[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50917.1

[Show Plain Result]


## Summary of Sequence Search
    1::337
    7::338     2e-92  49%  338 aa  FLIG_BACSU RecName: Full=Flagellar motor switch protein fliG;
    4::335     2e-90  48%  335 aa  FLIG_THEMA RecName: Full=Flagellar motor switch protein fliG;
   15::344     7e-84  50%  344 aa  FLIG_BORBU RecName: Full=Flagellar motor switch protein fliG;
    9::338     6e-56  34%  338 aa  FLIG_PSEAE RecName: Full=Flagellar motor switch protein fliG;
   20::346     2e-47  32%  348 aa  FLIG_VIBCH RecName: Full=Flagellar motor switch protein fliG;
    4::326     4e-44  31%  331 aa  FLIG_ECOLI RecName: Full=Flagellar motor switch protein fliG;
    4::326     4e-44  31%  331 aa  FLIG_ECOL6 RecName: Full=Flagellar motor switch protein fliG;
    4::326     4e-44  31%  331 aa  FLIG_ECO57 RecName: Full=Flagellar motor switch protein fliG;
    4::326     8e-43  31%  331 aa  FLIG_SALTY RecName: Full=Flagellar motor switch protein fliG;
    4::326     8e-43  31%  331 aa  FLIG_SALTI RecName: Full=Flagellar motor switch protein fliG;
    1::328     2e-40  30%  329 aa  FLIG_BRAJA RecName: Full=Flagellar motor switch protein fliG;
    8::326     5e-40  32%  328 aa  FLIG_AQUAE RecName: Full=Flagellar motor switch protein fliG;
    7::339     9e-37  29%  340 aa  FLIG_CAUCR RecName: Full=Flagellar motor switch protein fliG;
    3::328     1e-28  25%  331 aa  FLIG_BUCAP RecName: Full=Flagellar motor switch protein fliG;
   22::344     3e-21  28%  345 aa  FLIG_RHIME RecName: Full=Flagellar motor switch protein fliG;
   16::333     3e-21  22%  347 aa  FLIG_AGRT5 RecName: Full=Flagellar motor switch protein fliG;
    3::321     1e-20  23%  331 aa  FLIG_BUCAI RecName: Full=Flagellar motor switch protein fliG;
    3::316     2e-19  23%  320 aa  FLIG_BUCBP RecName: Full=Flagellar motor switch protein FliG;
    4::239     1e-18  26%  242 aa  FLIG_SHIBO RecName: Full=Flagellar motor switch protein fliG;Flags:
  128::238     7e-04  23%  475 aa  TRI62_HUMAN RecName: Full=Tripartite motif-containing protein 62;
    1::337

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNQYEKLTGEQKAAILLISLGADVSSKLLKQEFTEDEVEKVTAAIAEMDKVPNDIQKQVVEEFIYLIQAR
FLIG_BACSU      ----DKLTGKQKAAILMISLGLDVSASVYKH-LTDEEIERLTLEISGVRSVDHQKKDEIIEEFHNIAIAQ
FLIG_THEMA      ----KKIDGRRKAAVLLVALGPEKAAQVMKH-LDEETVEQLVVEIANIGRVTPEEKKQVLEEFLSLAKAK
FLIG_BORBU      ------LTGKQKAAILLVSIGSEISSKVFKY-LSQEEIESLTFEIAKLETITSELKDNVLLEFKELMMAQ
FLIG_PSEAE      -----KLTKVDKAAILLLSLGETDAAQVLRH-MGPKEVQRVGVAMASMRNVHREQVEQVMGEFVEVVGDQ
FLIG_VIBCH      -----EIPGEEKAAILLLSLNEEDAAGIIRH-LEPKQVQRVGSAMARAKDLSQTKVSAVHRAFLEDIQKY
FLIG_ECOLI      ------LTGTDKSVILLMTIGEDRAAEVFKH-LSQREVQTLSAAMANVTQISNKQLTDVLXXXXXXXXXX
FLIG_ECOL6      ------LTGTDKSVILLMTIGEDRAAEVFKH-LSQREVQTLSAAMANVTQISNKQLTDVLXXXXXXXXXX
FLIG_ECO57      ------LTGTDKSVILLMTIGEDRAAEVFKH-LSQREVQTLSAAMANVTQISNKQLTDVLXXXXXXXXXX
FLIG_SALTY      ------LSGTDKSVILLMTIGEDRAAEVFKHLSTR-EVQALSTAMANVRQISNKQLTDVLSXXXXXXXXX
FLIG_SALTI      ------LSGTDKSVILLMTIGEDRAAEVFKHLSTR-EVQALSTAMANVRQISNKQLTDVLSXXXXXXXXX
FLIG_BRAJA      ------MAGPKRAAILMLALGEQYGGKIWSM-LDDDEVRQLSLEMSTLGTVEVDTVEDMLLEFVSRMSAS
FLIG_AQUAE      ------LSKAQKAAVLLLSLPEEVSMNIVK-ELSEEELQKLFALAKDXXXXXXXXXXXXXXXXIKIKKPE
FLIG_CAUCR      VNDVKNLSGPEKAAIVLLALGEDHTR--IWEALDDEEIKEVSQAMAGLGTVSASVVEDLLVEFVSGMSST
FLIG_BUCAP      ------LNGTEKSAILLMSIGADQASEVLKH-LTPFEVQELVASMVNINQFSNTILNTVLSECYDLFSKK
FLIG_RHIME      ----------EKAAAVLLAMGKSIAGKLLKF-FTQSELQAIIAAAQSLRAVPPHELEALVNEFEDLFTEG
FLIG_AGRT5      ------LSQADKAAAVLLAMGKGVAGKLLKF-FTQHELQMIISSAQTLRVIPPDELAQIVAEFEDLFTEG
FLIG_BUCAI      ------VNGTEKSALLLMAIGSDQAGEILKH-LTPFEVQELITAMVNIKRVSAQKLNEILLQCYNLIKNN
FLIG_BUCBP      ------LNGEQKSAVLLALVGIDKAIEILK-ELSIQEIENIAKCMSYMDVISSITADLVLSEFCNEVRIN
FLIG_SHIBO      ------LTGTDKSVILLMTIGEDRAAEVFKH-LSQREVQTLSAAMANVTQISNKQLTDVLXXXXXXXXXX
TRI62_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DYLLNGGVNYAKELLEKTYGYDKGSEILERISSTMQSVPFGSLRKTDPRHILSFIREEHPQTIAFVLSYL
FLIG_BACSU      DYISQGGLSYARQVLEKALGEDKAENILNRLTSSLQVKPFDFARKAEPEQILNFIQQEHPQTMALILSYL
FLIG_THEMA      EMISEGGIEYAKKVLEKAFGPERARKIIERLTSSLQVKPFSFVRDTDPVQLVNFLQSEHPQTIAVVLSYL
FLIG_BORBU      EFIQKGGIDYARELLEKSLGTQKAVDIINNLGSALQSRPFEFVRRADPANILNFIQQEHPQTIALILSYL
FLIG_PSEAE      TSLGVGADGYIRKMLTQALGEDKANNLIDRIXXXXXXXXXXXXKWMEPRAVADVIRYEHPQIQAIVVAYL
FLIG_VIBCH      TNIGMGSEDFLRNALVAALGADKANNLVDQILLGTGSKGLDSLKWMDPRQVASIIINEHPQIQTIVLSYL
FLIG_ECOLI      XXLNINANDYLRSVLVKALGEERAASLLEDILETRDTASIETLNFMEPQSAADLIRDEHPQIIATILVHL
FLIG_ECOL6      XXLNINANDYLRSVLVKALGEERAASLLEDILETRDTASIETLNFMEPQSAADLIRDEHPQIIATILVHL
FLIG_ECO57      XXLNINANDYLRSVLVKALGEERAASLLEDILETRDTASIETLNFMEPQSAADLIRDEHPQIIATILVHL
FLIG_SALTY      XXLNINANEYLRSVLVKALGEERASSLLEDILETRDTTSIETLNFMEPQSAADLIRDEHPQIIATILVHL
FLIG_SALTI      XXLNINANEYLRSVLVKALGEERASSLLEDILETRDTTSIETLNFMEPQSAADLIRDEHPQIIATILVHL
FLIG_BRAJA      GALM-GNFDATERLLQQYLPPERVNGIMDEIRGPAGRNMWEKLSNVQEEVLANYLKNEYPQTIAVVLSKL
FLIG_AQUAE      EFIENIKKVIPPTLAEKFRGIGDAEKILKEIE------------KVDSRILASLLKNEHPQTIALFLSQL
FLIG_CAUCR      GAIM-GSYEQTQRLLASFMPQDKVDALMEEIRGPAGRTMWDKLGNVNEAVLANYLKNEYPQTVAVVLSKV
FLIG_BUCAP      NNLINNDENYISDVLTKTLGEKQGRILLNEVLETRNKMCIETFNHMDPEKFISLLDQEHPQILTTILMYL
FLIG_RHIME      AGLMDNA-KAMESILEEGLTPDEVDGLLGR-RATFQSYEWDRLMDCDPVIIAQLLAREHPQTIAYVLSMM
FLIG_AGRT5      TGLMDNA-KAIESILEEGLTPEEVDSLLGRRAAAYEASIWDRLQEAEPEFVGKFLLREHPQTIAYILSML
FLIG_BUCAI      AFNCNNSDKYLIKMLTKALGEKKGTSLLEALEIRNARICIKALNYMKAKQVAFLLDKEHPQIITTILICL
FLIG_BUCBP      QXXXXXXXXXXXXLLKKVLGEHHAVLLLDKFKNQKNSDNIKKLNLINPEKIVSLIKGEHPQIIATILIYL
FLIG_SHIBO      XXLNINANDYLRSVLVKALGEERAASLLEDILETRDTASIETLNFMEPQSAADLIRDEHPQIIATILVHL
TRI62_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KPDQAAVILAELDSQLQSEVARRVAILDRISPDXXXXXXXXXXXXXXSVAQHEETVVGGVQCLVNILNRV
FLIG_BACSU      DPVQAGQILSELNPEVQAEVARRIAVMDRTSPEIINEVERILEQKLSSAFTQDYTQTGGIEAVVEVLNGV
FLIG_THEMA      DPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFVSRTFSKVGGIDTAAEIMNNL
FLIG_BORBU      DPQKASFILSSLPTEVQTNVARRIALMDRTSPXXXXXXXXXXXXXXASLSSEDYTSAGGVDNVVEIINMA
FLIG_PSEAE      DPDQAAEVLSHFDHKVRLDIVLRVSSLNTVQPSALKELNLILEKQFAGNSNATRTTMGGVKRAADIMNYL
FLIG_VIBCH      EPDQSAEILAQFAQRDALDLLMRIANLEEVQPSALAELNEIMEXXXXXXXXXXXXXXXXXXXXXDIMNYL
FLIG_ECOLI      KRAQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDG-QNLKRSKMGGVRTAAEIINLM
FLIG_ECOL6      KRAQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDG-QNLKRSKMGGVRTAAEIINLM
FLIG_ECO57      KRAQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDG-QNLKRSKMGGVRTAAEIINLM
FLIG_SALTY      KRSQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDG-QNLKRSKMGGVRTAAEIINLM
FLIG_SALTI      KRSQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDG-QNLKRSKMGGVRTAAEIINLM
FLIG_BRAJA      KPEHAARVLGIFPEDLALDVVNRMLKMEAVQKEVIESVEKTLRTEFMSNLSQTRRR-DAHEVMAEIFNNF
FLIG_AQUAE      SPKKSAEIIQNLPEELKKEVVKRIATLENVNVQYVKELAQILLEEISSLGAKEALKLEGTAVAAELLNTL
FLIG_CAUCR      KSDHAARVLACLPEDFALECVTRMLRMEPVQREILDKIEMTLRTEFMSLARTSKR--DSHEMMAEIFNNF
FLIG_BUCAP      DKRQSSKVLSRLSEKKCTEIVLRMAEFNCIKESNLIDLKKIIE----NLLKRKKLIFSGIKTVAEILNSM
FLIG_RHIME      PSSFGAKVLLQLSDKQRPEILNRAVNIKNVNPKXXXXXXXXXXXXXXXXXXDRNSP--GPAKIAEVMNEL
FLIG_AGRT5      PSSFGAKVLLTIPEEQRADIMNRTVNMKEVSPTAAQIIEKRVVNLINEI--EAERNAGGSTKVADLMNEL
FLIG_BUCAI      NKNQSAEVLSFLSDKKRAEIILRIVDFHGIE-ESSLVELTQVIXXXXXXXXXILSEKGGIKTAAQILNSM
FLIG_BUCBP      NRNHAANILSYFEDNLSLDIIRRIA---NFSSLKKLGQEEFVKIIDNLINKYQNSMLNGIVTAVELLKLI
FLIG_SHIBO      KRAQAADILALFDERLRHDVMFVSHLWRRAASALAELTEVLNGLLDGQNLKRSK--MGGVRTAAEIINLM
TRI62_HUMAN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DRSTEKTIFEDLERADPNLSEEVRRLMFIFEDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYK
FLIG_BACSU      DRGTEKTILDSLEIQDPDLAEEIKKRMFVFEDIVTLDNRAIQRVIRDVENDDLLLSLKVASEEVKEIVFN
FLIG_THEMA      DRTTEKKIMDKLVQENPELADEIRRRMFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFK
FLIG_BORBU      DRKTEKFXXXXXXXXXXXXXXXXKKKMFVFEDIVLLDDRSIQRVLREIDGQELAKALKSVDIPVQEKIFK
FLIG_PSEAE      DSSIEGQLMDSIREVDEDLSGQIEDLMFVFDNLADVDDRGIQALLREVSSDVLVLALKGSDEAIREKVFK
FLIG_VIBCH      DNNIESVLMEGMREKDEDLATQIQDLMFVFENLVEVDDQGIQKLLRDVPQDVLQKALKGADDTLREKIFK
FLIG_ECOLI      KTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEQPLREKFLR
FLIG_ECOL6      KTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEQPLREKFLR
FLIG_ECO57      KTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEQPLREKFLR
FLIG_SALTY      KTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEPPLREKFLR
FLIG_SALTI      KTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEPPLREKFLR
FLIG_BRAJA      DRQTETRFITSLEEDNRESAERIKALMFTFDDLVKLDSGSAQTLMRNVDKDKLGVALKSANEDVRNFFFG
FLIG_AQUAE      DKETRELILQSIGQEDPLLEERIREKMFTFEDIRKLSDRDIIEILKVVDKNTLMIALLGAPEDIKQKFLS
FLIG_CAUCR      DRQTEARFXXXXXXXXXXXXXXXXXXMFVFEDLSKLDPGGIQTLLRGTPKEQLALALKGASDKLRDLFFS
FLIG_BUCAP      KIEDEQXXXXXXXXXXXXXTRKIIKEMFLFDNIVNIEDKYIQCLISNLEKEKLCIALQGTSEVIRNKFFK
FLIG_RHIME      EKPQVDTLLASLETISTDSVKKVRPKIFLFDDILFMPQRSRVQLFNDVSTDVITMALRGSAAELRESILA
FLIG_AGRT5      DKPQVDXXXXXXXXXXKEAANKVKPKIFLFDDLMFMPQRSRVLLLNDVSADVLTMALRGATVEIKECVLS
FLIG_BUCAI      XXXXXXXXXXXXXXXXXQLADKIIKEIFLFENLVDLDDKYIKILLENIEKEKLHIALQNTSQAIREKFFK
FLIG_BUCBP      KRDQETKILTKMFSSDKVLAKRIKTKMLEFSDIINLDDVYIRRLIKVFPLYELSEIMXXXXXXXXXXXXX
FLIG_SHIBO      KTQQEEAVITAVREFDGELAQKIIDEMFLFENLV------------------------------------
TRI62_HUMAN     -----------IDDAFDELQRELKDQLQALQDSEREHTEALQLLKRQLETKSSTKSLRTTIGEAFERLHR


                         .         *         .         .         .         .         +:350
query           NMSKRASEMLKEEIDYMGPVRLKDVEEAQQRIVNVIRRLEEAGEIVISRGGEDAILV
FLIG_BACSU      NMSQRMVETFKEEMEFMGPVRLKDVEEAQSRIVSIVRKLEEAGEIVIARGGGDDIIV
FLIG_THEMA      NMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEIVIARGGGEELIM
FLIG_BORBU      NMSKRAASMLKEDMEFLGPTRRKDVEESQQKIVSLIRKLEEQGEIVISRGGEEDVLV
FLIG_PSEAE      NMSKRAAELLRDDLEAKGPVRVSEVEGAQKEILTIARRMAESGDIVLGKGGEEMI--
FLIG_VIBCH      NMSKRAAEMMKDDLEAMPPIKVSDVEAAQKEILSIARRMADNGEIMLGGGADE----
FLIG_ECOLI      NMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSG-------
FLIG_ECOL6      NMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSG-------
FLIG_ECO57      NMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSG-------
FLIG_SALTY      NMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSG-------
FLIG_SALTI      NMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSG-------
FLIG_BRAJA      NMSSRAAKMLQDDMAAMGPVRLRDVDEAQALLVNLAKDLAAKGEIMLTKNRADDELV
FLIG_AQUAE      NMSKRAAKLFLEDMEALGPVKKSEIEKAQRQVVNIIRKMIDEGKIEI----------
FLIG_CAUCR      NMSERAAKIMREDMDSMGPVRLKDVDAAQVGMVQVAKDLAAKGEIMLAGSGADDELI
FLIG_BUCAP      NMNEEEANKLSEEKSYISDIAIKN---EQKLILIMLKNILDNGIFSLKKLGK-----
FLIG_RHIME      SIGARQRRMIESDLAADAGINPRDIAIARRSITQEAIRLSASGQLELKEKEPEA---
FLIG_AGRT5      SISPRQRRMIESDLAVQASLNTREVAIARRAVAQEAIRLANSGQI------------
FLIG_BUCAI      NMSHTESNELTLNLEKKSYISDISIKNEQKLILIMLKSIVENGRI------------
FLIG_BUCBP      NMSLENTNLIKNYCSKKIFISNDLIQKKRNNLLNSVKKI------------------
FLIG_SHIBO      ---------------------------------------------------------
TRI62_HUMAN     LLRERQKAML-EELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAE-----