[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO51003.1

[Show Plain Result]


## Summary of Sequence Search
    1::247
    3::244     9e-33  36%  245 aa  RSME_HAEIN RecName: Full=Ribosomal RNA small subunit
    1::248     8e-29  32%  256 aa  RSME_BACSU RecName: Full=Ribosomal RNA small subunit
    3::243     1e-26  33%  243 aa  RSME_SHIFL RecName: Full=Ribosomal RNA small subunit
    3::243     1e-26  33%  243 aa  RSME_ECOLI RecName: Full=Ribosomal RNA small subunit
    3::243     1e-26  33%  243 aa  RSME_ECOL6 RecName: Full=Ribosomal RNA small subunit
   67::297     7e-22  29%  303 aa  RSME_SYNY3 RecName: Full=Ribosomal RNA small subunit
   42::245     2e-16  30%  246 aa  RSME_BUCAP RecName: Full=Ribosomal RNA small subunit
   12::251     2e-16  24%  253 aa  RSME_BUCAI RecName: Full=Ribosomal RNA small subunit
    7::227     5e-16  26%  229 aa  RSME_AQUAE RecName: Full=Ribosomal RNA small subunit
    1::222     8e-16  30%  227 aa  RSME_MYCH2 RecName: Full=Ribosomal RNA small subunit
   15::233     4e-10  26%  244 aa  RSME_RICCN RecName: Full=Ribosomal RNA small subunit
   25::170     7e-10  27%  198 aa  RSME_RICPR RecName: Full=Ribosomal RNA small subunit
   26::148     4e-08  23%  243 aa  RSME2_BORBU RecName: Full=Ribosomal RNA small subunit
   28::93      3e-07  36%   93 aa  RSME_DICD3 RecName: Full=Ribosomal RNA small subunit
    3::159     4e-07  25%  226 aa  RSME_HELPJ RecName: Full=Ribosomal RNA small subunit
   16::159     1e-06  24%  226 aa  RSME_HELPY RecName: Full=Ribosomal RNA small subunit
    6::122     1e-04  24%  262 aa  RSME_MYCTU RecName: Full=Ribosomal RNA small subunit
    6::122     1e-04  24%  262 aa  RSME_MYCBO RecName: Full=Ribosomal RNA small subunit
    1::247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEVHCRILEQQEA
RSME_HAEIN      IPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELA
RSME_BACSU      MQRYFIEKQQIEAPTFSITGEEVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTNE
RSME_SHIFL      IPRIY-HPEPLTSHSHIALCEDANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKSVEVKVLEGQID
RSME_ECOLI      IPRIY-HPEPLTSHSHIALCEDANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKSVEVKVLEGQID
RSME_ECOL6      IPRIY-HPEPLTSHSHIALCEDANHIGRVLRMGPGQALQLFDGSNQVFDAEITSASKKSVEVKVLEGQID
RSME_SYNY3      --RLVVAPEQIIEATVTLTTAQLHYLQRVLRLQKXXXXXXXXXXXXXWRAQLNDLAHGTA--QLLETVSE
RSME_BUCAP      -------------------------------------LEIFNNTNYIFFSEILEINNHTIEIIILKKQIK
RSME_BUCAI      IPRIYIEDDLDLNQFYFLSDENRHYVTKVLRMKIEDILEIFNNTHYIFFAXXXXXXXXXXXXXXXXXXXX
RSME_AQUAE      --------EERRGNLLILREGEVKHF-RVRRIEKDEEFGVIH-EGKIYVCKVRREDKREISCEIVEELE-
RSME_MYCH2      MYRFFVNEKQENF--FILTNLTLNHIKTV-RIKNENFICVY--QNEFYLVRLVNSNKAE----IIEKIKG
RSME_RICCN      -----------NSKIELASDHHVHYVKTVLRLKVNDGLRLFNGTDGEFLAQINDIGKNNLSVRLKEQ---
RSME_RICPR      ----------------------VHYVKTVLRLKIHDSLRIFNGSDGEFLAQITQIGKNNLSV-VLKEQLK
RSME2_BORBU     ------------------------HLVNVRRLKKGDKLNILLKDKELRASEIVKIGSNFIKFTT-NKIDK
RSME_DICD3      ------------------------HVGRVLRMSAGQALQLFDGSNQVFDAEIVQAGKKNVRVRYAAGQTE
RSME_HELPJ      ----FVYHPLAKEPTLKIEGESYIHLYRSRRIKSASRLDLRNLKGFLYTYEHAEIAKKHALLRLVGVQPL
RSME_HELPY      -----------------IEGESYTHLYRSRRVKSASRLDLRNLKGFLYTYEHAEITKKHALLKLVGARLL
RSME_MYCTU      ---FYVDTLPDTGAVAVVDGDEGFHAATVRRIRPGEQLVLGDGVGRLARC-VVEQXXXXXXXXXXXXXXX
RSME_MYCBO      ---FYVDTLPDTGAVAVVDGDEGFHAATVRRIRPGEQLVLGDGVGRLARC-VVEQXXXXXXXXXXXXXXX


                         .         .         *         .         .         .         .:140
query           TSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAKKAAERVQRWQRVAVEAAKQC
RSME_HAEIN      DKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQC
RSME_BACSU      NRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVXXXXXXXXXXRERWTKIAKEAAEQS
RSME_SHIFL      DRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDSERLNKKLQQWQKIAIAACEQC
RSME_ECOLI      DRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDSERLNKKLQQWQKIAIAACEQC
RSME_ECOL6      DRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDSERLNKKLQQWQKIAIAACEQC
RSME_SYNY3      QNELPLPVTLAIALPKGSGFEEIIRPCTELGATAFQPLLTERTLL----KPSQNKLERWQRIVTEAAEQS
RSME_BUCAP      NLESPLLIHLGQVISKNEKMNFSIQKSVELGVNTITPLFSEYCNFQNKLICFPKKKIHWENIVISSCEQC
RSME_BUCAI      NLESPLHIHLGQVISKNEKMDFTIQKSIEIGVKTITPLFFENDHFQKKRINFSNKIKRWEKIAISACRQC
RSME_AQUAE      TKLPPKDITLYQSVTVDLKMDTIVRQATELGVLTFVPIISERSFQKEEA--ILKKTEKWKRIVIEAMKQS
RSME_MYCH2      NNEPKNKVVLALAILKTKSFEFAIQKAVEIGVNEIWPFYSKNVSQKLSG-DLEKKLKRWEQICLHSAQQS
RSME_RICCN      LKKPYTKLTLAVAIIKQDKLMLAINMATQLGITKIIPL------ITRWCQFRSVNIERLTKCVIEATEQS
RSME_RICPR      KAYIESALTLAVAIIKSDKLMLTINMATQLGITKIIPLITRR------CQFRTVNIERLMKCVIEATEQS
RSME2_BORBU     IEKNNFEISIFISSLKGRKIDLVLRQVVEIGVSEINIINADRSVSKIDINNASAKILRFSKIIDEALKQS
RSME_DICD3      NRESPLHLHLGQVMSRGEKM--------------------------------------------------
RSME_HELPJ      EIMANKKTHLILSVIEIKNIEKILPFLNQLGVSKLSLFYADFS--QRNEKIDSAKLERFQKILIHSCEQC
RSME_HELPY      EVMASKKTHLILSVIEIKNIEKILPFLNQLGVSKLSLFYADFS--QRNEKIDIAKLERFQKILIHSCEQC
RSME_MYCTU      XXXXXXXXXXXQALPKSERSELAIELATEAGADAFLAWQAARCVANWDGAR-------------------
RSME_MYCBO      XXXXXXXXXXXQALPKSERSELAIELATEAGADAFLAWQAARCVANWDGAR-------------------


                         +         .         .         .         .         *         .:210
query           RRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLREVLQTRPMAPGQVYIFIGPXXXXXXXXXXX
RSME_HAEIN      GRNIVPEIRPL--------------MKLQDWCAENDGALKYSIKTLPTIPGGVRLLIGSEGGLSAQEIAQ
RSME_BACSU      YRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYEESEISAFSAIVSSLPKGSSLLIVF-GPEGGLTEAEVER
RSME_SHIFL      GRNRVPEI--------------RPAMDLEAWCAEQDEGLKNSINTLPLPVERVRLLIGPEGGLSADEIAM
RSME_ECOLI      GRNRVPEI--------------RPAMDLEAWCAEQDEGLKNSINTLPLPVERVRLLIGPEGGLSADEIAM
RSME_ECOL6      GRNRVPEI--------------RPAMDLEAWCAEQDEGLKNSINTLPLPVERVRLLIGPEGGLSADEIAM
RSME_SYNY3      ERQWLPPVAAPLTFGQFVEKVAPETLALLCVTRLNSPMLGAYLKQSNL-PAQIVLATGPEGGWTDNEISL
RSME_BUCAP      HRNNIPEI--------------KNPEYILPWENETSPSATFTINELPEKINCVRLLIGSEGGFSFLEIEK
RSME_BUCAI      NRNIIPKIKIVFHWCE-NNQNNDKKIIFHPKSTLTMKCLTEPIK-------YIQIIIGSERGFFNDEFQK
RSME_AQUAE      RRPIPMEIKKPVRLSDLIPESEENIILDNFYEGVKPKDVNLEAKT-------YSVVVGPEGGFSKRESQI
RSME_MYCH2      FRNLIPKINLPINYKDLLEQAKNFPVKLISF--ERAKNNINI----PDNPQNTIIIIGPEGGFDDVEIQQ
RSME_RICCN      ERLTPPIIEKAITIQDYLKK--NNNLMLYANEHEK-EEXXXXXXXXXXXXXXXXXXVGPGGFTNDELELL
RSME_RICPR      ERLNPPIIEQAITLKDYLKK--NNNLILYANEHEKVK---------------------------------
RSME2_BORBU     GNKIVPKI--------------------------------------------------------------
RSME_DICD3      ----------------------------------------------------------------------
RSME_HELPJ      GRSVLMELEAFSNTKEALKAYP------------------------------------------------
RSME_HELPY      GRSALMELEVFSNTKEALKAYP------------------------------------------------
RSME_MYCTU      ----------------------------------------------------------------------
RSME_MYCBO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXYPVTLGSRILRTETAGPAALTMVLYQFGELG
RSME_HAEIN      TEQQGFTEILLGKRVLRTETASLAAISALQICFGDLG
RSME_BACSU      LTEQDGVTCGLGPRILRTETAPLYALSAISYQ-----
RSME_SHIFL      TARYQFTDILLGPRVXXXXXXXXXXXXXXQVRFGDLG
RSME_ECOLI      TARYQFTDILLGPRVXXXXXXXXXXXXXXQVRFGDLG
RSME_ECOL6      TARYQFTDILLGPRVXXXXXXXXXXXXXXQVRFGDLG
RSME_SYNY3      AIAKGFQPVSLGKRILRAVTAPTVALAQI--------
RSME_BUCAP      IIQYGFIPIKLGPRILRTETAVIAAITALQIKFGDL-
RSME_BUCAI      IIKYGFIPIRLGPRILRTETASVVAITALQTMFGD--
RSME_AQUAE      LREKGFKSVLLEPYTLRTETAVVSIVSILM-------
RSME_MYCH2      AEKLGFQSITLGKRILRSETAAIFLLT----------
RSME_RICCN      ASYKNTKSISLGSNILRAETAAITAIAQV--------
RSME_RICPR      -------------------------------------
RSME2_BORBU     -------------------------------------
RSME_DICD3      -------------------------------------
RSME_HELPJ      -------------------------------------
RSME_HELPY      -------------------------------------
RSME_MYCTU      -------------------------------------
RSME_MYCBO      -------------------------------------