[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO51163.1

[Show Plain Result]


## Summary of Sequence Search
    1::204
    1::205     1e-39  41%  205 aa  YKAA_BACSU RecName: Full=UPF0111 protein ykaA;
   54::213     2e-10  24%  214 aa  PITX_RHIME RecName: Full=Putative pit accessory protein;
   23::148     4e-05  24%  181 aa  ATPD_CLOD6 RecName: Full=ATP synthase subunit delta;AltName:
   43::205     9e-05  28%  485 aa  CTU2_VANPO RecName: Full=Cytoplasmic tRNA 2-thiolation protein 2;
   21::112     4e-04  21%  226 aa  Y637_PYRHO RecName: Full=UPF0111 protein PH0637;
  318::372     6e-04  31%  739 aa  GCP4_MEDTR RecName: Full=Gamma-tubulin complex component 4 homolog;
  696::830     8e-04  26%  968 aa  SNX13_HUMAN RecName: Full=Sorting nexin-13;AltName: Full=RGS
  185::331     0.001  26% 1102 aa  RPOP_AGABT RecName: Full=Probable DNA-directed RNA polymerase;     
    1::204

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFFKKTDIFFETFKAIAENITRAAEDFSAEIHNPSSDKRGLTNLQNYEKTGDRYTHTIIKELNKTFVTPL
YKAA_BACSU      MIRRKKDKFSLLLTEIAKNIDETAEYFNFKVTNQTTLKEFADTLKEYETKGDNHVHVMIKELNKAFITPI
PITX_RHIME      -----------------------------------------------ENEADEITREVLLAVRRSFITPF
ATPD_CLOD6      -----TDVLFKELEKVVDMMTKVSKDFYKVLKSPKSEKKNLVEIIFSKEVSSNIKNFLKVLVDKDRISYL
CTU2_VANPO      --------------------------------------------QRKQMMSDQYYQDIFKVMYKDKLRSE
Y637_PYRHO      ----------------------------------------------------------------------
GCP4_MEDTR      ----------------------------------------------------------------------
SNX13_HUMAN     -FARKMDTFVNPLRNSMRNVSNAVKSL------PDSLAEGMTKMSNMGKMSERLGQDIKQSFFK--VPPL
RPOP_AGABT      -----------------ESVVAKVEEINYEVHNKFIKGNGNTNFSNRNLTEIK---SILKELNKMEILD-


                         .         .         *         .         .         .         .:140
query           EREDIMNLAVKLDDILDGIEATMIRMDIYDIKDMNIFIKRNTEIILEQCQEVEKSIGKLVTKRFLEIRTH
YKAA_BACSU      EREDILQLTNSLDDVLDGIEHFSAMMEIFSITSSDEHIDKFSGYIRECAKEILITIELLAENRLKDIQPH
PITX_RHIME      DRGDIKDLIQSMDDAIDMMHKTVKTIRLYEQKSFDPGMQAMGXXXXXXXXXXXXXIPLLIGANAHRLSAI
ATPD_CLOD6      EDIELKELLNKKNNVIDGVAISAIPMSETDIKELEVKLKYNKNVTIENV--VDKTI--------------
CTU2_VANPO      QDAHLQNLNSKILVPLSFGSSSLVMLDILNLLEQSITHRGKTDVIIEQIQQIKENVSKLINAKYKEIKFH
Y637_PYRHO      ---------------------------------------RHAEVVVQTVETLEKALDSWARGDYENMKEY
GCP4_MEDTR      QREPIINTGMRVEDLLPQSEADKIENMLLDLKESSEFHKRSFECAVDSIQAIAAS---------------
SNX13_HUMAN     SDPEHRRVSAQLDDNVDDLRVMLLLMDVFDLKERNQWLRRNIKNLLQQL--IRATYGDTINRKIVD----
RPOP_AGABT      --NRINKLSTKESDLLKVIK---------EILDSNLII-----------EDKQLAIEKTVVEYELTFFRH


                         +         .         .         .         .         *         .:210
query           AVRINELENEADHLFNNSLRELVASCNDAIQFIKYKQIYEMLEEVTDACEDVANILESILMRNS
YKAA_BACSU      AIKIKEYEHSCDNLHRKSLKNLFGNETDPIKVIQYREIYETLEEIADSCQSVANNLETIIMKNA
PITX_RHIME      AEEVTHVEDRSDQLHEQGLKDLFQGASNPMAYIIGSEIYGELEKVVDRFEDVANEISGIVIEN-
ATPD_CLOD6      ----------------------------------------------------------------
CTU2_VANPO      LVDINQFFDNSPHLQSLVLQELIKSLNLKDQSIIEKKL--TLSEILDQCSD-------------
Y637_PYRHO      AKKVDDLEDIADKIKSELRDSITSKLLMPVQRTDILEYLHMQDKIADAAEDTAKWL--LIKRN-
GCP4_MEDTR      ----------------------------------------------------------------
SNX13_HUMAN     ----------------------------------------------------------------
RPOP_AGABT      NMDTHETRNKIIHNIYPKLNKAYTELLANYKLNRYSKIKKSIHLISNKSE--------------