[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO50988.1

[Show Plain Result]


## Summary of Sequence Search
    1::387
 2201::2265    4e-08  39% 2313 aa  SLAP1_CLOTH RecName: Full=Cell surface glycoprotein 1;AltName:
  584::638     2e-07  36%  688 aa  SLAP2_CLOTH RecName: Full=Cell surface glycoprotein 2;AltName:
  322::399     3e-07  33%  447 aa  ANCA_CLOTH RecName: Full=Cellulosome-anchoring protein;Flags:
 1672::1855    5e-07  27% 1861 aa  APU_THETU RecName: Full=Amylopullulanase;AltName:
  908::1081    4e-06  24% 1087 aa  XYNX_CLOTM RecName: Full=Exoglucanase xynX;       
   74::145     4e-06  35%  762 aa  SLAP_ACEKI RecName: Full=Cell surface protein;AltName: Full=S-layer
   32::75      1e-05  41%  917 aa  SLAP2_THET8 RecName: Full=S-layer protein;AltName: Full=Surface
   32::75      1e-05  41%  928 aa  SLAP1_THET8 RecName: Full=S-layer protein;AltName: Full=Surface
   85::141     3e-05  32%  531 aa  Y6545_BACAN RecName: Full=Uncharacterized cell wall amidase
  101::149     4e-05  43%  941 aa  GUN_BACS6 RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
 1056::1107    1e-04  33% 1157 aa  XYNA_THESA RecName: Full=Endo-1,4-beta-xylanase A;       
   23::85      2e-04  34%  862 aa  SLAP2_BACAN RecName: Full=S-layer protein EA1;Flags: Precursor;
   78::146     3e-04  37%  941 aa  GUN_BACS6 RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:(query 205->277)
    1::387

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLAP1_CLOTH     ----------------------------------------------------------------------
SLAP2_CLOTH     ----------------------------------------------------------------------
ANCA_CLOTH      ----------------------------------------------------------------------
APU_THETU       ----------------------------------------------------------------------
XYNX_CLOTM      ----------------------------------------------------------------------
SLAP_ACEKI      ----------------------------------------------------------------------
SLAP2_THET8     ----------------------------------------------------------------------
SLAP1_THET8     ----------------------------------------------------------------------
Y6545_BACAN     ----------------------------------------------------------------------
GUN_BACS6       ----------------------------------------------------------------------
XYNA_THESA      ----------------------------------------------------------------------
SLAP2_BACAN     ----------------------------------------------------------------------
GUN_BACS6       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TKTNKANNDKKFGEVQSKVKYAAKDFKDTQNHWAKGPIQRLQMLGIASGFPDGTFQPEAPVTQEQVVSMV
SLAP1_CLOTH     -------------EIMSKIDISNPKFDDCVGHWAQEFIEKLTSLGYISGYPDGTFKPQNYIKRSESVALI
SLAP2_CLOTH     -------------------KIEKSKFGDTKGHWAQQFIEQLSDLGYINGYPDGTFKPNNNIKRSESVALI
ANCA_CLOTH      TRAEFATVTYKFLEKLGKIEQGTDQLKDIEGHWAQKYIETLVAKGYIKGYPDETFRPQASIKRAESVALI
APU_THETU       -------------------QYAAKTFNDIKDNWAKDVIEVLASRHIVEGMTDTQYEPNKTVTRAEFTAMI
XYNX_CLOTM      -------------------------FNDIKDNWAKDVIEVLASRHIVEGMTDTQYEPSKTVTRAEFTAMI
SLAP_ACEKI      TFVNRMLGYEDLAEMAKSEKSAFKDVP--QNHWAVGQINLAYKLGLAQGVGNGKFDPNSELRYAQALAFV
SLAP2_THET8     -------------------------------HWAKEAVEALAAKGIILGFPDGTFRGNENLTRYQAALLI
SLAP1_THET8     -------------------------------HWAKEAVEALAAKGIILGFPDGTFRGNENLTRYQAALLI
Y6545_BACAN     -------------------KQAKPSFQDAKNHWASPYIAAVEKAGVIYGDGSGNFNPSKDIDRASMASML
GUN_BACS6       -------------------------FKDRKN-WAYKEIQAAYEAGIVTGKTNGEFAPNENITREQMAAMA
XYNA_THESA      -------------------------FDDIKNSWAKDAIEVLASRHIVEGMTDTQYEPNKTVTRAEFTAMI
SLAP2_BACAN     --------------IVSPVAAAGKSFPDVPGHWAEGSINYLVDKGAITGKPDGTYGPTESIDRASAAVIF
GUN_BACS6       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VRTLELQGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPNWARGAVAEAKAKGIINLNRFHSGVQASRVQSM
SLAP1_CLOTH     NRALE-----------------------------------------------------------------
SLAP2_CLOTH     NRAM------------------------------------------------------------------
ANCA_CLOTH      NRSLE-----------------------------------------------------------------
APU_THETU       LRLLNIKDETYSGEFSDVKSG----------------DWYANAIEAAYKAGIIEGDRPNDSITREEMTAI
XYNX_CLOTM      LKLLNIKEEAYNGEFSDVKNG----------------DWYANAIEAAYKAGIIEGDRPNDSITREEMTSI
SLAP_ACEKI      LRAL------------------------------------------------------------------
SLAP2_THET8     YRLLQ-----------------------------------------------------------------
SLAP1_THET8     YRLLQ-----------------------------------------------------------------
Y6545_BACAN     VEAYKL----------------------------------------------------------------
GUN_BACS6       VRAYE-----------------------------------------------------------------
XYNA_THESA      LRLLNIK---------------------------------------------------------------
SLAP2_BACAN     TKILNL----------------------------------------------------------------
GUN_BACS6       ----------------------------------------------------------------TRAQFT


                         .         .         .         +         .         .         .:280
query           VWLAKAMDLEPVETTGLPFKDGILVSPEDMGYVMALYKEGLVAGGPGGMLNPNSAVTRAQIAALIDRMLx
SLAP1_CLOTH     ----------------------------------------------------------------------
SLAP2_CLOTH     ----------------------------------------------------------------------
ANCA_CLOTH      ----------------------------------------------------------------------
APU_THETU       AMRAYEMLTQYKEENATTFSDDKSISDWARNVVANAAKLGIVNGEPNNVFAPKGNATRAEAAAIIYGLL-
XYNX_CLOTM      AMRAYEMSYKEENIGATSFNDDKSISDWAKNVVANAAKLGIINGEPSNVFAPKGIATRAEAAAIIYGLL-
SLAP_ACEKI      ----------------------------------------------------------------------
SLAP2_THET8     ----------------------------------------------------------------------
SLAP1_THET8     ----------------------------------------------------------------------
Y6545_BACAN     ----------------------------------------------------------------------
GUN_BACS6       ----------------------------------------------------------------------
XYNA_THESA      ----------------------------------------------------------------------
SLAP2_BACAN     ----------------------------------------------------------------------
GUN_BACS6       VMLTRGLGLE-ASSKDYPFKDR-----KNWAYIQAAYEAGIVTGKTNGEFAPNENITREQMAAMAVR---


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLAP1_CLOTH     ----------------------------------------------------------------------
SLAP2_CLOTH     ----------------------------------------------------------------------
ANCA_CLOTH      ----------------------------------------------------------------------
APU_THETU       ----------------------------------------------------------------------
XYNX_CLOTM      ----------------------------------------------------------------------
SLAP_ACEKI      ----------------------------------------------------------------------
SLAP2_THET8     ----------------------------------------------------------------------
SLAP1_THET8     ----------------------------------------------------------------------
Y6545_BACAN     ----------------------------------------------------------------------
GUN_BACS6       ----------------------------------------------------------------------
XYNA_THESA      ----------------------------------------------------------------------
SLAP2_BACAN     ----------------------------------------------------------------------
GUN_BACS6       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLAP1_CLOTH     -------------------------------------
SLAP2_CLOTH     -------------------------------------
ANCA_CLOTH      -------------------------------------
APU_THETU       -------------------------------------
XYNX_CLOTM      -------------------------------------
SLAP_ACEKI      -------------------------------------
SLAP2_THET8     -------------------------------------
SLAP1_THET8     -------------------------------------
Y6545_BACAN     -------------------------------------
GUN_BACS6       -------------------------------------
XYNA_THESA      -------------------------------------
SLAP2_BACAN     -------------------------------------
GUN_BACS6       -------------------------------------