[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO48707.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bjdC.bssp"

## Summary of PDB Search
:472
    1e-10  15%  3bjdC  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
:472

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTLDDQREMLRVV
3bjdC           ---------------------TRNFLQNLPIEEARIVAASKLAALAELYVLSLSDDVATAQTRRWLARAI


                         .         .         *         .         .         .         .:140
query           TNSWHLDFSPLRDEILEKDLFARDFTLNAMALPVSMGINKYNWQNQIQDPTXXXXXXXXXXXRAASSSSI
3bjdC           YRVEERFPAASRALSEEDFQKRLEQEIAAQSR----------------ERHPSQYVFSGSASRAQLQVFL


                         +         .         .         .         .         *         .:210
query           QQDPLRSLRGIRFAATYNLAIIPETMVLLRQGTRRIEQIAGERLWHELAILFKLPITSFWINYMDQELHF
3bjdC           RHQWFRTFRLYRDAADVNLTDVDEAAALARYLYGELGEEDEKGSHPRLLAKLLEAIGLEADFQA-VSTPE


                         .         .         .         +         .         .         .:280
query           WQYLLPGQLRMAQTKQNHYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVL
3bjdC           EIAYLNNRARAFRH-------AEVGWGLAVFYITELVV--------------------------------


                         .         *         .         .         .         .         +:350
query           KLAALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLKxxxxxxxxxxxxxxxxxxxxxxxxxx
3bjdC           NHEKLYRALLQAGL---SEDQAEYYKVHISLVPPRAKREWQLIA--------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bjdC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bjdC           ----------------------------------------------------