[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO48689.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bs2B.bssp"
#ERROR : Can't open dsspfile "1b0tA.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "1d0cB.bssp"

## Summary of PDB Search
:334
    8e-06  17%  2bs2B  [d.15.4 - a.1.2 (1e7pB)] QUINOL-FUMARATE REDUCTASE
    9e-06  14%  1b0tA  [d.58.1] PROTEIN (FERREDOXIN I)
    1e-04   9%  1d0cA  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    1e-04   7%  1d0cB  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bs2B           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bs2B           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bs2B           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxEKCLGCGACTYLCPTCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSGHNPR
2bs2B           --------------------------------QEVFELDRCIECGCCIAACGTKIMREDFVGAGLNRVVR
1b0tA           ----------------DNCIKCKKCVEVCPVDGPNFLVIHPDECIDCA-LCEPECPAQAIFSEDEVPEDM
1d0cA           --------------------------------VASTGTYHLRESELV----FGAKQAWRNAPRCVGRI--
1d0cB           ---------------------YSSIKRSGSQAHESTGTYHLRESELV----FGAKQAWRNA-----PRCV


                         .         *         .         .         .         .         +:350
query           PGGKARWRQRLMHKFNYFVERYNATACVGCGRCIKNCPVNLDIRQVLADVRALD
2bs2B           FMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLR---
1b0tA           QEFIQLNAE-------------LAEVWPNITEDKDPLPDAEDWDGVKGKLQHLE
1d0cA           ---QWGKLQVFDARDCSSAQEMFTYICNHIKYAT--NRGNLRSAITVFPQR---
1d0cB           GRIQWGKLQVFDARDCSSAQEMFTYICNHIKYAT--NRGNLRSAITVFPQ----