[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50894.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
    4::256     4e-61  44%  257 aa  CHER_BACHD RecName: Full=Chemotaxis protein methyltransferase;     
   40::280     8e-56  45%  282 aa  CHER_THEMA RecName: Full=Chemotaxis protein methyltransferase;     
    8::261     8e-54  42%  262 aa  CHER_LISMO RecName: Full=Chemotaxis protein methyltransferase;     
    8::261     8e-53  41%  262 aa  CHER_LISIN RecName: Full=Chemotaxis protein methyltransferase;     
    1::256     7e-52  42%  256 aa  CHER_BACSU RecName: Full=Chemotaxis protein methyltransferase;     
    7::255     9e-36  37%  274 aa  CHER1_PSEAE RecName: Full=Chemotaxis protein methyltransferase 1;  
   18::282     5e-35  35%  283 aa  CHER_BORBU RecName: Full=Chemotaxis protein methyltransferase;     
    9::261     7e-33  36%  288 aa  CHER2_VIBCH RecName: Full=Chemotaxis protein methyltransferase 2;  
   27::273     6e-32  35%  286 aa  CHER_ECOLI RecName: Full=Chemotaxis protein methyltransferase;     
   13::254     1e-31  38%  275 aa  CHER_VIBPA RecName: Full=Chemotaxis protein methyltransferase;     
   27::268     2e-31  37%  288 aa  CHER_SALTY RecName: Full=Chemotaxis protein methyltransferase;     
   15::258     2e-31  34%  276 aa  CHER3_VIBCH RecName: Full=Chemotaxis protein methyltransferase 3;  
    2::258     9e-31  37%  268 aa  CHER_RHIEC RecName: Full=Probable chemotaxis protein
   13::254     1e-29  36%  275 aa  CHER1_VIBCH RecName: Full=Chemotaxis protein methyltransferase 1;  
   13::254     2e-29  36%  275 aa  CHER_VIBAN RecName: Full=Chemotaxis protein methyltransferase;     
  198::420     6e-28  31%  952 aa  YH19_RHOCA RecName: Full=Uncharacterized 104.1 kDa protein in hypE
   68::254     3e-26  37%  593 aa  FRZF_MYXXA RecName: Full=Protein methyltransferase frzF;       
   21::268     1e-20  29%  280 aa  CHER2_PSEAE RecName: Full=Chemotaxis protein methyltransferase 2;  
   11::242     2e-20  28%  262 aa  CHER_CAMJE RecName: Full=Chemotaxis protein methyltransferase;     
   11::242     3e-20  28%  262 aa  CHER_CAMJJ RecName: Full=Chemotaxis protein methyltransferase;     
   80::148     7e-04  34%  250 aa  Y028_RICPR RecName: Full=Uncharacterized protein RP028;
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSE
CHER_BACHD      --DYNWFIEQVKERTGIDLNLYKETQMKRRLIALREKRNYQDFRSYFTAMTNDDTLQNEFLERMTINVSE
CHER_THEMA      --------------FGLNLSSYKPQRVKRRTE-LLLRKYNVGYREYLNMLIKDKKYLDEFMDKMTINVTE
CHER_LISMO      --DYLYFTRVVKRDLGLDLALYKETQMKRRILSFIVKKKYITFGEFFKHLKKDAVLLDEFISLITINVSS
CHER_LISIN      --DYLYFTRVVKRDLGLDLTLYKETQMKRRILSFIVKKKYITFGEFFKHLKKDALLLDEFISLITINVSA
CHER_BACSU      MDTYSVFTTKWKQLTGVDLTLYKEAQMKRRLTSLYEKKGFQSFKDFAAALEKDQALLNETLDRMTINVSE
CHER1_PSEAE     --DFELFRVFLEKTCGIVLGSNKQYLVSSRLNKLMEQQGIKSLGELVQRIQTQRGGLREMVDAMTTNETL
CHER_BORBU      --ELSRLIKIVYNNFGINLSEKKKLLIESRLSSLLKVKGFKNFTEYINFLEKSTGNIQELIDKISTNHTY
CHER2_VIBCH     -TDFCRFRDYFYQKTGIFFENSKRYFVDKRLLQRIELTEHQSFRGYFTYLRASGEELQAVINALTVNETY
CHER_ECOLI      ---FRRISQLIYQRAGIVLADHKRDMVYNRLVRRLRSLGLTDFGHYLNLLESNQHSWQAFINSLTTNLTA
CHER_VIBPA      --DFSRFLES---QCGIVLGDSKQYLVRSRLSPLVTKFKLASLSDLLRDVVAGRNRELRIVDAMTTNETL
CHER_SALTY      ---FRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSWQAFINALTTNLTA
CHER3_VIBCH     --DFKFIQWFMHKTVGIYLPDSKRTMVYGRLSRQMRRKGLRRFTQFRELIESDEQERIHFINTLTTNKTE
CHER_RHIEC      ----------IYSDAGIFLNETKASLVYSRLSKHIRNLGLSGFREYCELVASPAGAAREMLSHLTTNFTR
CHER1_VIBCH     --DFCRFLES---QCGIVLGDSKQYLVRSRLSPLVTKFKXXXXXXXXRDVVTGRNRDLRVVDAMTTNETL
CHER_VIBAN      --DFSRFLES---QCGIVLGDSKQYLVRSRLSPLVAKFKLTSLSDLLRDVVTGRNRELRVVDAMTTNETL
YH19_RHOCA      ---------------------YKPGTVQRRIERRMGVRQVPDLTSYLELLTHDRTELASLRREMLIPVTS
FRZF_MYXXA      ------------------------------------------------------------LPLVTVGHTE
CHER2_PSEAE     --DFQQVRERLYRLTGISLAESKAQLVYXXXXXXXXXXXXGSFAEYFTHLDREPGEQQLFVNALTTNLTA
CHER_CAMJE      --ELNEFIKIINEMSGIDLTD-KKNILALKLNKFLEGTNTKNFSEFLGKLKSNRQLKQETLDFVTIGETY
CHER_CAMJJ      --ELNEFIKIINEMSGIDLTD-KKNILALKLNKFLEGTNTKNFSEFLGKLKSNRQLKQETLDFVTIGETY
Y028_RICPR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAA
CHER_BACHD      FFRNRKRWDVLDETIIPQLLKEKKRLKVWSAACSTGEEPYTLAMILQKHLPLKDVSILATDIDRAILQQA
CHER_THEMA      FFRNPEKWWELRDEIIPLIAKNSLRMKFWSAGCSSGEEPYSLAILVHELNLSYKTRILATDIDIGVLRRA
CHER_LISMO      FFRNRNRWDALEKQVLPRLLEDRGKLRVWSAACSSGEEPYSLAMMMERSVGTRHYDILATDLEPAILKRA
CHER_LISIN      FFRNRNRWDVLEKQVIPRLLEDRGKLRVWSAACSSGEEPYSLAIMMERSVGTRHYDILATDLEPAILKRA
CHER_BACSU      FYRNYKRWEVLETAILP-LIKTSRPLKIWSAACSTGEEPYTLAMLLDQQKGLPGYQILATDIDEKALEKA
CHER1_PSEAE     WFRDTYPFEVLKQRVLPELIKANGGLRIWSAACSSGQEPYSLSMAIDEFEKTNLGQLKATDLSGSMLTAA
CHER_BORBU      FFRESKHFDFLNNKILPKLTEKNSEIRIWSAGCSSGEEPYTIAMMLKEYMEHNRVKILATDISISVLNEA
CHER2_VIBCH     FFREISQLESLVEEVLDDIVRHRPGIRIWSMPCSSGEEPYSIVLFLLEHWP-KLEQVDASDIDTGILQKA
CHER_ECOLI      FFREAHHFPLLADHAR----RRSGEYRVWSAAASTGEEPYSIAMTLADTLGTARWKVFASDIDTEVLEKA
CHER_VIBPA      WFRDTYPFTVLADKLLPEVAANKRPIKIWSAASSSGQEPYSIAMTILETQQRKSVSITATDISASMLEMC
CHER_SALTY      FFREAHHFP-----ILAEHARRRGEYRVWSAAASTGEEPYSIAITLADMAPG-RWKVFASDIDTEVLEKA
CHER3_VIBCH     FFRESHHFEFIEKVLVPEWSKERGQLRFWSAGCSTGEEPYTLVSVLDHAGVMNDIKIWATDLDTAVLEKA
CHER_RHIEC      FFRENHHFEHLRDHVLPELLQRAGRVRIWSAASSDGQEPYSIALVLSLMPNVADYKILATDIDPKILAIA
CHER1_VIBCH     WFRDSYPFTVLADKLLPEMAANKRPIKIWSAASSSGQEPYSMAMTILEVQQKRSVSITATDISASMLDMC
CHER_VIBAN      WFRDAYPFTVLAERLLPEVAANKRPIKIWSAASSSGQEPYSMAMTVLETQQRKPGMITATDISASMLDMC
YH19_RHOCA      FFRDPDSFAELAEKVIDPLVAQAATLRVWTAGCATGEEAYTLAMLFERAGRWPTLKIFATDVEPMNXXXX
FRZF_MYXXA      FFRDAKQFRALEKSVLPDLVREMRKVSIWSAGCATGEEPYSLAMVLAELALSLEVDLWATDLNLAAVEAA
CHER2_PSEAE     FFRERHHFPXXXXXXXXXXXXXXP-LRIWSAAASTGEEPYSIAITLVEALGSPPVKIVASDIDTGVLDCA
CHER_CAMJE      FLRELA--QLKEIIYYAKSLEKRVN--ILSAPCSSGEEVYSLALLAAQNFI-KDMYILGVDINSSVIEKA
CHER_CAMJJ      FLRELA--QLKEIIYYAKSLEKRVN--ILSAPCSSGEEVYSLALLAAQNFI-KDMYILGIDINSSVIEKA
Y028_RICPR      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTRE
CHER_BACHD      KVGYYTERSLKEIPVELKEGFFTKDRAGYYVSNELKQAVTFKQHNLLADRFERDCDLIVCRNVLIYFTEE
CHER_THEMA      QEGIYEERAFVSTPKEYLEKYFELPDGRYRIKDSVKKIVEFKRHDLLKDPFEKNFDLIVCRNVVIYFEPE
CHER_LISMO      VIGEYQSRQMEELSEQERHTAFVEKGDTYQILPKYRKSIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAE
CHER_LISIN      VIGEYQSRQMEELNEQERRSAFIEKGDTYQILPEYRKAIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAE
CHER_BACSU      KKGVYQERSLQEVPLSVKDRYFTQNANRYEVKTEIKKNITFKKHNLLADRYEQDFDLIVCRNVFIYFTES
CHER1_PSEAE     KAGEYDTAMGRGLSPERLQRYFDAKPGRWAVKPAIRSRVEFRALNLL-DSYASKFDMVFCRNVLIYFSAE
CHER_BORBU      REGIYPEDRIINLPKYLKIKYLNLQDDKFQVKEILKKMVYFKKLNLMDEKFPKKFDLIFCRNVMIYFDEK
CHER2_VIBCH     AQGIFSARSVKNLPNSSLNKYFSLRDGSYQLIDDIRQSVRFTQTNLRAEVQKLGMDVIFCRNLLIYFDDI
CHER_ECOLI      RSGIYRHEELKNLTPQQLQRYFMPHEGLVRVRQELANYVDFAPLNLLAKQYPGPFDAIFCRNVMIYFDQT
CHER_VIBPA      RAGVYNLALGRGLSPERRRTFFDAGDGRMKVKDNVKRLVNFRPQNLM-DSYAGKFDIIFCRNVLIYFSPE
CHER_SALTY      RSGIYRLSELKTLSPQQLQRYFMPHEGLVRVRQELANYVEFSSVNLLEKQYPGPFDAIFCRNVMIYFDKT
CHER3_VIBCH     SLGIYPIESQSSIPERYLRRCFVRQQGNMKIKQSLQRYIDFHQLNLIQEPFKQKLDLILCRNVMIYFDRP
CHER_RHIEC      RAGAYDESALETVSPAMRKQWFSVEQGRFQVDDRVKRLITYNELNLMAQWPFKGFDVIFCRNVVIYFDEP
CHER1_VIBCH     RAGIYNLALGRGLSPERRRVFFDAGDGRMKVKDNVKRLVNFRPQNLMESYSLLGFDIIFCRNVLIYFSPD
CHER_VIBAN      KAGIYNLALGRGLSPERRKIFFDAGDGRMKIKDNVKRLVNFRPQNLMESYALLGFDIIFCRNVLIYFSPD
YH19_RHOCA      XXXXXXXXXXXDLPTTFLERFFTTRGGQYTIRPEIRQTIVFARHNLLSDPPFTRMDLVTCRNTLIYFRPE
FRZF_MYXXA      KQGRFTSRRAISINQARLTRFFKPVEEGYEALPALREYIRFDGQNLAVPVFDKSLDLILCRNVIIYFDLP
CHER2_PSEAE     RQGVYPLERLEQMPAPLKKRFFLPNAGKARVVEELRQLVEFRQINLLADWSIAGLDAIFCRNVMIYFDKP
CHER_CAMJE      KLGKYQGRTLQRLSESEKRRFFLESEDKFYTINKNECTCKFELCNVFEEKFSRKFDIIASRNMIIYFDHE
CHER_CAMJJ      KLGKYQGRTLQRLSESEKRRFFLESEDKFYTINKNECTCKFELCNVFEEKFSRKFDIIASRNMIIYFDHE
Y028_RICPR      -----------------------IEIGKKTISDAKIKNVRLKALSILDESYGK-FDYIVCHGVYSWVSKE


                         .         .         .         +         .         .         .:280
query           AQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVSPCFYRKK
CHER_BACHD      AKRELYHKFSEALRPGGVLFVGSTEQIFEASKYGLETNETFFYRK-
CHER_THEMA      AKNELYRKFAESLKPGGFLFVGNTERIFNYKELGFEIYKPFIYRK-
CHER_LISMO      GKHQAYQKFAESLRRGGVLFIGGSEQILNPADYGLATLNNFFYIK-
CHER_LISIN      GKHQAYQKFADSLRRGGVLFIGGSEQILNPADYGLATLNNFFYIK-
CHER_BACSU      AKEELYLKMAHSLKKNGVLFVGSTEQIFNPEKFGLVPADTFFYQKR
CHER1_PSEAE     VKRDILLRIHGTLKPGGYLFLGASEALNN-----------------
CHER_BORBU      TRNNLANKFNSYLKKDSYLLIGHSETIRGNKNL--EYIMPATYKK-
CHER2_VIBCH     SRRNAVESFYEQLNPGGVLFLGHSESMSRISSI-------------
CHER_ECOLI      TQQEILRRFVPLLKPDGLLFAGHSEN-FSHLERRF-----------
CHER_VIBPA      MKSKVLNQMASSLNPGGYLLLGASESL-------------------
CHER_SALTY      TQEDILRRFVPLLKPDGLLFAGHSENFSN-----------------
CHER3_VIBCH     TQEQLIERFHQQLKPGGVLMLGHSESV-------------------
CHER_RHIEC      TQMKIWQRFAGLLPEGGHLYIGHSERVSGEAKHVFDNIGITTYR--
CHER1_VIBCH     MKSKVLNQMAASLNPGGYLLLGASESL-------------------
CHER_VIBAN      MKSKVLNQMASSLNPGGYLLLGASESL-------------------
YH19_RHOCA      AQERALRRMHYAVRTGGYLFLGGSEAL-------------------
FRZF_MYXXA      TIRGLMDRFLAALRPGGLLFLGYSESLF------------------
CHER2_PSEAE     TQTRLLERMVALLRPEGLFFAGHSENFVHASHL-------------
CHER_CAMJE      SKLKLMERFHRILNDKGRLYVGNADLI-------------------
CHER_CAMJJ      SKLKLMERFHRILNDKGRLYVGNADLI-------------------
Y028_RICPR      VQDKILEVLNKLLNPNGIAFI-------------------------