[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for dred0:ABO51527.1

[Show Plain Result]


## Summary of Sequence Search
    1::210
  705::814     5e-05  22%  979 aa  P115_MYCHR RecName: Full=Protein P115;
  291::424     2e-04  24%  564 aa  EZRA_STAES RecName: Full=Septation ring formation regulator ezrA;
  291::424     2e-04  24%  564 aa  EZRA_STAEQ RecName: Full=Septation ring formation regulator ezrA;
  319::409     6e-04  34%  430 aa  MU132_SCHPO RecName: Full=Meiotically up-regulated gene 132
    1::210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxMDKVMDYIQALTNLYGVVHKDKVQEIYNQQNDDKIDDKSMEYIIKEKKDYLINHRQI
P115_MYCHR      ----------------------------------KLRKLNTQHSDSITEQNRAKFLVEQNQKRLSEHYKL
EZRA_STAES      -------------LDEMYDLIE-----YEVKAKNEVEETKDIITDDLFKAKDMNYTLQTRENYYINESDA
EZRA_STAEQ      -------------LDEMYDLIE-----YEVKAKNEVEETKDIITDDLFKAKDMNYTLQTRENYYINESDA
MU132_SCHPO     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TVHKDYFVYLSIMVAGSYFDEELRAKEGKPYYIPEKEELLKYKDVNYFEVNKEYEELLQFLKKMFWRKSK
P115_MYCHR      TLE----------AASEQYSLDLDIEQARHFVDSLKKELKELGNVNFEEVNQRYQEKKQYIEELTTAKSK
EZRA_STAES      QSVRQFENEIQSLI--SVYDDILKETSKSAVRYSEVQDNLQYLEDHVSVINKEQDKLQNHLIQLREDEAE
EZRA_STAEQ      QSVRQFENEIQSLI--SVYDDILKETSKSAVRYSEVQDNLQYLEDHVSVINKEQDKLQNHLIQLREDEAE
MU132_SCHPO     -----------------------------PSIIPEEIFFMRKFDSSLFKDIKNIHELLGFLGRLFMDLQD


                         +         .         .         .         .         *         .:210
query           AEDVAREIQMHCESFRAMENLHLLFEEKKIRFKNAKQADELMRLIRNLANNTRxxxxxxxxxxxxxxxxx
P115_MYCHR      IEEAISDL--------------------------------------------------------------
EZRA_STAES      AEDNLLRVQ-------------------------------------------------------------
EZRA_STAEQ      AEDNLLRVQ-------------------------------------------------------------
MU132_SCHPO     CEKFHHDTEYHC--YRIGKPLYQNYEEEALRKKSVKDAD----FIKPLVTNTR-----------------