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKGVILSGSHASTYEDHQLRA
GUAA_THEM4      --------VVVLDYGSQYTQLIVRRVREKGYYAELLPWDAKEEEVKRLNPTAIILSGGPSSVYEKDAPFV
GUAA_PSEAE      --------ILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRA
GUAA_PSEA8      --------ILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRA
GUAA_MICLC      --------VLVLDFGAQYAQLIARRVREANVYSEVVPASTPAAQILEREPAALILSGGPSSVYEPGAPQL
GUAA_HELPH      -------MILVLDFGSQYTQLIARRLRESGIYAEIVPFFESIENIQKKAPKGLILSGGPASVYAKDAYKP
GUAA_BURVG      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_BURCJ      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDDFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_BURA4      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_RALPJ      --------VLILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAIILSGSHASTYEDHQLRA
GUAA_PSEAB      --------ILILDFGSQYTQLIARRVREIGVYCEIHPFDMSNEAIIAFAPRGIILAGGPESVHEADSPRA
GUAA_JANMA      --------ILILDFGSQVTQLIARRVRDSGVFSEVFPYDVSDEFVRNYGAAGVILSGGPNSVIGDESPRV
GUAA_BURCM      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFVREFAPKAVILSGSHASTYEDHQLRA
GUAA_HAES2      --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPTGIILSGGPESTTEANSPRA
GUAA_CHLPD      --------VTVLDFGSQYTQLIARRIRELGIYSEILPYNASPETIREHDPKAIILSGGPTSVYGDSALLP
GUAA_BORPD      --------ILILDYGSQVTQLIARRVREAGVYSEIHPGDVDDAFVRGQGLKGIILSGSHASAYAEDSLRV
GUAA_BACV8      -----QEKIIILDFGSQTTQLIARRVRELNTYCEIVPYN----KFPHNDPSGVILSGSPFSVYDESAFKV
GUAA_XYLFA      --------ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAA
GUAA_RALSO      --------VLILDFGSQVTQLIARRVREAHVYCEIHPNDVSDAFVREFAPKAIILSGSHASTYEDQDLRA
GUAA_PROVI      --------VLVLDFGSQYTQLIARRIRELGIYSEILPYSTTPETIREHNPRAIILSGGPTSVYGDSAILP
GUAA_NITOC      --------ILILDFGSQYTQLIARRVREAGVYCEIHPYDMAESTLRDFAPRGIILSGGPASTVGETAPRL
GUAA_HERAR      --------ILILDFGSQVTQLIARRVRDSGVFSEVYPYDVSDEFVRNYGAAGVILSGGPNSVIGDESPRV
GUAA_XYLFT      --------ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAA
GUAA_XYLF2      --------ILILDFGAQYTQLIARRIREIGVYCEVWPWDHSPEEILSFGAKGIILSGGPESTTSPGAPAA
GUAA_DEIRA      --------IVILDFGSQFTRLITRRFRELGAYSVILPGTASLERIQQENPQGIVLSGGPSSVYDEGAPRP
GUAA_BORA1      --------ILILDYGSQVTQLIARRVREAGVYSEIHPGDVDIREQAAQGLKGVILSGSHASAYEEGSMRV
GUAA_THEAB      --------VVVLDYGSQYTQLIVRRVREKGYYAELLPWDASKEEVQNLNPAAIILSGGPASVFEKDAPFV
GUAA_CANAL      ------DTILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKIAELSWK-PKGIILSGGPYSVYAEDAPHV
GUAA_THESQ      -------MVLVVDYGSQYSRLITRRIRENEVYSEVVFPD---DKVDLSKVDAVILSGGPRSVYEEDAPKL
GUAA_THEMA      -------MVLVVDYGSQYSRLITRRIRENEVYSEVVFPD---DKVDLSKVDAVILSGGPRSVYEEDAPKL
GUAA_YARLI      ------DTILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKIAELPWK-PKGVILSGGPYSVYAEGSPHV
GUAA_THEP1      -------MVLVVDYGSQYSRLITRRIRENEVYSEVVFPD---DKVDLSKVDTVILSGGPRSVYEEDAPKL
GUAA_DEBHA      ------DTILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKISELTWK-PKGIILSGGPYSVYEDGSPHV
GUAA_KLULA      ------DTILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKIADLHWK-PKGVILSGGPYSVYEKDAPHV
GUAA_COXBU      -----QHRILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRA
GUAA_COXB2      -----QHRILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRA
GUAA_YEAST      ------DTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKISEL-GWTPKGVILSGGPYSVYAEDAPHV
GUAA_PARD8      ------EKLIILDFGSQTTQLIGRRVRELNMYCEIVPYNKFPHD--ATDVKGVILSGSPYSVYDENAFKA
GUAA_COXBN      -----QHRILILDFSSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRA
GUAA_ASHGO      ------DTILVLDFGSQYSHLITRRLREFNVYAEMLPCTQKISELGWK-PKGVILSGGPYSVYAADAPHV
GUAA_CHLPB      --------VLVLDFGSQYTQLIARRIREIGIYSEIVPYNTPLEKIREHNPGAIILSGGPSSVYGESAFHP
GUAA_COXB1      -----QHRILILDFGSQYAQLIARRVREIGVYCELMPCDIDEETIRDFNPHGIILSGGPETVTLSHTLRA
GUAA_NITEU      --------ILILDFGSQYTRLIARRIRETNVYCELHPFDVSPQFIREFAPIGIILSGGPASTFTEDAPRV
GUAA_DEIGD      --------VVILDFGSQFTRLIARRLRELGAYSVILPGTASLERIAQENPQGIVLSGGPSSVYDANAPRP
GUAA_RHOFD      --------ILILDFGSQVTQLIARRIREAHVFCEVHPCDVTDDWVRAYKLKGVILSGSHASVYEETTDKA
GUAA_EHRCR      --------VAIIDFGSQFTQLLARRIRELNVYSEIFPHDIAFDYIK--DSKAFILSGGPKSVLDFTGPPI
GUAA_METPP      --------ILILDFGSQVTQLIARRVREAHVYCEIHPNDVSDEFIREFAPKGIILSGSHASTYEDHDLRA
GUAA_EHRCJ      --------VAIIDFGSQFTQLLARRIRELNVYCEIFTPDVEFDLVK--DSKAFILSGGPKSVASAEIPKI
GUAA_CANGA      ------DTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKIADLHFK-PKGVIMSGGPYSVYAEDAPHV
GUAA_VESOH      --------ILILDFGSQYTQLIARRVREIGVYCELSHYDINSDFIKKFNPKGVILSGGPDTVTFDNSARA
GUAA_USTMA      ---SQYDSILILDFGSQYSHLITRRCRELNVYCEMLPCTQKIKDLDWK-PKGIILSGSPYSVYDEVAPRV
GUAA_PHANO      ------DTILVLDFGSQYTHLITRRLRELNVYSEMLPCNTKLADLPF-TPKGIILSGGPYSVYEEGAPHV
GUAA_FRATT      --------ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_FRAT1      --------ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_FRATM      --------ILILDFGSQYTQLIARRVREVDVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_FRATW      --------ILILDFGSQYTQLIARRVRELGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_FRAP2      --------ILILDFGSQYTQLIARRVREVGVFCEIFPHDIADDFIKDYHAKGIILSGGPESVYDSKAPEI
GUAA_FRATN      --------ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_GRAFK      -----QNNVLILDFGSQYTQLIARRVRELNIYCEIYPYHKIPEDLSGF--KAVILSGSPFSVRAEDAPHP
GUAA_MESFL      --------ILILDFGSQYTQLLARRVREANIYTEVLPFDTSIEKIK-EYPKGIILSGGPSSVYLQNAYKI
GUAA_WOLWR      --------IAIIDFGSQFTQLIARQVRGMGVYCEIFPSNISFETISKFN--GFILSGGPQSVNDDCSET-
GUAA_WOLPM      --------IAIIDFGSQFTQLIARQVRGMGVYCEIFPSNISFETISKFN--GFILSGGPQSVNDDCSET-
GUAA_FRATH      --------ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_BDEBA      ---------VILDFGSQFTQLIARRLREMGFYSEIHSFEYPTEEIRKKNPYGIILSGGPNSVYEAGSPQR
GUAA_FRATO      --------ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_FRATF      --------ILILDFGSQYTQLIARRVREVGVFCEIFPHDVAADFIKNYQAKGIILSGGPESVYDSKAPEI
GUAA_SCHPO      ------DTILILDFGSQYSHLIARRLREIHVYAELLPCTQKIEALPFK-PIGVILSGGPYSVYDDIAPHV
GUAA_BRUME      ---AYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSPRA
GUAA_EMENI      ------DTILVLDFGSQYTHLITRRLREINVYSEMLPCTQKLADLGWK-PKGIILSGGPYSVYEEGAPHA
GUAA_NITEC      --------ILILDFGSQYARLIARRIRETSVYCELHPFDVSPQFIREFSPVGIILSGGPASIFTNDAPRV
GUAA_RUTMC      --------ILILDFGSQYTQLIARRVREIGVYCELFPYDVDSEFIKKLNPKGIILSGGPDTVTLDNAAKA
GUAA_ANAMF      --------VAIVDFGSQVTQLIARRVRELGVYSEVFPPSTDFQAMASRGIKAFILSGGPNSVQQHGVPNA
GUAA_ANAMM      --------VAIVDFGSQVTQLIARRVRELGVYSEVFPPSTDFQAMASRGIKAFILSGGPNSVQQHGVPNA
GUAA_BORGA      --------ILVLDFGSQYSQLIARRIREIGVYTKVIPYYTPLKEIKNMNIAGIILSGGPASVYAKDAPTL
GUAA_FLAJ1      -----QHNVLILDFGSQYTQLIARRVRELNIFCEIFPYNHIPSDLSSY--KAVILGGSPFSVRGEDAPHP
GUAA_BLOPB      --------ILVIDFGSQYTQLLLRRIRELGVYSESCSWNISKSQVYAFNPNGIILSGGPYSVIDNDSPYI
GUAA_BAUCH      --------ILILNFGSQYAQLLVRRVRELGVYCELRAWDITEAQIREFAPNGIILSGGPESTLTIDSPRA
GUAA_ASPOR      ------DTILTLDFGSQYTHLITRRLRELNVYSEMLPCTQKLADLKFK-PAGVILSGGPYSVYEEGAPHV
GUAA_PYRAE      ------EKVLVVNFGGQYAHLIARRIREVGVYAEIASPEEAVIKASKEEVKAVILSGGPSSVYEPGAPDI
GUAA_FLAPJ      -----QHNVLILDFGSQYTQLIARRVRELNIFCEIFP----FDKIPTDLSKAVILGGSPFSVRSEDALHP
GUAA_AERPE      --------VLVVDFGGQYAHLIARRIRELGVYSEIVPAT-SLDALGEALPRGVVLSGGPGSVWGSRHDEA
GUAA_WOLPP      --------IAVIDFGSQFTQLIARQIREMGVYCEIFPSNIDFETVSKFN--GFIFSGGPQSVVSEVAHKI
GUAA_EHRRW      --------VAIIDFGSQFTQLLARRIRDLNIYSEIFLPNVAFDLIKGVD--AFILSGGPRSVNSDGIPKI
GUAA_TROW8      --------VLVVDFGSQYSQLVVRAIRECGYYAEFASPSISAAECLALSPIAIFLSGGPASAYKDNAPKL
GUAA_TROWT      --------VLVVDFGSQYSQLVVRAIRECGYYAEFASPSISAAECLALSPIAIFLSGGPASAYKDNAPKL
GUAA_EHRRG      --------VAIIDFGSQFTQLLARRIRDLNIYSEIFLPNVAFDLIKGVD--AFILSGGPRSVNSDGIPKI
GUAA_BORBU      ------QAILVLDFGSQYSQLIARRIREIGVYTKVIPYYTPLKEIKNMNISGIILSGSPASVYSKEAPTL
GUAA_CHLFF      --------ILILDFGSQYTNVLAKKIRLLSVFCEVLPWNTPLEDILQESPSGLIFSGGPHSVYQENSPKV
GUAA_ASPFU      ------DTILTLDFGSQYTHLITRRLREIGVYSEMLPCTQKLADLPFK-PKGIILSGGPYSVYEDGAPHA
GUAA_CHLMU      --------ILILDFGSQYTNVLAKKIRLLSVFCEVLPWNTPLEKILQKSPSGLIFSGGPHSVYQNNSPEV
GUAA_CHLCV      --------ILILDFGSQYTNVLAKKIRLLSVFCEVLTWNTPLEKILQISPSGLIFSGGPHSVYQENSPKV
GUAA_PELUB      --------ILIIDFGSQFTQLIARRVRELGVFSEIVSHKIKIAQITKDNIAGIILSGGPLNVYENXXXXX
GUAA_BLOFL      MKQCTRQCILIIDFGSQYTQLLLRRIRELGIYAKVCDWNISQDLLVSLNPNGIIFSGGPDSVTNKHSSSI
GUAA_WIGBR      ------QYILIIDFGSQYTKLVARRMKDIGAKFIISSWEXXXXXXXXXXXXXXXXSGSPMSVLDDKSPYV
GUAA_WOLTR      --------IAIIDFGSQFTQLIARQIREMDVYCEIFPSNISFETISKFN--GFILSGGPQSVHDSEASGV
GUAA_GIBZE      --------------------LILRRLRSLGVYSEMLPCTQKIKDLGWK-PVGVILSGGPSSVYADDAPGV
GUAA_THET2      -------MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
GUAA_THET8      -------MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRP
GUAA2_BACTN     ----KQDMIVILDLGSHENTVLARAIRALGVYSEIYPHDITVEELKAPXXXXXXXXXXXXXXXXXXAIDV
GUAAB_METJA     ----------------------------------------------------------------------
GUAAB_PYRKO     ----------------------------------------------------------------------
GUAA_HELHP      --------ILVLDFGSQYTQLIARRLREYGVYTEIVPYFEKLDSIKSKNPKGIILSGGPASVYEKDAYKP
GUAAB_PYRHO     ----------------------------------------------------------------------
GUAAB_PYRAB     ----------------------------------------------------------------------
GUAAB_PYRFU     ----------------------------------------------------------------------
GUAAB_METTH     ----------------------------------------------------------------------
GUAAB_METVS     ----------------------------------------------------------------------
GUAAB_METM7     ----------------------------------------------------------------------
GUAAB_METMP     ----------------------------------------------------------------------
GUAA_DICDI      ------EVIVILDAGSQYSKVIDRRVRELNVASEIHPLNIDLLELXXXXXXXXXXXXXPESVYGENAPKF
GUAA_PONAB      --------VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWF
GUAA_HUMAN      --------VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWF
GUAA_LEPIN      --------IAVVDFGGQYAHLIASRIRRLGAYTEILSNEEPISNYQKYS--GIILSGGPESVYEPNSPTV
GUAA_LEPIC      --------IAVVDFGGQYAHLIASRIRRLGAYTEILSNEEPISNYQKYS--GIILSGGPESVYEPNSPTV
GUAA_MOUSE      --------VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWF
GUAA_RAT        --------VVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWF
GUAAB_UNCMA     ----------------------------------------------------------------------
GUAAB_ARCFU     ----------------------------------------------------------------------
GUAA_CAEEL      ------ERIAILDFGAQYGKVIDRRVRELLVQSEMFPLNTTARTIELGGFKGIIISGGPNSVFEPEAPSI
GUAAB_METBF     ----------------------------------------------------------------------
GUAAB_METB6     ----------------------------------------------------------------------
GUAAB_METMA     ----------------------------------------------------------------------
GUAAB_METAC     ----------------------------------------------------------------------
GUAAB_THEAC     ----------------------------------------------------------------------
GUAAB_METMJ     ----------------------------------------------------------------------
GUAAB_THEVO     ----------------------------------------------------------------------
GUAAB_PICTO     ----------------------------------------------------------------------
GUAAB_METPE     ----------------------------------------------------------------------
GUAAB_HALSA     ----------------------------------------------------------------------
GUAAB_HALS3     ----------------------------------------------------------------------
GUAAB_METBU     ----------------------------------------------------------------------
GUAAB_NATPD     ----------------------------------------------------------------------
GUAAB_HALMA     ----------------------------------------------------------------------
GUAAB_METKA     ----------------------------------------------------------------------
GUAAB_HALLT     ----------------------------------------------------------------------
GUAA_CHLPN      --------IFILDFGSQYTYVLAKQVRKLFVYCEVLPWNISVQCLKERAPLGIILSGGPHSVYENKAPHL
GUAAB_SULSO     ----------------------------------------------------------------------
GUAAB_SULIY     ----------------------------------------------------------------------
GUAAB_SULIN     ----------------------------------------------------------------------
GUAAB_SULIM     ----------------------------------------------------------------------
GUAAB_SULIL     ----------------------------------------------------------------------
GUAAB_SULIK     ----------------------------------------------------------------------
GUAAB_SULIA     ----------------------------------------------------------------------
GUAAB_SULTO     ----------------------------------------------------------------------
GUAAA_PYRKO     -------MIVIMDNGGQYVHRIWRTLRYLGVEAKIIPNTTPLEEIKAMKPKGIIFSGGPDINKTGNCSAI
GUAAA_PYRHO     -------MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKV
GUAAA_PYRFU     -------MIIIMDNGGQYVHRIWRTLRYLGVEAKIIPNTTPLDEIKAMKPKGIIFSGGPSLENTGNCEKI
GUAAA_PYRAB     -------MIVIMDNGGQYVHRIWRTLRYIGVESKIIPNTTPLEDIKAMNPSGIIFSGGPSLENTGNCEKI
GUAAA_SULAC     --------VAVIYFGGQYNHLIVKDLKYLGLEAVAITPDKSVEELKEFD--SVVFGGGPYSVINEKMGFA
GUAAA_METJA     -------MIVILDNGGQYVHRIHRSLKYIGVSSKIVPNTTPLEEIESKEVKGIILSGGPDI---EKAKNC
GUAAA_METST     --------IVIINNFGQYNHRISRTLKYLNIENSLIPNTTSFEEIEQMNPKGIILGGGPSI---ERIGNC
GUAAA_SULSO     -------------YGGQYNHLILKNVKYLGADIEVIPPHKPVEELKKFDC--VIFSGGPYSVSEEIQKMG
GUAAA_METTH     -------MILIINNHGQYNHRIHRTLRYLQIPSELVPNTTPLDEIISRDPEGLILGGGPSL---ERSGNC
GUAAA_METVS     -------MIVILNNGGQYVHRIQRSLKYIGVPAKIVLNSTNLEEIE-KNPKGIILSGGPDIT---KATNC
GUAAA_METBU     --------IIVINNYGQFCHLIHRTVRDLDMDTKIVANTTSVEDILDEEPDGIILSGGPSM---ERVGSC
GUAAA_METBF     --------ILVVNNYGQFCHLIHRAVRDLDMDTKIIPNTTPIEDILAEEPDGLILSGGPEM---DRAGLC
GUAAA_SULTO     --------IAVIYFGGQYNHLIVKDLKYLGLNAVLITPEKPVEILKDYDC--IIFGGGPYSVITEKMGNA
GUAAA_METMP     -------MIVILNNGGQYVHRIQRSLKYLDVPAKIVPNSTTLEEIAA-NPKGVILSGGPDIT---KATNC
GUAAA_HALWD     --------IAVIDNHGQFTHLEQRALRDLGVDVELVDNTTSPEQL-IQTADGLVLSGGPDIDRVGNCPEY
GUAAA_METM6     -------MIVILNNGGQYVHRIQRSLKYLEVPAKIVPNSTTLEEIIADSEKGIILSGGPDIT---KATNC
GUAAA_METS3     --------ILVINNKGQYNHRIQRSLQYLKIPTELVPNTLSIEEIEAKNXXXXXXXXXXSI---EGAGNS
GUAAA_METM7     -------MIVILNNGGQYVHRIQRSLKYLGVPAKIVPNSTTLEEITV-NPKGIILSGGPDIT---KATNC
GUAAA_METM5     -------MIVILNNGGQYVHRIQRSLKYLDVPAKIIPNSTTLEEIIADSEKGIILSGGPDIT---KATNC
GUAAA_METMA     --------ILVVNNYGQFCHLIHRTVRDLDMDTKIIPNVTPIEEILAEEPDGLILSGGPEM---ERAGLC
GUAAA_METKA     -------MILIIDNHGQYVHLIRKNFDYMGVPAEIIPNTTDPEDVRER-ASGVVISGGPSR---ERAGNS
GUAAA_METAC     --------ILVVNNYGQFCHLIHRAVRDLDMDTKIIPNVTPIEDILAEEPDGLILSGGPEM---ERAGLC
GUAAA_ARCFU     ---------------GQYNHLIHRTLRDLGVETKLVENTTPVEQLK--DVDGLVIGGGPSL---DRTGNC
GUAAA_METTP     --------ILVVNNYGQFNHLIYRSIKD-RVEARMISNETPVEDIVAD---GLILGGGPSM---DRSGRC
GUAAA_NATPD     --------IVVVDNHGQFTHLEHRALRDLGVDTELIDNDTPPEEIDAD---GIVLSGGPDM----DRIGH
GUAAA_UNCMA     --------LLVINNYGQTCHLIHRSLRDLGMDAKLVSNTSTVEDILKQSPDGLVFSGGPTM---ERAGNG
GUAAA_META3     -------MIVILNNGGQYVHRIHRSLRYLKIPSKIIPNSTPLXXXXXXXXXXXXLSGGPDI---EKASNC
GUAAA_HALMA     ----------VIDNHGQFTHLEQRALRDMGVDVSLRDNTTPPEEIDAD---GIVLSGGPDMDDIGNCPEY
GUAAA_PICTO     --------IYIIDNGGQWTHREWRTVRDLGVDSTIVPNTVDADVLA--DADGIILSGGPASIESEKLGNI
GUAAA_METB6     --------ICVVNNYGQFNHLIHRALRDLDIDAVLIPNTTPREEI-ASQYRGIILGGGPDIARAG----V
GUAAA_HALSA     --------ILVVDNHGQFTHLEHRLLRDMD--------GVTVDLTDNTTPPGLVLSGGPTMAIGHCREYL
GUAAA_THEVO     --------IYVVDNGGQWTHREWRVLRELGVETEIVPNDIESRKXXXXXXXXXXXXAPNIDEEMDKLGSI
GUAAA_IGNH4     --------VLVVAFGGQYNHLIKRSIERIGHEAALRPYN--LPPPDEGEFDCVVFGGGPLTMPKDFDKVK
GUAAA_METMJ     --------LYVVNNHGQFNHLILRTLRDMDIEATMISNETPPAEV-ARGCRGIVLGGGPTL---ERAG-V
GUAAA_THEAC     --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNXXXXXXXXXXXXXXXXXXAPNIDEELDKLGSV
GUAAA_METHJ     ------------------------------------PNTTPVSEVR-EGCQGIILGGGPDI----SRAGL
TRPG_THEMA      --------VIVIDNYDSFVYNIVQYIGEVEPDCEIEVFRITIEEIERKNPTHIVISPGPGRPE-EAGISV
TRPG_AZOBR      -------MLLLIDNYDSFTYNLVHYLGELGAELDVRRNDLTVEEAMALRPEGIVLSPGPCDPAGICLPLI
TRPG_CYAPA      -------MILLIDNYDSFTYNLAQYLSELNIKVLVKRNDITLDEIKNLNIQGIIISPCPG---GPEDSGI
TRPG_METJA      ----EVKKVLVIDNIDSFVWNLVQYVGTLGYKVKLVDNKITLDEIKKINPDRIIISPGPKTP--KEAGNC
PABA_BACSU      -------MILMIDNYDSFTYNLVQYLGELGEELVVKRNDITIDEIEELSPDFLMISPGPCSPDEAGISLE
TRPG_ARCFU      ---------------------------------------------------GVVISPGPG-----KPDRS
PABA_SALTY      -------MILLIDNYDSFTWNLYQYFCELGAEVQVRRNDLTLAHIDALNPQKIVISPGPCTPNDAGISLA
PABA_ECOLI      ---------------------------------------LTLADIDALKPQKIVISPGPC--------TP
TRPG_HELPY      ----------------------------------------------------------------------
TRPG_HELPJ      ----------------------------------------------------------------------
CARA_GRATL      --------IILIDFGVKYN--ILSRLDNYGCSIQILPATSSYETINAYNPDGIILSNGPGSIITYAIKTV
CARA_CAUCR      --------VVVIDYGVKRN--ILRALAHVGARATVVPASTSAEDILARNPDGVMLSNGP----GDPAATG
TRPG1_HALMA     ---------------------------------EVVRNTASLDDVEAFDPDAIILSPGPGHPKNERDVGV
TRPG_PYRKO      ---------------------------------KVVPNTITVGELRRLDPDGVIISPGPGHPLERREVGN
TRPG_PORYE      -------MILIIDNYDSFTYNLAQCVGELG-YDVLVCRNDEIDTIKQLNPNKIIISPGPGKPSDSGISLD
TRPG_PHYBL      -------------------QYLCSQGADVVVY---RNDKITVDEIVKLNPVNIVISPGPGHPSHDAGVSR
CARA_MARMM      --------VVVLDYGVKAN--ILRLLTGAGARVAVLPGKASIDDIKALNPDGVVVSNGPGAETGKYALPT
TRPG_METTH      -------VILIIDNYDSFTQLAGEILRDEGMDEEIRNDEARISDLRALDPEKIIISPGPGSRRSDFGVCM
TRPG_PORPU      -------MILIIDNYDSFTYNLAQCVGELGLVCRND--EIDVVKIKKLNPEKIIISPGPGKPT-ESGISL
TRPG_PSEAE      -------MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDLSVEQIEALAPERIVLSPGPCT---PNEAGV
TRPG_LACLA      -------MILIIDNYDSFTYNLVQYVGVLTDVAVVKNDDDSLGNM-AEKADALIFSPGPG--WPADAGKM
TRPG_ACIAD      -------MLLMIDNYDSFTYNIVQYFGELNQDVKVVRNDVTLEDIERWQPKYLVVGPGPCSP--TEAGIS
PABS_STRGR      ----------------------------------------------------------------------
CARA_BARHE      --------IVAIDYG--IKRNILRLIAAHSAHITIVPANTNIEEILAMNPDGVFLSNGPAATANYAVPTI
TRPG_YEAST      ---------------------------------------ITVPEIAALNPDTLLISPGPGHPKTDSGISR
CARA_METS5      ------------------------------------PCKSSADEIMNYSPKGIVFGNGPGNPNILKDLVK
TRPG_PICAN      ---------------------------------------ITIPEIEQLKPDVVVISPGPGHPRTDSGISR
CARA_BARQU      --------IVAIDYG--IKRNILRLMAAHGARITIVPANTNVEKILAMNPDGVFLSNGPTATANYAVPTI
TRPG_THET8      -----------------------------------------LEEVEALDPDRILISPGPCTPFGLSVPLV
TRPG_HALVO      ---------------------------------EVRKTTASLDEIRDLDPDAIVISPGPGHPKNDRDVGV
TRPG_METTM      ------KLILIIDNYDSFTHNLYQMAGEIMMEMDVRNDEVDIDYVRGLDPERIIISPGPGNIKREDFGIC
CARA_SULSO      ------DMIVVVDCGGILYGLYKRGFSIVRVPCSF-----SASKIIEYNPKGIVFSNGPGNLLENQIKTF
CARA_RHILO      --------VVAIDYGVKRN--ILRLLAGLGAKVTVVPANTGSEEILAMQPDGIFLSNGPGDATGDYAVPV
CARA_AKKM8      --------IVAFDFGIKYN--ILRQLRENGFRVTVVPAHTTAEEVLAMNPDGVFLSNGP----GDPATLT
TRPG_LEPBI      --------------------------------------------IKSANYDKIIISPGPGH-------PA
TRPG_PSEPU      -------LLMMIDNYDSFTYNVVQYLGELGAEVKIRNDEMTIAQIEALNPERIVVSPGPCTP-SEAGVSI
CARA_SALTY      --------VVAYDFGAKRN--ILRMLVDRGCRLTVVPAQTSAEEVLKMNPDGIFLSNGP----GDPAPTA
CARA_RHOBA      --------VVCMDFGMKWN--IPRHLRSRGNRVTIVPGNASADDILKMDPDGVFLSNGPGD--PEPLTYA
Y221A_HAEIN     --------ILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQXIREFAPE-------------------
Y1171_HAEIN     --------LLIINNHDSFTFNLVDLIRKLNVPYDV----LNVEDLKAENYSHILISPGPD------IPRA
TRPE_AZOBR      ----EGRRVLLVDHDDSFVHTLADYLRQTGASVTTLRHSHARAALAERRPDLVVLSPGPGRPADDVAGTI
CARA_STRA5      --------IVLVDFGLKHS--ILRELSQRQCHITVVPHTTTAQEILNLNPDGVLLSNGPGN--PEQLPNA
CARA_STRA3      --------IVLVDFGLKHS--ILRELSQRQCHITVVPHTTTAQEILNLNPDGVLLSNGPGN--PEQLPNA
CARA_ECOLI      --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
CARA_ECOL6      --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
CARA_ECO57      --------VVAYDFGAKRN--ILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGP----GDPAPTA
TRPG_SCHPO      ---------------------------------------ITVDELEKLNPLKLVLSPGPGH------PAR
TRPG_CRYNE      -----------------------------NIYADLNPYVVRNDKITLKEIEGIVISPGPGHPRTDSGVSR
CARA_RHIME      --------VVALDYGVKRN--ILRLFAGLNCRVTVVPAQTSAEEVLALKPDGIFLSNGPGAATGEYAVPV
CARA_OCHA4      --------VVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGDPAATGAPTI
TRPG_SULSO      ------DLTLIIDNYDSFVYNIAQIVGELGSYIVIRNDEISIKGIERIDPDRIIISPGPGTPEKREDIGV
TRPG_HAEIN      --------ILFLDNFDSFTYNLVDQFRVLGHNVTIYRNDCDLEKLTALNTPDTILALSPGPGTPSEAGIL
CARA_SALTI      --------VVAYDFGAKRN--ILRMLVDRGCRLTVVPAQTSAEEVLKMNPDGIFLSNGPS----DPAPC-
CARA_BRUSU      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUSI      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUO2      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUME      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUMB      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUC2      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUAB      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUA2      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BRUA1      ---APQYHVVALDFGVKRN--ILRLLTGLGAKVTVLPATATAEDVLAHNPDGVFLSNGPGAATGEYAPTI
CARA_BARBK      --------IVAIDYG--IKRNILRLMAAQGARITVVPAHTSVQEILAMKPDGIFLSNGPGNATAEYAVPM
TRPE_RHIME      --------ILLVDHEDSFVHTLANYFRQTGASVTTVRTPVAEEIFDRVKPDLVVLSPGPGTPKDFDCKAT
TRPG_PENCH      --LASASNVILIDNYDSFTQYLVLEGATVTVYRNDE---VTVEDLVAKKPTQLVISPGPGH------PDT
CARA_PHOLL      ----EQDLVVAYDFGAKRN--ILRMLVDRGCRLTVVPAQTSAEDVLKLNPDGIFLSNGP----GDPAPAI
CARA_ANASP      ----ESLTVVALDFGVKRN--ILRRLASYGCRVIVVPADTSPEEILKYNPDGIFLSNGPGDPSATEGITT
TRPG_HALSA      ----------------------------------------------------------------------
TRPG_CRYNV      -----------------------------NIYADLNPFVVRNDKITLKEIEGIVISPGPGHPRTDSGVSR
CARA_DEIGD      -TLRHGKRVVLMDFGIKHT--IIERLAEVGIEPIVVPAHTTPAQIMALQPHGLFLSNGP----GDPAPLA
CARA_SYMTH      --------VVAVDFGAKENILRELTARGCDV--TVVPATASAEEVLSLRPEGVVLTNGPG------APTD
CARA_SULAC      ------DVVVVVDCGGILYQLYLRGFTVVRVPC-----NYSADKIMDFYPKGLLFSNGP----GNPNLLT
CARA_DEIRA      -TLRQGKRVVLMDFGIKHT--IIERLAEVGIEPIVVPAHTTPAQIMALQPHGLFLSNGP----GDPAPLA
CARX_BACHD      --------IVLIDYGFKQSILNSLLKRDCQV--TIVPYDVSFEVVQELNPDGLLFSNGP----GDPKQIE
CARA_HYPNA      -ALANAEFVAVIDFGVKKN--ILRNLASAGARATVVNGNVSAEEVLALKPDGIVFANGPGAATFERSGEM
CARA_CORGL      ----ERHTVVAYDLG--IKQNTPRRFSARGVRTVIVPAETPFEDIKQYNPSGVFISNGPGDAAADVMVDI
PABA_KLEAE      -------------------------------------------------PAKIVISPGPCTPDESGISLA
CARA_ZYMMO      --------VVAIDYGLKHN--ILRNLVEAGARVTVVKATASFDEVMAHKPDGVFLSNGP----GDPAATA
TRPG_VIBPA      --------IVFIDNFDSFTYNLVDQFRSLGHSVKIYRNHIPAETIEQENPV-VLLSPGPG------APSE
TRPG2_HALMA     -------MILIIDNYDSFAYNLVQYVGEFDDVTVRRNDAIDVEGIHELDPDGIVVSPGPGTP-AEAGVSI
CARA_LISMO      --------VVLVDYGVKSS--ILRELNKRNCYVTVVPYNTSAEEILAMHPDGVMLSNGPGD------PKD
CARA_LISIN      --------VVLVDYGVKSS--ILRELNKRNCYVTVVPYNTTAEEILAMHPDGVMLSNGPGD------PKD
CARA_DESAD      --------LVLVDYGVKWN--ILRLLDEQGFEVLSVPSHYSEEQVRALEPDAIFLSNGPGDPAVLDQAVK
CARA_CHLTE      -------------------------IRQLNAECKVTVVNATADEVLAMNPDGIFLSNGPGDPFAYAIDTI
PYR1_EMENI      --------VLCLDVGLKFNQLRCLVARGVEVL--VVPWDYDFPTLAGKDYDGLFVSNGPGATMTTTVNNL
NADE_CHLPD      ----------------------------------------------------------------------
CARA_MYCTU      ------------------------------IRCHVLPASTTFEQIAELNPHGVFLSNGPGDATADHVVAL
CARA_MYCBO      ------------------------------IRCHVLPASTTFEQIAELNPHGVFLSNGPGDATADHVVAL
CARA_LISMF      --------VVLVDYGVKSS--ILRELNKRNCYVTVVPYNTTAEEILAMHPDGVMLSNGPGD------PKD
CARA_BRAJA      --------VVAIDYG--IKRNILRLLAGVGCKVTVVPATTSAEDILAMKPDGVFLSNGPGAATGKYAVPV
PYR1_SCHPO      --------ILVIDVGMKYNQIRCFLNRGVELL--VVPWDYDFTK---ETYDGLFISNGPGSLMDLVVDRV
PHNB_PSEAE      ----------------------------------------------------------------------
NADE_METJA      ----------------------------------------------------------------------
CARA_VIBCH      ---ADSELVVAYDFGAKRN--ILRMLVDRGCRLTVVPAQTSAEDVLALNPDGVFLSNGPGDTYAIEATRV
CARA_PORPU      --------VIVIDFGVKLN--ILRRLATLGCQITVMPASTPTQDILSCKPDGILLSNGPGDPYGIK--TV
CARA_COREF      -----------------------RRFAARGVRTVIVPAETPFEEIKQYNPSGVFISNGPGDAAADIMVNI
CARA_ARCFU      --------VVLVDCGVKMS--IVRQLLKRGVNLTVVPYDFPAEKIKEMNPDGVFISNGPGDPARVK-PTI
CARA_AGRT5      --------