[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO48569.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b3jD.bssp"
#ERROR : Can't open dsspfile "2b3jA.bssp"
#ERROR : Can't open dsspfile "2b3jC.bssp"
#ERROR : Can't open dsspfile "3dh1B.bssp"
#ERROR : Can't open dsspfile "3dh1A.bssp"
#ERROR : Can't open dsspfile "3dh1D.bssp"
#ERROR : Can't open dsspfile "2a8nA.bssp"
#ERROR : Can't open dsspfile "3b8fB.bssp"
#ERROR : Can't open dsspfile "3b8fC.bssp"
#ERROR : Can't open dsspfile "3b8fA.bssp"
#ERROR : Can't open dsspfile "3e1uA.bssp"
#ERROR : Can't open dsspfile "3dmoB.bssp"
#ERROR : Can't open dsspfile "3dmoA.bssp"
#ERROR : Can't open dsspfile "2a8nB.bssp"
#ERROR : Can't open dsspfile "2b3zD.bssp"
#ERROR : Can't open dsspfile "2ab1A.bssp"
#ERROR : Can't open dsspfile "1dysA.bssp"
#ERROR : Can't open dsspfile "2b3zA.bssp"
#ERROR : Can't open dsspfile "1af2A.bssp"
#ERROR : Can't open dsspfile "2d30A.bssp"
#ERROR : Can't open dsspfile "2ab1B.bssp"
#ERROR : Can't open dsspfile "2ahuA.bssp"

## Summary of PDB Search
:151
    1e-43  51%  2b3jD  [x.x.x] TRNA ADENOSINE DEAMINASE
    2e-42  51%  2b3jA  [x.x.x] TRNA ADENOSINE DEAMINASE
    2e-41  51%  2b3jC  [x.x.x] TRNA ADENOSINE DEAMINASE
    2e-36  31%  3dh1B  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    2e-33  31%  3dh1A  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    4e-33  31%  3dh1D  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    3e-32  45%  2a8nA  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    7e-27   9%  3b8fB  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    1e-26   9%  3b8fC  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    2e-26   9%  3b8fA  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    2e-25  11%  3e1uA  [x.x.x] DNA DC->DU-EDITING ENZYME APOBEC-3G
    9e-25  21%  3dmoB  [x.x.x] CYTIDINE DEAMINASE
    1e-24  21%  3dmoA  [x.x.x] CYTIDINE DEAMINASE
    2e-23  44%  2a8nB  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    3e-23  30%  2b3zD  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    6e-23  13%  2ab1A  [x.x.x] HYPOTHETICAL PROTEIN
    8e-23  14%  1dysA  [c.6.1] ENDOGLUCANASE
    1e-22  25%  2b3zA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    1e-22  15%  1af2A  [c.97.1 - c.97.1] CYTIDINE DEAMINASE
    2e-22  21%  2d30A  [x.x.x] CYTIDINE DEAMINASE
    2e-16  16%  2ab1B  [x.x.x] HYPOTHETICAL PROTEIN
    4e-04  16%  2ahuA  [x.x.x] PUTATIVE ENZYME YDIF
:151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSHALFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRESLCDASAHAEILAMRKAAKHLGDWRL
2b3jD           -NDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIERAAKVLGSWRL
2b3jA           --DIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIERAAKVLGSWRL
2b3jC           --DIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIERAAKVLGSWRL
3dh1B           --TEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRSEVF
3dh1A           --TEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRSEVF
3dh1D           --TEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRSEVF
2a8nA           --RTHFMELALVEARSAGERDEVPIGAVLVLDGRVIARSGNRTRELNDVTAHAEIAVIRMACEALGQERL
3b8fB           --EQQLYDVVKQLIEQRYP-NDWGGAAAIRVEDGTIYTSVAPDVINASTELCMETGAILEAHKFQKKARE
3b8fC           --EQQLYDVVKQLIEQRYP-NDWGGAAAIRVEDGTIYTSVAPDVINASTELCMETGAILEAHKFQKKARE
3b8fA           --EQQLYDVVKQLIEQRYP-NDWGGAAAIRVEDGTIYTSVAPDVINASTELCMETGAILEAHKFQKKARE
3e1uA           -----FNNEPWVRGRHETYLYEVERMHNDTWVRRGFLCNQAPHKHGFLEGRHAELCFLDVIPWKLDLDQD
3dmoB           ---------ALIEAAKAAREKAYKVGAALVTNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPIA
3dmoA           --------HALIEAAKAARESNFKVGAALVTNDGKVFHGCNVENASYGLCNCAERTALFSALAAGYRPGE
2a8nB           -----FMELALVEARSAGERDEVPIGAVLVLDGRVIARSGNRTRELNDVTAHAEIAVIRMACEALGQERL
2b3zD           --EEYYMKLALDLAKQGEGQTESNVGAVVVKDGQIVGMGAHLK----YGEAHAEVHAIHMAG-----AHA
2ab1A           --------------------------------PEIASLSWGQKVK--GSNTTYKDCKVWPGGSRTWDWRE
1dysA           --LLRDIDVAIQNARAAKARGENPIVGLVL--YNLPDRDCSAGESSGELKLNEYVNPFAQKLKAASDVQF
2b3zA           --EEYYMKLALDLAKQGEGQTESNVGAVVVKDGQIVGMGAHLK----YGEAHAEVHAIHMAGAHAEGADI
1af2A           --------------------SNFNVGAIARGVSGTWYFGANFIGATMQQTVHAEQSAISHAWLS---GEK
2d30A           MNSKQLIQEAIEARKQAYVPSKFQVGAALLTQDGKVYRGCNVENASYGLCNCAERTALFKAVSEGDVAIA
2ab1B           -------------------------------------------------STSPEIASLSWGQKVKGSNTV
2ahuA           ----INGRVPVLSAQEAVN--YIPDEATLCVLGAGGGILE----------ATTLITALADKYKQTQTPRL


                         .         .         *         .         .         .         .:140
query           NDATLYVTVEPCAMCAGAIVQFRINRLVYGAPNAKSGSVDTILNIVQEARFNHRVEVIAGILEDQCKEII
2b3jD           EGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLL
2b3jA           EGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLL
2b3jC           EGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLL
3dh1B           EHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLTGRPFQCIPGYRAEEAVEML
3dh1A           EHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLTGRPFQCIPGYRAEEAVEML
3dh1D           EHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLTGRPFQCIPGYRAEEAVEML
2a8nA           PGADLYVTLEPCTMCAAAISFARIRRLYYGAQDPKGGAVESGVRFFSQPTCHHAPDVYSG----------
3b8fB           NEHSELKVLSPCGVCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYH----DEMVKEWST--
3b8fC           NEHSELKVLSPCGVCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYH----DEMVKEW----
3b8fA           NEHSELKVLSPCGVCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYH----DEMVKEWST--
3e1uA           YRVTCFTSWSPCFSCAQEMAKFISKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWD
3dmoB           VVGETHGPIAPCGACRQVMIELGKPTLEVVLTNMQGDVRVTSAGDLLPDAF-------------------
3dmoA           FVGETHGPIAPCGACRQVMIELGKPTLEVVLTNMQGDVRVTSAGDLLPDAF-------------------
2a8nB           PGADLYVTLEPCTMCAAAISFARIRRLYYGAQDPKGGAVESGVRFFSQPTCHHAPDVYSGLAESESAEIL
2b3zD           EGADIYVTLEPCSPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMK----EAGIEVREGILADQAERLN
2ab1A           TGTEHSPG--VQPADVKEVVEKGVQTLVIGRGSEALKVPSSTVEYLK----KHGIDVRVLQTEQAVKEYN
1dysA           AEPDAIGNMVTGTSAFCRNAGPQQEAIGYAISQLQASHIHLYLDVANGGKLEPTAQEVATILQKAGNNAK
2b3zA           VTLEPCSHYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVRE----GILADQAERLN
1af2A           ALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHA-------------------------------
2d30A           IVADTKRPVPPCGACRQVMVELCKQDTKVYLSNLHGD---------------------------------
2ab1B           WPGGSRTWDGVQPADVKEVVEKGVQTLVIGRGSEALKVPSSTVEYLK----KHGIDVRVLQTEQAVKEYN
2ahuA           SIISPTGLGDRADRGISPLAQEGLVKWALCGH--------------------------------------


                         +         .         .         .         .         *         .:210
query           QNFFRELRKNK
2b3jD           TTFFKNLRANK
2b3jA           TTFFKNLRAN-
2b3jC           TTFFKNLRANK
3dh1B           KTFYK------
3dh1A           KTFYKQ-----
3dh1D           KTFYKQ-----
2a8nA           -----------
3b8fB           -----------
3b8fC           -----------
3b8fA           -----------
3e1uA           TFVDHQGCPFQ
3dmoB           -----------
3dmoA           -----------
2a8nB           -----------
2b3zD           EKFL-------
2ab1A           ALVAQGVRVG-
1dysA           IRGF-------
2b3zA           EKFL-------
1af2A           -----------
2d30A           -----------
2ab1B           ALVAQGVR---
2ahuA           -----------