[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO48823.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3drdB.bssp"
#ERROR : Can't open dsspfile "3dodA.bssp"
#ERROR : Can't open dsspfile "3dodB.bssp"
#ERROR : Can't open dsspfile "2bylA.bssp"
#ERROR : Can't open dsspfile "3du4A.bssp"
#ERROR : Can't open dsspfile "2byjA.bssp"
#ERROR : Can't open dsspfile "2cinA.bssp"
#ERROR : Can't open dsspfile "3bv0A.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "3drdA.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "1asfA.bssp"
#ERROR : Can't open dsspfile "2cstA.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "3clzB.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "1aiaA.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "3clzD.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "1czcA.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1akaA.bssp"
#ERROR : Can't open dsspfile "3aatA.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "2d61A.bssp"
#ERROR : Can't open dsspfile "1aheA.bssp"
#ERROR : Can't open dsspfile "7aatA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "2d64A.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "1arsA.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "1ajrA.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "1bqdA.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "3clzA.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "2d66A.bssp"
#ERROR : Can't open dsspfile "3e77C.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "3dwkA.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "2bhgA.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1ay5B.bssp"
#ERROR : Can't open dsspfile "3e77A.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1bjoA.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "2ch2A.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "1dkrA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1bjnA.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "2bhxB.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "2bieA.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "1dfoA.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "1bybA.bssp"
#ERROR : Can't open dsspfile "2c0rA.bssp"
#ERROR : Can't open dsspfile "3e77B.bssp"
#ERROR : Can't open dsspfile "1btcA.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "1ay4A.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "1djeA.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3ca8B.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "3c3jC.bssp"
#ERROR : Can't open dsspfile "3d1rA.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "2dqxA.bssp"
#ERROR : Can't open dsspfile "3ca8A.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "1cj0B.bssp"
#ERROR : Can't open dsspfile "2cdmA.bssp"
#ERROR : Can't open dsspfile "2a8iB.bssp"
#ERROR : Can't open dsspfile "1cliB.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "3a2bA.bssp"
#ERROR : Can't open dsspfile "3brmA.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "1awiA.bssp"
#ERROR : Can't open dsspfile "3blvH.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "1c8fA.bssp"
#ERROR : Can't open dsspfile "1c8eA.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "1dy2A.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "1bxgA.bssp"
#ERROR : Can't open dsspfile "3blvD.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "2b34A.bssp"
#ERROR : Can't open dsspfile "1b1xA.bssp"
#ERROR : Can't open dsspfile "1ei7A.bssp"
#ERROR : Can't open dsspfile "2bu3A.bssp"

## Summary of PDB Search
:396
    2e-98  29%  3drdB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    4e-98  29%  3dodA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-97  29%  3dodB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-96  34%  2bylA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    5e-93  28%  3du4A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-81  35%  2byjA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    3e-74  24%  2cinA  [x.x.x] L-LYSINE-EPSILON AMINOTRANSFERASE
    4e-73  29%  3bv0A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    6e-72  48%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    8e-63  48%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    1e-60  24%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-60  29%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-58  27%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    1e-57  30%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    9e-57  30%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    6e-56  27%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    9e-54  28%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    9e-51  26%  3drdA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-50   8%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-50  26%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    7e-50  23%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    5e-49  12%  1asfA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    5e-49   8%  2cstA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-48   9%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-48  13%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    5e-48  13%  1c7nA  [c.67.1] CYSTALYSIN
    1e-47   8%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-47  12%  1aamA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    5e-47  10%  3clzB  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE UHRF1
    1e-46  10%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-46  12%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-46   8%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-46  14%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-46  12%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-46   9%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    1e-45  13%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-45  12%  1aiaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-45  14%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-45   9%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    2e-45   8%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-45  11%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-45   9%  3clzD  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE UHRF1
    4e-45  22%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    4e-45  13%  1czcA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    6e-45  14%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-45  10%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    8e-45   8%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-45  15%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-44   8%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-44  13%  2c44A  [x.x.x] TRYPTOPHANASE
    2e-44  14%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-44  12%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-44   8%  1akaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-44  11%  3aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-44  14%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    7e-44   8%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-44  10%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    8e-44  12%  2d61A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    8e-44  12%  1aheA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-44   8%  7aatA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-44  14%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-43  12%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    3e-43  11%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-43   8%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-43  14%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    7e-43  12%  2d64A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-43  14%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    9e-43  13%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    1e-42  12%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    1e-42  12%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-42   9%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    2e-42  11%  1arsA  [c.67.1 (1argA)] ASPARTATE AMINOTRANSFERASE
    2e-42  11%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    3e-42  11%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-42  11%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    3e-42   9%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    4e-42  11%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    5e-42   8%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-42  11%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    6e-42  11%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    6e-42  11%  1eg5B  [c.67.1] AMINOTRANSFERASE
    8e-42  14%  1ax4A  [c.67.1] TRYPTOPHANASE
    1e-41  13%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    1e-41   9%  1ajrA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-41  13%  2c44B  [x.x.x] TRYPTOPHANASE
    2e-41  14%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-41  14%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-41  14%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    3e-41  12%  1bqdA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    4e-41  10%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    4e-41  14%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    4e-41  10%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    5e-41  12%  3e9kA  [x.x.x] KYNURENINASE
    6e-41  13%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    6e-41  13%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    7e-41   9%  3clzA  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE UHRF1
    9e-41  13%  1ecxB  [c.67.1] AMINOTRANSFERASE
    1e-40  14%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-40  14%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    2e-40  14%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    4e-40  10%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    5e-40  12%  2c44C  [x.x.x] TRYPTOPHANASE
    7e-40  11%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    7e-40  15%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    9e-40  11%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    1e-39  12%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-39   9%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    3e-39  14%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    2e-38  12%  2d66A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-38   9%  3e77C  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    3e-38  14%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-38   9%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    4e-38  11%  3dwkA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    7e-38  14%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    2e-37  14%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    2e-37  16%  2bhgA  [x.x.x] FOOT-AND-MOUTH DISEASE VIRUS 3C PROTEASE
    2e-37  12%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    3e-37  12%  1c0nA  [c.67.1] PROTEIN (CSDB PROTEIN)
    6e-37  11%  1ay5B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    7e-37   8%  3e77A  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-36  11%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    1e-36  11%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    1e-36  11%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    2e-36  10%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-36   8%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-36  12%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-36  12%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    3e-36   9%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    4e-36  11%  1d2fB  [c.67.1] MALY PROTEIN
    5e-36   9%  1bjoA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    8e-36   9%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    9e-36  11%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    1e-35  10%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-35   9%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    4e-35  14%  1ecxA  [c.67.1] AMINOTRANSFERASE
    6e-35  12%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-34  13%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    2e-34  12%  2ch2A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    3e-34  11%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    3e-34  11%  1d2fA  [c.67.1] MALY PROTEIN
    3e-34  12%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    5e-34  12%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    6e-34  17%  1dkrA  [c.61.1 - c.61.1] PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
    8e-34  14%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    2e-33   8%  1bjnA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    2e-33  13%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    4e-33  11%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    5e-33  12%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-33  11%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    7e-33  12%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    1e-32   9%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-32  10%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    1e-32  11%  2bhxB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    4e-32  11%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    7e-32  10%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    8e-32  12%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    1e-31  22%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    2e-31   8%  2bieA  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-31  12%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    2e-31  13%  1eg5A  [c.67.1] AMINOTRANSFERASE
    2e-31  13%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    3e-31  15%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    5e-31  15%  1dfoA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    5e-31  12%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    6e-31  13%  1bybA  [x.x.x] BETA-AMYLASE
    8e-31  12%  2c0rA  [c.67.1 (1bt4A)] PHOSPHOSERINE AMINOTRANSFERASE
    8e-31   9%  3e77B  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-30  13%  1btcA  [x.x.x] BETA-AMYLASE
    1e-30  11%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    1e-30  11%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    2e-30   9%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    4e-30  19%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    5e-30  12%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-30  10%  1ay4A  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    1e-29  13%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    2e-29   9%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-29  11%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    2e-29  20%  1djeA  [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
    2e-26  15%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    4e-26  13%  3ca8B  [x.x.x] PROTEIN YDCF
    6e-26   9%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    2e-25   8%  3c3jC  [x.x.x] PUTATIVE TAGATOSE-6-PHOSPHATE KETOSE/ALDOSE
    3e-25  10%  3d1rA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    5e-25  12%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    1e-24  10%  2dqxA  [x.x.x] BETA-AMYLASE
    1e-22  14%  3ca8A  [x.x.x] PROTEIN YDCF
    2e-21  10%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    6e-20  12%  1cj0B  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    1e-19  11%  2cdmA  [x.x.x] TRWC
    1e-19   8%  2a8iB  [x.x.x] THREONINE ASPARTASE 1
    2e-19  14%  1cliB  [d.79.4 - d.139.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE
    5e-18  14%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    1e-16  16%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-15   5%  1c8nA  [b.121.4] COAT PROTEIN
    2e-15  18%  3a2bA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    2e-12  14%  3brmA  [x.x.x] GLUTAMINASE 1
    2e-11  12%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    1e-10   7%  1awiA  [d.110.1] PROFILIN
    1e-09  11%  3blvH  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    2e-09  11%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    3e-09   9%  2btwA  [x.x.x] ALR0975 PROTEIN
    3e-09  18%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    3e-09  18%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    4e-09  21%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    3e-08   6%  1c8fA  [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID
    2e-07   5%  1c8eA  [b.121.5] FELINE PANLEUKOPENIA VIRUS CAPSID
    7e-07  14%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    7e-07   7%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    1e-06   9%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    2e-06  18%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    3e-06  18%  1dy2A  [d.169.1] COLLAGEN ALPHA1(XV) CHAIN
    5e-05   4%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    8e-05  28%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    9e-05  15%  1bxgA  [c.58.1 - c.2.1] PHENYLALANINE DEHYDROGENASE
    2e-04  12%  3blvD  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    3e-04  12%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    5e-04  11%  2b34A  [x.x.x] MAR1 RIBONUCLEASE
    6e-04  11%  1b1xA  [c.94.1 - c.94.1] LACTOFERRIN
    7e-04  10%  1ei7A  [a.24.5] COAT PROTEIN
    8e-04   9%  2bu3A  [x.x.x] ALR0975 PROTEIN
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT
3drdB           ---HDLIEKSKKHLMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGK
3dodA           ---HDLIEKSKKHLMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGK
3dodB           --------------MKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGK
2bylA           --SDDIFEREYKYGAHNAHPLPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGHCHPKIVNALKSQVDK
3du4A           --THDLIEKSKKHLMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGK
2byjA           --SDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSISAVNQGHCHPKIVNALKSQVDK
2cinA           -----------RSMLVDGLDIVLDLTRSGGSYLVDATGRRYLDMFTFVASSALGMNPPALVDDREFHAEL
3bv0A           LTPEQIIAVDGAHL---WHPSPVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV
2eh6A           ------------YLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEK
2e54A           ------------YLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEK
1dtyA           --TTDDLAFDERHIWMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA
2e7uA           --------------FKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLER
3dxvA           ---KALYDRDGAANLQKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAAN
1d7uA           LNDATFWRNARQHLVRYGGTFPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK
1dgdA           -DDATFWRNARHHLVRGGTFEPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK
3dxvB           ---KALYDRDGAAIGNKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAAN
3bv0B           LTPEQIIAVDGAHL---WHPSPVVAVAAHGAWIRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV
3drdA           --THDLIEKSKKHLMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGK
3ei7A           -------------RNSNMSKLQAGIARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
2cfbA           ---------------------PIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEK
3bs8A           -------------AFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAEY
1asfA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
2cstA           -------------------RAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPLPVVRKVEQLIAGD
1ajsA           ------------SVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWPVVRKVEQRIANN
2bwnD           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDY--LGMGQHPVVLAAMHEALEA
1c7nA           ----------------IYDFTTKISRKNLGSLKWDLMYSQNPEVGNEVVPLSVADNPPELIEGLKKYLDE
3eiaA           -------------RNSNMSKLQAGIARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
1aamA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
3clzB           -----------VAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNT
2dgmB           ----------------AESKRFPLHEMRDDVAFQIINDELYLDGNARQATFCQTWDDENVHKLMDLSINK
2aatA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
3ei9B           -------------RNSNMSKLQAGIARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
1bjwA           ---------------------SATVAVNAKALELRRQGVDLVALTAGEPDF---DTPEHVKEAARRALAQ
1arhA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
3dc1D           --------------MN-YARFITAASAARNPSPIRRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQ
2egyB           -------------------GAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREK
1aiaA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
1bkgA           ---------------------SATVAVNAKALELRRQGVDLVALTAGEPDF---DTPEHVKEAARRALAQ
1ejiA           ----------TLWASHEKLSQPLKDSDAEVYSIIKKESNRQRVGLELIASE--NFASRAVLEALGSSLNN
3ei6A           ------------------------IARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
1b4xA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
3clzD           -----------VAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNT
2cy8A           EGSVFWAQRARSVMPDGAFDHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSH
1czcA           -------------MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTLTSVKKAEQYLLEN
2egyD           -------------------GAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFP-KEEAAEAAARLREK
3ecdB           ----------------------------------------PFFSQS------LAERDASVRGAILKELER
3ei7B           ------------------------IARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
2egyC           -------------------GAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFP-KEEAAEAAARILRE
3ei6B           ------------------------IARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
2c44A           LPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSG---TGAVTQSMQAAMMRGDEA
2bwnE           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDY--LGMGQHPVVLAAMHEALEA
1ariA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKVLTSVKKAEQYLLEN
1akaA           -----------------MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK
3aatA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
2bwoD           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNRPDG-GKQDITVWCGND--YLGMGQHPVVLAAMHEALEA
3ei8A           -------------RNSNMSKLQAGIARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
2dgmA           ---KQVTDLRSELLTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQATFCQTWDDENVHKLMDLSINK
2d61A           -------------MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKVLTSVKKAEQYLLEN
1aheA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKILTSVKKAEQYLLEN
7aatA           -----------------MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK
1b5oA           ---------------------SATVAVNAKALELRRQGVDLVALTAGEPDF---DTPEHVKEAARRALAQ
2dgkC           -------------------RFP-LHEMRDDVAFQIINDELYLDGNARQATFCQTWDDENVHKLMDLSINK
1bqaA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
3ei9A           -------------RNSNMSKLQAGIARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
1b5pA           ---------------------SATVAVNAKALELRRQGVDLVALTAGEPDF---DTPEHVKEAARRALAQ
2d64A           -------------MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTLTSVKKAEQYLLEN
2dr1B           --------------------------------VYEMVKPKYKLFTAGP-----VACFPEVLEIMKVQMFS
3e2fA           ----------------------------RIEGLDSNVWVEFTKLAADPSVVNLGQGFPYVKEELSKAAFI
2dgmE           ----------------AESKRFPLHEMRDDVAFQIINDELYLDGNARQATFCQTWDDENVHKLMDLSINK
2d5yA           -------------MFENITTAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
3dc1A           ---------------------ARFITAASAARNPSPGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQ
1arsA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
2dgmC           ---KQVTDLRSELLTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQATFCQTWDDENVHKLMDLSINK
1asbA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
3bcbA           ------------QGKCPEDGWDESTLELFLHELAVMDSNNFLGN-CGVGEREGRVASALVARRHYRFIHG
3dc1B           ----------------------------ARNPSPIRGPKSMISLAGGLPNPNMFPFKTAVITVENGKIPE
3ecdA           ---------------------------------------------NPFFSQSLAERDASVRGAILKELER
3eiaB           ------------------------IARRRSAHLLKYPDAQVISLGIGDTT---EPIPEVITSAMAKKAHE
1ay4B           ---------------------NLKPQLALMGEFRADPRQGKIDLGVGVYKDATGHTMRAVHAAEQRMLET
3ecdD           ---------------------------------------------NPFFSQSLAERDASVRGAILKELER
1eg5B           --------------------------------------RVYFDNNA------TTRVDDRVLEEIVFYREK
1ax4A           --------------RIKMVEKIRVPSREEREAALKEAGYNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAM
3e2yA           ----------------------------RIEGLDSNVWVEFTKLAADPSVVNLGQGPSYVKEELSKAAFI
1ajrA           ------------SVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYR--TDDCQPWVLPVVRKVEQR
2c44B           LPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSG---TGAVTQSMQAAMMRGDEA
2bwpA           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDY--LGMGQHPVVLAAMHEALEA
5bj4A           ------------------------------RVQAMKPGVDLVALTAGEPDF---DTPEHVKEAARRALAQ
5bj3A           -----------------------------GLSRRVQAMKPLVALTAGEPD---FDTPEHVKEAARRALAQ
1bqdA           -------------MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTLTSVKKAEQYLLEN
1bj4A           ---------------------PLKDSDVEVYNIIKKESNRQRVGLELIA--SENFASRAVLEALGSCLNN
2bwoA           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDY--LGMGQHPVVLAAMHEALEA
3ecdC           ---------------------------------------------NPFFSQSLAERDASVRGAILKELER
3e9kA           -------------FREFYIPKIQDLPPVDLSLVNKDENAIYFLGNSL------GLQPKMVKTYLEEELDK
1b8gB           --------LSRNATFNSSSYFLGWQEYEKNPYHEVHNTNGIIQMGLALESWLAKNPEAAAFKKNGESIFA
3b46A           -------VVANKYFTSNTAKDVWSLTNEAAAKAANNQGRELINLGQGFFSYSPPQFAIKEAQKALDIPMV
3clzA           -----------VAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNT
1ecxB           --------------------------------------RVYFDNNA------TTRVDDRVLEEMIVFYRE
2bwnA           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDY--LGMGQHPVVLAAMHEALEA
3b46B           ------------------------FTSNTAKDVWSLTGRELINL--GQGFFSYSP-PQFAIKEAQKALDI
1dfoB           ---------------------REMNIADYDAELWQAMEQEKVRQEEHILIASENYTSPRVMQAQGSQLTN
3d6kA           -------------------------------YAELKAKNLSLDLTRGKPSAEQLDLSNDLLSLPGGDFRT
2c44C           LPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSG---TGAVTQSMQAAMMRGDEA
1c7gA           ---------------------VSMISRDERVKKMQEAGYNTFLLNSKDIY--IDLLTDSGTNAMSDKQWA
2bwnB           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGND--YLGMGQHPVVLAAMHEALEA
2dgkA           --------------------------MRDDVAFQIINDELYLDGNARQATFCQTWDDENVHKLMDLSINK
1b8gA           ---------------------NPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNPEAAAFKKNGESIFA
3bc8A           -------------CPEDGWDESTLELFLHELAVMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGR
3cbfA           ----------SEAFGKGAGRIQ---ASTIRELLKLTQRPGILSFAGGLPAPELFP-KEEAAEAAARLREK
2d66A           -------------MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPTSVKKAEQYLLEN
3e77C           ----------------------------------------YFQSMLP------HSVLLEIQKELLDYKGV
2bwoB           --DKAIQKLHDEGRFIDIEREKGAFPKAQWNRPDG-GKQDITVWCGND--YLGMGQHPVVLAAMHEALEA
3bcaA           --------------LLEQGKCP-EDGWDESTLELFLHELAVMDSNNFLGNCGVGEREGRVASALVARRHY
3dwkA           ---------------------------PIPAKIYDKNGE-LVKTLDNGQ--RHEHVNLKDVPKSMKDAVL
3dzzB           -----------------QYDFTHVPKRQGNSIKWGVLKEKELPWIAED-----FKIAPEIASEEKLKVAA
2dr1A           -------------------------FEEAFKEVYEMVKPKYKLFTAGP-----VACFPEVLEIMKVQMFS
2bhgA           ----------------------------------------------------------------------
3dzzA           -------------------DFTHVPKRQGNSIKWGVLKEKELPWIAED-----FKIAPEIASEEKLKVAA
1c0nA           ---------------------VDAVRADFPVLSREVNGLPLAYLDSAA----SAQKPSQVIDAEAEFYRH
1ay5B           --------------------LGNLKPQAPDKILALMGEFGKIDL--GVGVYKDATGHTPIMRAVHAAEQR
3e77A           ----------------------------------------YFQSMLP------HSVLLEIQKELLDYKGV
3dydA           --------------------------VRPSDKVKPNPNKTMISLSIGDPTVFGNLPDPEVTQAMKDALGK
1djuA           ----------------------------LSDRLELVSAKDVISLGIGEP---DFDTPQHIKEYAKEALDK
3dydB           ---------------------------VRPSDVKPNPNKTMISLSIGDPTVFGNLTDPEVTQAMKDALDS
3cq5B           --------------MTKITLSDLPLRERGEHAYGAPQLNVDIRLNTNENP---YPPSEALVADLVATVDK
3d6kB           ----------------------LAQVREEVTAKYAKAKNLSLDLTRGKPSAEQLDLSNDLLSLPGGDFRT
3cq4B           ---------------------------TLSDLPLREELRVDIRLNTNENP---YPPSEALVADLVATVDK
2dkjA           -------------------------LFELIALEEKRQREGLELIAS------ENFVSKQVREAVGSVLTN
2aevA           -----------------------------------------------------EKARKIILEILNEKGRD
1d2fB           ---------------------------------FDFSKVVLLPFTISDMD---FATAPCIIEALNQRLMH
1bjoA           --------------------------------------QIFNFSSG------PAMLPAEVLKQAQQELRD
3d6kC           ------------------------------KYAELKAKNLSLDLTRGKPSAEQLDLSNDLLSLPGGDFRT
3bcxA           --------------------------QIAELVQYAETAMAPKPFEAGKSVVPPSGKVTKELQLMVEASLD
3cq4A           ------------------------------DLPLREELRVDIRLNTNENP---YPPSEALVADLVATVDK
3d6kD           ------------------------------KYAELKAKNLSLDLTRGKPSAEQLDLSNDLLSLPGGDFRT
1ecxA           --------------------------------------RVYFDNNAT------TRVDDRVLEEMIVFYRE
3cq6A           --------------------LPLREELRGEHAYGAPQLNVDIRLNTNENP---YPPSEALVADLVATVDK
3dr7B           ----------------------------------------------------ISVAAPRLDGNERDYVLE
2ch2A           -------------------------------------PASLRNPLIIPEKIMMGPGSKRVLTAMTNTVLS
1bw0A           --------------------------------------------VGDPTLDKNLLTSAAQIKKLKEAIDS
1d2fA           -----------------------------------------LPFTISDMD---FATAPCIIEALNQRLMH
3cq5A           ----------------TLSDLPLREELRGEHAYGAPQLNVDIRLNTNENP---YPPSEALVADLVATVDK
3bb8A           --------------------------QIAELVAYAETAMAPKPFEAGKSVVPPSGKVTKELQLMVEASLD
1dkrA           -----------------------------------------------------LNSNPELAKEIADIVGV
1agxA           ------------YSAAKVPVDALIKAVPQVNDLANITGIQALQVASESIT---DKELLSLARQVNDLVKK
1bjnA           --------------------------------------QIFNFSSG------PAMLPAEVLKQAQQELRD
3bcxB           --------------------------QIAELVQYAETAMAPKPFEAGKSVVPPSGKVTKELQLMVEASLD
3b8xA           ----------------------------------------------------YPLASSTWDDLEYKAIQS
3dr4B           ----------------------------------------------------ISVAAPRLDGNERDYVLE
1b9iA           ------------------------------------------------------PAWPQYDDAERNGLVR
1b9hA           -----------------------------------------------------FPAWPQYDDAERNGLVR
2bieB           --------------------------------------QVFNFNAG------PSALPKPALERAQKELLN
3b8xB           ----------------------------------------------------YPLASSTWDDLEYKAIQS
2bhxB           --------------------------------------KQVFNFNAG-----PSALPKPALERAQKELLN
2a7vA           ----------------------------------------------WTGQESLSDSDPEMWELLQREKDR
1c4kA           -------------------------------IQFDCPGHQGGQYYRKHPAGREFYDFFGETVFRADLCNA
3caiA           ---------------------------------HPSLGDGWVHF----DAPAGMLIPDSVATTVSTAFRR
1bs0A           -------------------RYPVA--QGAGRWLV-ADDRQYLNFSSN---DYLGLSHPQIIRAWQQGAEQ
2bieA           --------------------------------------QVFNFNAG------PSALPKPALERAQKELLN
1djuB           -----------------------------------ELVSDVISLGIGEP---DFDTPQHIKEYAKEALDK
1eg5A           --------------------------------------RVYFDNNAT------TRVDDRVLEEIVFYREK
3bn1D           -------------------------------------------------------AAPRLDGNERDYVLE
2douB           ----------------------------------------------------------------------
1dfoA           --------------------------ADYDAELWQAMEQEKVRQEEHIEIASENYTSPRVMQAQGSQLTN
2c7tA           ------------------------------------------------------QHSDRTRRKIEEVFQS
1bybA           ------------------------------------------------NML-LNYVPVYVMLPLGVVNVD
2c0rA           -------------------------------------ERAYNFNAG------PAALPLEVLERAQAEFVD
3e77B           ----------------------------------------YFQSMLP------HSVLLEIQKELLDYKGV
1btcA           ------------------------------------------------NML-LNYVPVYVMLPL------
1bw0B           --------------------------------------------VGDPTLDKNLLTSAAQIKKLKEAIDS
2ch1A           ---------------------------PASLRNPLIIPEKIMMGPG------PSNCSKRVLTAMTNTVLS
3dr4D           ----------------------------------------------------ISVAAPRLDGNERDYVLE
2bwpB           ---QKLHDEGRYRTFIDIEREKGAFPKAQWNRPDG-GKQDITVWCGN---DYLGMGHPVVLAAMHEALEA
3dr4A           -------------------------------------------------------AAPRLDGNERDYVLE
1ay4A           -------------MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHIMRAVHAAEQRMLET
3bn1C           ----------------------------------------------------ISVAAPRLDGNERDYVLE
2c81A           -----------------------------------------------------PQHSDRTRRKIEEVFQS
2e7jA           -----------------------------------------------------LQTGGKLTEEARQALLE
1djeA           -------------------RYPVA--QGAGRWLV-ADDRQYLNFSSN---DYLGLSHPQIIRAWQQGAEQ
2douA           ----------------------------------------------------------------------
3ca8B           ----------DFSGEVPYQADCVILAGNAVMPTIDADQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRT
2bkwA           ----------------------------------------DTLLIPGPI-----ILSGAVQKALDVPSLG
3c3jC           --------YHLPITCNEAGALYQNAINSDNAFALLPAETHDRGFATSSITTASCLAVFAPETINSQTFRD
3d1rA           ------------------------------------------------------GRGDAVDIAVDPIEGT
1cj0A           ---------------------PLKDSDAEVYDIIKKESNRQRVGLELIASE--NFASRAVLEALGSCLNQ
2dqxA           --------------------------------------------------------------MLLNYVPV
3ca8A           ------LAQDDFSGEVPYQADCVILAGNAVMPTIDADQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRT
2aeuA           --------------------------------------------------------GFLIDEKDKALLNT
1cj0B           ------------------------------DIIKKESNRQRVGLELI---ASENFASRAVLEALGSCLNN
2cdmA           -----------------------------------AASFYASEWQGK---GAEELGSGEVDSKRFRELLA
2a8iB           ---PFTNAGGSN--LNLLGEIECDASIDGKSLNFGAVGALSGANRLLCEGQKGRIPPCFLVGEGAYRWAV
1cliB           ----------------------------------------------------------------------
3bn1A           ----------------------------------------------------ISVAAPRLDGNERDYVLE
3dr4C           ----------------------------------------------------ISVAAPRLDGNERDYVLE
1c8nA           ----------------------------------------------------------------------
3a2bA           ----------------------------QDTEV-KIDGRRVLMFGSN---SYLGLTDTRIIKAAQDALEK
3brmA           ----------------------------------------------------------------------
1e5eA           ---------------------------------CIHANPQKDQFGAAIPPIYQTSTFDNCQQGGNRFAGQ
1awiA           ----------------------------------------------------------------------
3blvH           -----------------NIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVLNHGLTNHADQIQNAVLS
1e5eB           -----------------------------------HANPQKDQFGAAIPPIYQTSTFDNCQQGGNRFAGQ
2btwA           ----------------------------------------------------------------------
3e6gD           ----------------------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
2cb1A           ----------------------------------------------------------------------
1c8fA           ----------------------------------------------------------------------
1c8eA           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
3d19A           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
2ctzA           ----------------------------------------------------------------------
1bxgA           ----------------------------------------------------------------------
3blvD           -----------------NIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVLNHGLTNHADQIQNAVL-
3cogB           ----------------------------------------------------------------------
2b34A           --------------------------------------------------------NIKYFPEIITTSRR
1b1xA           ----------------------LCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFTVFENLPD
1ei7A           ----------------------------------------------------------------------
2bu3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG
3drdB           IAHSTLLGMTVPATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIAMKSYKAP
3dodA           IAHSTLLGMTVPATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIAMKSYKAP
3dodB           IAHSTLLGMTVPATQLAETLIDISPKKRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIAMKSYKAP
2bylA           LTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGKYKAKIVFAAGNFWG
3du4A           IAHSTLLGMTVPATQLAETLIDISPKTRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIAMKNGYHG
2byjA           LTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKYTVKGIQKYKAKIVFAAGNFWG
2cinA           MQAALNKPSNVAMARFVETFARDPALPHLFFVEGGALAVENALKAAFDWKSRHDPALGTQVLHLRGAFHG
3bv0A           MNHVMFGGLHEPAARLAKLLVDPAGLDTVFFSDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWRGGYHG
2eh6A           LLHVSNLYENPWQEELAHKLVKHWTEGKVFFANSGTESVEAAIKLARKYWRDKGKNKWK-FISFENSFHG
2e54A           LIHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKK-SEKKYRILSAHNSFHG
1dtyA           MSHVMFGEITAPAIELCRKLVAPQPLECVFLADSGSVAVEVAMKMALQYWDAKGEARDRFLTFRNG-YHG
2e7uA           GLTFG--APSPLEVALAKKVKRAPFVDLVRFVNSGTEATMSALRLARGYTGRPY------IVKFRGNYHG
3dxvA           PAGATILSASAPAVTLAERLLPGEGTHKIWFGHSGSDANEAAYRAIVKA------TGRSGVIAFAGAYHG
1d7uA           LDHLFSGMLSRPVVDLATRLANPPGLDRALLLSTGAESNEAAIRMAKLVTG------KYEIVGFAQSWHG
1dgdA           LDHLFSGMLSRPVVDLATRLANPPGLDRALLLSTGAESNEAAIRMAKLVTG------KYEIVGFAQSWHG
3dxvB           PAGATILSASAPAVTLAERLLAGEGTHKIWFGHSGSDANEAAYRAIVKA------TGRSGVIAFAGAYHG
3bv0B           MNHVMFGGTHEPAARLAKLLVDPAGLDTVFFSDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWRGGYHG
3drdA           IAHSTLLGMTNVPATLAETLIDPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPEKQKFIAMKSYKAP
3ei7A           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
2cfbA           GTSFGAPCLLENIL-AEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFE-----------
3bs8A           GTSFGAPTEVENEL-AKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTG------RNKILKFEGCYHG
1asfA           ETDGIPEFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKN------TSVKRVWVSNPSWPN
2cstA           GSLNHEYLPILGLPEFRANASRAQKRVGSVQGLGGTGALRIGAEFLRRWY-NGNNNTATPVYVSSPTWEN
1ajsA           SSLNHEYLPILGLAEFRTCASRQEKRVGGVQSLGGTGALRIGAEFLARWYNGTN--NKDTPVYVSSPTWE
2bwnD           VGAGSGGTRNISGTRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYS--------DSLNH
1c7nA           TVLGYTGPTEEYKKTVKKWMKDRHQWDWIINTAGVVPAVFNAVREFTKP--------GDGVIIITPVYYP
3eiaA           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
1aamA           EIDGIPEFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKNTS------VKRVWVSNPSWPN
3clzB           NRA--------------LALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYPAEGNRYDGIYKV
2dgmB           NWIDKEEYPQSAAIDLRHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP
2aatA           EIDGIPEFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKNTS------VKRVWVSNPSWPN
3ei9B           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
1bjwA           GKTKYAPPAGIPELRFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLS---------PYWV
1arhA           ETYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPN
3dc1D           FGEMMKRALQYSPSAGIPELLSWLKQIKLHNPPTIHYPPSQGQMDLCVT---SGSQQGLCKVFEMIINPG
2egyB           GEVALQYSPTEGYAPLRAFVAEGVRPEEVLITTGSQQALDLVGKVFLDE--------GSPVLLEAPSYMG
1aiaA           ETTKNYLFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKN------TSVKRVWVSNPSWPN
1bkgA           GKTKYAPPAGIPELKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDE--------VIVLSPYWVS
1ejiA           KYSEGYPGQRLCQKRALQAYHDPQCWGVNVQPYSGSPANFAVYTALVEP--------HGRIGLDLPDGGH
3ei6A           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
1b4xA           ETTKNYLFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKNTSVK------RVWVSNPSWPN
3clzD           NRA--------------LALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYPAEGNRYDGIYKV
2cy8A           GVQYA--ASHPLEVRWARIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRFEGTTANTLLIR-
1czcA           EIDGIPEFGRCTQELLFGKALINDKRARTAQTPGGTGALRVAADFLAKN------TSVRRVWVSNPSWPN
2egyD           GEVALQYSPTEGYAPLRAFVAEGVRPEEVLITTGSQQALDLVGKVFLDE------GSPVLLEAPSYMGAI
3ecdB           QQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYADEVEALAIERVKRLFNAG-----HANVQPHSGAQA
3ei7B           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
2egyC           KGEVALQYSPTEGYFVAEWI--GVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEA--------PSYMG
3ei6B           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
2c44A           YSGSRSYYALA------ESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFD
2bwnE           VGAGSGGTRNAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYS---------DSLN
1ariA           ETTKNYLGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSHPN
1akaA           KMDKEYLGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWG
3aatA           ETTKGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPN
2bwoD           VGAGSGGTRNISGTRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLI------IYSDSLNHAS
3ei8A           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
2dgmA           NWIDKEEYPQSAAIMVADLWAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP
2d61A           ETDGIPEFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKNTS------VKRVWVSNPSWPN
1aheA           ETTKLYLGIRCTQELLFGKGSANDKRARTAQTPGGSGALRVAADFLAKN------TSVKRVWVSNPSWPN
7aatA           KMDKEYLPIADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWG
1b5oA           GKTKYAPPAGIPELRFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPY---------WV
2dgkC           NWIDKEEYPQSAAIDLRHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRM------EAAGKPTDKP
1bqaA           ENYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPN
3ei9A           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
1b5pA           GKTKYAPPAGIPELRFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPY---------WV
2d64A           ETTKNYLGITQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTS------VKRVWVSNPGWPT
2dr1B           HRSKEYRKVHMDTVERLREFLEVEKGEVLLVPSSGTGIMEASIRNGVSK--------GGKVLVTIIGAFG
3e2fA           DNMNQYTRGFALVKALSCLYRQIDPNEEILVAVGAYGSLFNSIQGLVDP-----GDEVIIMVPFYDCYEP
2dgmE           NWIDKEEYPQSAAIMVADLWHAKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP
2d5yA           ETTKNYLGCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTS------VKRVWVSNPSWPN
3dc1A           LLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINP------GDNVLLDEPAYSGTL
1arsA           EIDGIPEFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKN------TSVKRVWVSNPSWPN
2dgmC           NWIDKEEYPQSAAIMVADLWAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP
1asbA           ETTLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPN
3bcbA           IGRSGDISAVQPKANVIKLA-GVHSVASCFVVPMATGMSLTLCFLTLRHKRPK-----AKYIIWPRIDQK
3dc1B           LLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVL------LDEPAYSGTL
3ecdA           QQSQVELIASENIVSRAVLDAQGS-VLTNKYAEGADEVEALAIERVKRL------FNAGHANVQPHSGAQ
3eiaB           LSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPA
1ay4B           ETTK-TYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTALRQALELARMANPDLRVFVSDPTWPN
3ecdD           QQSQVELIASENIVSRA----VLDAQGSVLTNKYADEVEALAIERVKRLFN------AGHANVQPHSGAQ
1eg5B           YGNPNSAHGGIEHEKAREKVAKGVSPSEIFFTSCATESINWILKTVAETF----EKRKRTIITTPIEHKA
1ax4A           ITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGK--AKNPVFISNFHFD
3e2yA           DNMNQYTRGPALVKALSCLYGKIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCY-EPMVRM
1ajrA           IANNSSLNHEYLPILGLAEFRTQEKRVGGVQSLGGTGALRIGAEFLARWYNGTNNK--DTPVYVSSPTWE
2c44B           YSGSRSYYA------LAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFD
2bwpA           VGAGSGGTRNISGTRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDS-------LNHA
5bj4A           GKTKYAPPAGIPELRFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGD--------EVIVLSPYWVS
5bj3A           GKTKYAPPAGIPELKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEV--------IVLSPYWVS
1bqdA           ETTLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNASWPN
1bj4A           KYSEGYPGQRYYGGRALQAYLDPQCWGVNVQPYSGSPANFAVYTALVEP--------HGRIMGLDLPDGG
2bwoA           VGAGSGGTRNISGTRLEAEIAGLHQKEAALVFSSAYNANDATLS-------TLRVLFPGLIIYSDSLNHA
3ecdC           QQSQVELIASENIVSRAVLDAQGS-VLTNKYAEGYDEVEALAIERVKRL-----FNAGHANVQPHSGAQA
3e9kA           WAEVGKRPWITGDESIVGLMIVGANEKEIALMNALTVNLHLLMLSFFKPTPK-----RYKILLEAKAFPS
1b8gB           ELALFQDYHGLPAFFMAEIRGNTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPT--------PYYPG
3b46A           NQYSPTRGRPSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVF----EPFFDQYIPN
3clzA           NRA--------------LALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKAPAEGNRYDGIYKV
1ecxB           KYGNPNSAHGLHMEKAREKVAKGVSPSEIFFTSCATESINWILKTVAET-----FEKRKRTIITTPIEHK
2bwnA           VGAGSGGTRNISGTRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDS---------LN
3b46B           PMVNQYSPINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFE----PFFDQYIPN
1dfoB           KYAEGYPGKRYYGQLAIDRAKELFGADYAVQPHSGSQANFAVYTALLEP--------GDTVLGMNLAHGG
3d6kA           KDGVDCRNYGGLLADIRELWAEGLPADLVVAQDGSSLNIFDLISWSYTWGNNDS------SRPWSAEEKV
2c44C           YSGSRSYYALA--ESVKNIF----GYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFD
1c7gA           GMMIGDEAYAGSENHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRFHQEKNG
2bwnB           VGAGSGGTRNISGTRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGL-------IIYSDSLNHA
2dgkA           NWIDKEEYPQSAAIDCVNMVADLWHAPAPKNGQAVGTNTIGSGMAMKWRWRKRM------EAAGKPTDKP
1b8gA           ELALFQDYHGLPAFFMAEIRKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIP--------TPYYPG
3bc8A           QPKAAGSSLLNKITNLVLNVIKLAGVHSVFVVPMATGMSLTLCFLTLRHKRPK-----AKYIIWPRIDQK
3cbfA           GEVALQYSPTEGYAPLRAFVAEGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEA---------PSYM
2d66A           EIDGIPEFGRCTQELLFGKGSANDKRARTAQTPGGTGALRVAADFLAKNTSVK------RVWVSNPGWPT
3e77C           GISVLEMSHRSSDFLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGL------KAGRCADYVVTGAWS
2bwoB           VGAGSGGTRNISGTRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGL-------IIYSDSLNHA
3bcaA           RFIHGIGQPKAAGNSLVLNVIKVHSVASCFVVPMATGMSLTLCFLTLRHKRP-----KAKYIIWPRIDQK
3dwkA           ATEDNRFYE-HGALDYKRLFGSTQQVVKDAFLSIGRKAQEAYLSYRLEQ---EYSKDDIFQVYLNKIYYS
3dzzB           FGYESVPAEYYKAVDWEEIEHRARPKEDWCVFASGVVPAISAVRQFTSPGDQILVQE---------PVYN
2dr1A           HRSKEYRKVHMDTVERLREFLEVEKGEVLLVPSSGTGIMEASIRNGVSKGGKV--------LVTIIGAFG
2bhgA           ------------------------------------------------------------TKPVELNLDG
3dzzA           FGYESVPAEYYKAVDWEEIEHRARPKEDWCVFASGVVPAISAVRQFTSPGDQILVQE---------PVYN
1c0nA           GYAAVHAGAHEKMENVRKRASLFRSAEELVFVRGTTEGINLVANSWG----NSNVRAGDNIIISQMEHHA
1ay5B           MLETETTKTYAGLPEFQKAMGELILGDGLKSETTATLATVGGTALRQALELARMANPDLRVFVSDPTWPN
3e77A           GISVLEMSHRSSDFLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGR------CADYVVTGAWS
3dydA           YNGYAPSIGFLSSREIASYYHCPEAAKDVILTSGCSQAIDLCLA--------VLANPGQNILVPRPGFSL
1djuA           GLTHYGPNIGLLELRIAEKLIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPT---------PAFV
3dydB           GKYNGYAPSISSREEIASYYHCPEAAKDVILTSGCSQAIDLCLA--------VLANPGQNILVPRPGFSL
3cq5B           IATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSM
3d6kB           KDGVDCRNYGGLLIRELWAEALGLPADLVVAQDGSSLNIFDLISWSYTWGNNDSSRPWSAEEKVKWLCPV
3cq4B           IATELDAVELRDELYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPS---------YS
2dkjA           KYAEGYPG---------------------ARYYGGCEVIDRVESLAIERAKA-LFGAAWANVQPHSGSQA
2aevA           ALYDLSGLSGGFLIDEKDKALLNTYIGSSYFAEKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKP
1d2fB           GVFGYSRWNDEFLAAIAHWFSTAIDSQTVVYGPSVIYMVSELIRQWSET---------GEGVVIHTPAYD
1bjoA           WNGLGT--------------------SVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRG
3d6kC           KDGVDCRNYGGLLADIRELWAEGLPADLVVAQDGSSLNIFDLISWSYTWGNNDS-------SRPWSAEEK
3bcxA           GWLTTGRFNDAFEKKLGEYLG----VPYVLTTTSGSSANLLALTLTSPKLGVRALKPGDEVITVAAGFPT
3cq4A           IATELRDAVELRDEYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQ--------PSYSM
3d6kD           KDGVDCRNYGGLLADIRELWAEGLPADLVVAQDGSSLNIFDLISWSYTWGNNDS------SRPWSAEEKV
1ecxA           KYGNPGIEANLHMEKAREKVVLGVSPSEIFFTSCATESINWILKTVAET-----FEKRKRTIITTPIEHK
3cq6A           IATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPS-YS
3dr7B           CMDTTWISSVGRFIEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE-------VIVPSLTYIA
2ch2A           NFHAELFRTMDEVKDGLRYIFQTENRATMCVSGSAHAGMEAMLSNLLEEGD--------RVLIAVNGIWA
1bw0A           QECNGTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVSGGSHGILMAITAICDAGDYALVPQPGFPH
1d2fA           GVFGYSRWKNDEAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGE---------GVVIHTPAYD
3cq5A           IATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALG-FQPSYS
3bb8A           GWLTTGRFNDAFEKKLGEYL----GVPYVLTTTSGSSANLLALTLTSPKLGVRALKPGDEVITVAAGFPT
1dkrA           QLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVALKRASAKTINIVYARQDRKS
1agxA           PSVNGVVITHDTMEETAFFLNLGSMRPSTALSADGPLNLYSAVALASSNEA----KNKGVMVLMNDSIFA
1bjnA           WNGLGTSV--------------------MEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRG
3bcxB           GWLTTGRFNDAFEKKLGEYL----GVPYVLTTTSGSSANLLALTLTSPKLGVRALKPGDEVITVAAGFPT
3b8xA           VLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAALFFTKKPRLKKGDEIIVPAVS--WS
3dr4B           CMDTTWISSVGRFIEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE-------VIVPSLTYIA
1b9iA           ALEQGQWWRMGGDESFEREFAAHHGAAHALAVTNGTHALELALQVMGVGPGTE--------VIVPAFTFI
1b9hA           ALEQGQWWRMGGDESFEREFAAHHGAAHALAVTNGTHALELALQVMGVGPGTE--------VIVPAFTFI
2bieB           FNDTQMLSHRSQSYLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVL--------TGSWS
3b8xB           VLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAALFFTKKPRLKKGDEIIVPAVSWSTT
2bhxB           FNDTQMLSHRSQSYLLRELLQIPNDYQILFLQGGASLQFTMLPM-------NLLTKGTIGNYVLTGSWSE
2a7vA           QCRGLELIASENFCSRAALEALGSCLN-NKYSEGVDEIELLCQRRALEAFDLDPAQWG--VNVQPYSGSP
1c4kA           DVALGDLLIHEGPAVAEKHAARVYNADKTFVLGGSSNANNTVTSALVSNGDLVLFDRNHKSVYNSALAMA
3caiA           SGASTVGAHPSARRSAAVLDAAREAPGGVVLGADRAVL----LSLLAEASSSRAGLGY-EVIVSRLDDEA
1bs0A           FGHVSGYSVV--HQALEEELAEWLGYSRALLFISGFAANQAVIAAMMA---------KEDRIAADRLSHA
2bieA           FNDTQMLSHRSQSYLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGT--------IGNYVLTGSWS
1djuB           GLTHYGPNIGLLELRIAEKLKKQNGKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPT--------PAFVS
1eg5A           YGNPNSAHGGIEAEKAREKVAKGVSPSEIFFTSCATESINWILK----TVAETFEKRKRTIITTPIEHKA
3bn1D           CMDTTWISSVGRFIEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE-------VIVPSLTYIA
2douB           ----------------------------------------------------------------------
1dfoA           KYYGGCEYVDIVEQLAIDRAKELFGADYAVQPHSGSQANFAVYTALLEP--------GDTVLGMNLAHGG
2c7tA           NRWAISGYWTSMERKFAKAFADFNGVPYCVPTTSGSTALMLALEALGIGEGDE-------VIVPSLTWIA
1bybA           NVF-------EDPDGLKEQLLQLRAAGDGVMVDVWWGIIELKGPKQYD-------WRAYRSLFQLVQECG
2c0rA           YQHTGMSIMMSHRGAVYEAVHNEAQARKVLFIQGGASTQFAMIPMNF------LKEGQTANYVMTGSWAS
3e77B           GISVLEMSHRSSDFLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGR------CADYVVTGAWS
1btcA           --------------------------GVVNVDNVFEDPDGLKEQLLQLRAPKQYDWRAYRSLFQLVQECG
1bw0B           QECNGTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNLCSGGSHGILMAITAICDAGDYALVPQPGFPH
2ch1A           NFHAELFRTMDEVKDGLRYIFQTENRATMCVSGSAHAGMEAMLSNLLEEGD--------RVLIAVNGIWA
3dr4D           CMDTTWISVGRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE-------VIVPSLTYIA
2bwpB           VGGTRNISTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRV-------LFPGLIIYSDSLNHA
3dr4A           CMDTTWISSVGRFIVFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE-------VIVPSLTYIA
1ay4A           --ETTKTYGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTALRQALELARMANPDLRVFVSDPTWPN
3bn1C           CMDTTWISSVGRFIEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE-------VIVPSLTYIA
2c81A           NRWAISGYWTSMERKFAKAFADFNGVPYCVPTTSGSTALMLALEALGIGEGDE-------VIVPSLTWIA
2e7jA           WPPIHD--------FIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDE--------NCHYS
1djeA           FGHVSGYSVV--HQALEEELAEWLGYSRALLFISGFAANQAVIAAMMA---------KEDRIAADRLSHA
2douA           ----------------------------------------------------------------------
3ca8B           TGRAEATILADIAHQFWHIPHEK-IWIEDQSTNCGENARFSIALLNQAVERVHTAIQDPTMQRRTMATFR
2bkwA           HTSPEFVSIFQRVLKNTRAVFKSAASQPFVLAGSGTLGWDIFASNFILSKAP-----NKNVLVVSTGTFS
3c3jC           VADRCQAILTSLG-DFSEGVFGYAPWKRIVYLGSGGLQGAARESALKVLELTA-----GKLAAFYDSPTG
3d1rA           RMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADN------LRNVAAALGKPL
1cj0A           RYYGGTEHIDELETLCQKRALQAYGLDPNVQPYSGSPANFAVYTALVEPHG--------RIMGLDLPDGG
2dqxA           YVMLPLGVVNDNVFEDPDGLKE----QLLQLRAAGVDGVMVDVRWGIIELKGPKQYDWRSLFQLVQECGL
3ca8A           TGRAEATILADIAHQFWHIPHEKIWIED-QSTNCGENARFSIALLNQAV------ERVHTAIVVQDPTMQ
2aeuA           YIGSSYFAEKVNEYGLKHLGG----DENDKCVGFNRTSSAILATIL------ALKPKK-VIHYLPELPGH
1cj0B           KYYGGTEHIDELETLCQKRALDPQCWGVNVQPYSGSPANFAVYTALVEPHG--------RIMGLDLPDGG
2cdmA           GNIGEGIGLDLTFSAPKSVSLQALVAGDAEIIKAHDRAVARTLEQAE----------------------A
2a8iB           DHGIPSCPPNITTRFSLAAFKRRKLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAEN
1cliB           ----------------------------------------------------------------------
3bn1A           CMDTTWISSVGRFIVFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE-------VIVPSLTYIA
3dr4C           CMDTTWISSVGRFIVFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPGDE--------VIVPSLTYI
1c8nA           -----------------------------TPIALAYTVQSLPLIA--------TQPA--WLGTIADNYSK
3a2bA           TGCAGSRFTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSC-------LMGRNDYILLDERD--HA
3brmA           --------------------------------------NAGALTIASILPGES-AYEKLEFLYSVETLIG
1e5eA           ESGYIYTRLGNPTVSLEGKIAFLEKTEACVATSSGMGAIAATV--------LTILKAGDHLISDECLYGC
1awiA           ----------------------------------------------------------------------
3blvH           TI--------------------------------------------------------------------
1e5eB           ESGYIYTRLGNPTVSLEGKIAFLEKTEACVATSSGMGAIAATVLTILKAGDHLISDE---------CLYG
2btwA           --------------------------------NLIGFNSNEGEKLL-------LTSRS-REDFFPLSQFV
3e6gD           ----------------------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
2cb1A           -----------------------------------------------------------EVVAAKGLFGQ
1c8fA           ------------------------------GISTGTFNNQTEFKFLENGWVEITASRLVHLNMPESENYK
1c8eA           ------------------------------GISTGTFNNQTEFKFLENGWVEITASRLVHLNMPESENY-
3d19E           --------------------VERSLNEIRFWSRIMKEH---SFFLRLGFRCEDT-----QLIEEANQFYR
3bh1C           ----------------------------------------------------CAIELVDGSIITGATSDL
3d19A           ----------------------------FWSRIMKEHSFFLRLGFRCE---------DTQLIEEANQFYR
3e6gA           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
1eghA           -------------------------PARKHIALVAHDHCKQMLMSWVE---------RHQPLLEQHVLYA
2ctzA           ----------------------------------------------------------------------
1bxgA           ----------------------------------------------------------------------
3blvD           ----------------------------------------------------------------------
3cogB           ----------------------------------------------------------------------
2b34A           LIDALSIPTIVTEQYPKGLLKEGLAENTPIFDKTKFSMCIPPTEDT------LKKVQN-VILVGIEAHVC
1b1xA           EAERDKYELLCPDNTRKPVDAFKECHLARVPSH-AVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLF
1ei7A           ----------------------------------------------------------------------
2bu3A           ------------------------------YCGVASIIVLNSLGINAYRVFTQDNFFSTKAV------IA


                         +         .         .         .         .         *         .:210
query           RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVK
3drdB           IPYVYRSESGDPDECRD-------------QCLRELAQLLEEHAALSIESMVQGASGMIVMPEGYLAGVR
3dodA           IPYVYRSESGDPDECRD-------------QCLRELAQLLEEHAALSIESMVQGASGMIVMPEGYLAGVR
3dodB           IPYVYRSESGDPDECRD-------------QCLRELAQLLEEHAALSIESMVQGASGMIVMPEGYLAGVR
2bylA           RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNAAFMVEPIQGEAGVVVPDPGYLMGVR
3du4A           DTIGAVSVGSIELFHHVYGPLMFESYKAPIPYVYRSESGDPDECRDQLRSMVQGASGMIVMPEGYLAGVR
2byjA           RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNAAFMVEPIQGEAGVVVPDPGYLMGVR
2cinA           RSGYTLSLTNTKPTITRFPKFDWPRIDAPYMRPEALRQARPHDIACFVAEPIQGEGGDRHFRPEFFAAMR
3bv0A           DTFLAMSICDPHGGMHSLWTDPRDYDPAYSAAFEAQLAQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLR
2eh6A           RTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLDEETAGIIIEVIQGEGGVNEASEDFLSKLQ
2e54A           RTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEPIQGESGIVPATKEFLEEAR
1dtyA           DTFGAMSVCDPDNSMHSLWKGYLPENLFAMVGFARLMAAHRHEIAAVIIPIVQGAGGMRMYHPEWLKRIR
2e7uA           HADGLLVEAGSGALTLGVPSSAGVPEEYAYNDPEGLREVLGEEIAAIIFEPVVGNAGVLVPT-EDFLKAL
3dxvA           CTVGSMAFSGLILLPYPDPYRPYRNDPTGDAITEKLAAVPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFA
1d7uA           RKGVGPAAVGSFAIPAPFTYRPRFERNGAYDAFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALK
1dgdA           MTGAAASATGSFAIPAPFTYRPRFERNGAYDAFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALK
3dxvB           CTVGSMAFSGHSVQADAAKADGLILLPYPTLLTEKLAAVPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFA
3bv0B           DTFLAMSICDPHGGMHSLWTDVLAAQVFAPQAFEAQLAQHAGELAAVVVPVVQGAGGMRFHDPRYLHDLR
3drdA           IPYVYRSESGD----------PDECRDQCLRELAQLLEEHHEEIAASIESMVQGASGMIVMPEGYLAGVR
3ei7A           YVDSSVIMGQTGQFNTDVQKYGNIYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAA-TREQLTQLV
2cfbA           -------------GCYHGHAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLR
3bs8A           HGDSLLIKAGSGVATLGLPDSPGVPEGIALESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLR
1asfA           HKSVFNSAGLEVREYAYYDA---ENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
2cstA           HNSVFMDAGFKDIRTYRYWDAA--KRGLDLQGLLDDMEKAPEFSIFILHACAHNPTGTDPT-PDEWKQIA
1ajsA           NHNGVFTTAGFKDIRSYRYWDTEKRGLDL-QGFLSDLENAPEFSIFVLHACAHNPTGTDPTP-EQWKQIA
2bwnD           ASMIEGIKRNAGPKRIF-------RHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
1c7nA           FFMAIKNQERKIIECELLEKDGYY-----TIDFQKLEKLSKDKNNKALLFCSPHNPVGRVWKKDELQKIK
3eiaA           YVDSSVIMGQTGQFNTDVQKYGNIYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAA-TREQLTQLV
1aamA           HKSVFNSAGLEVRE---YAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTG-IDPTLEQWQTLA
3clzB           VKYWPEKGKSGFLVWRYLLR--------RDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEA---------
2dgmB           VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEA---CDENTIGVVPTFGVTYTGNYPQPLHDALDKF
2aatA           HKSVFNSAGLEVRE---YAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTL-EQWQTLA
3ei9B           YVDSSVIMGQTGQFNTDVQKYGNIEYRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATR-EQLTQLV
1bjwA           SYPEMVRFAGGVVVEVETLPEEGFVP-----DPERVRRAITPRTKALVVNSPNNPTGAVYPK-EVLEALA
1arhA           HKSVFNSAGLEVREYAYYDA---ENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
3dc1D           DNPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPK-FLYTVPNGNNPTGNSLTSERKKEIY
2egyB           AIQAFRLQGPRFLTVP-------AGEEGPDLDALEEVLKRERPR-FLYLIPSFQNPTGGLTPLPARKRLL
1aiaA           HKSVFNSAGLEVREY---AYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
1bkgA           YPEMVRFAGGVVVEVETLPE------EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYP-KEVLEALA
1ejiA           LTHGFTDKKKISATSIFFESPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCYSR-----NLDYARLR
3ei6A           YVDSSVIMGQTGQF-NTDVQKYGNIEYMRCTPENGFFLSTVGRTDIIFFCSPNNPTGAAA-TREQLTQLV
1b4xA           HKSVFNSAGLEVRE---YAYYDAENHTLDFDALINSLNEAQAGDVVLFHGSCHNPTGIDPTL-EQWQTLA
3clzD           VKYWPEKGKS--------GFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEA---------
2cy8A           --------------------------PDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVSDSFLREGA
1czcA           HKSVFNSAGLEVREY---AYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
2egyD           QAFRLQGPRFLTVPA-----------GEEGPDLDALEEVLKRERRFLYLIPSFQNPTGGLTPLPARKRLL
3ecdB           NGAVMLALAKPGDTVLGMSLFNALQYGVSLIDYDQVEALAQQHKPSLIIAGFSAYPRKLD-----FARFR
3ei7B           YVDSSVIMGQTGQFNTDVQKYGNIYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATRE-QLTQLV
2egyC           AIQAFRLQGPRFLTVPAGEE-------GPDLDALEEVLKRERPR-FLYLIPSFQNPTGGLTPLPARKRLL
3ei6B           YVDSSVIMGQTGQFNTDVQKYGNIYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATR-EQLTQLV
2c44A           TTQGHSQINGCTVRNVYIKEAFDTGVRYDFKDLEGLERGIEEVGPYIVATITSNSAGGQPVSLANLKAMY
2bwnE           HASMIEGIKRNAGPKRIFRHNDV------AHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICD---
1ariA           HKSVFNSAGLEVREY---AYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
1akaA           NHTPIFRDAGLQLQAYRYY--DPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDP-RQEQWKELA
3aatA           HKSVFNSAGLEVREYAYYDAENHTLDFDALINSLN----EAQAGDVVLFHGCCHNPTGIDPTLEQWQTLA
2bwoD           MIEGIKRNAGPKRIFRHNDVAH---------LRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
3ei8A           YVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPEGFFPDLSTVGRTDIIFFCSPNNPTGAAATR-EQLTQLV
2dgmA           VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEA---CDENTIGVVPTFGVTYTGNYPQPLHDALDKF
2d61A           HKSVFNSAGLEVREY---AYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
1aheA           HKSVFNSAGLEVREY---AYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
7aatA           NHTPIFRDAGLQLQAYRYYDPKTC-----SLDFTGAMEDISKIPEIILLHACAHNPTGVDPRQEQWKELA
1b5oA           SYPEMVRFAGGVVVEVETLP-----EEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKE-VLEALA
2dgkC           NLVCGPVQICWHKFARYWDVELREIPMRPFMDPKRMIEACDENTIGVVPTFGVTYTGNYPQPLHDALDKF
1bqaA           HKSVFNSAGLEVRE---YAYYDAENHTLDFDALINSLNEAQAGDV-VLFHGCCHNATGIDPTLEQWQTLA
3ei9A           YVDSSVIMGQTGQFNTDVQKYGNIEYRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATR-EQLTQLV
1b5pA           SYPEMVRFAGGVVVEVETLPEEGFVPD-----PERVRRAITPRTKALVVNSPNNPTGAVYPK-EVLEALA
2d64A           HKSVFNSAGLEVREY---AYYDAENHTLDFDALINSLNEAQAGDV-VLFHGCCHNPTGIDPTLEQWQTLA
2dr1B           KRYKEVVESNGRKAV------VLEYEPGKAVKPEDLDDALNPDVEAVTITYNETSTGVLN----PLPELA
3e2fA           MVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTR-QELQVIA
2dgmE           ------VQICWHKFARYWDVELREIPMRLFMDPKRMIEACDENTIGVVPTFGVTYTGNYPQPLHDALDKF
2d5yA           HKSVFNSAGLEVREYAYYDA---ENHTLDFDALINSLNEAQAGD-VVLFHGCCHNPTGIDPTLEQWQTLA
3dc1A           QSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPFLYTVPNGNNPTGNSLTSERKKEIY
1arsA           HKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGD----VVLFHGCCHNPTGIDPTLEQWQTLA
2dgmC           VQICWHKFARYWDVELREIPMRPGQ---LFMDPKRMIEACDENTIGVVPTFGVTYTGNYPQPLHDALDKF
1asbA           HKSVFNSAGLEVRE---YAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDP-TLEQWQTLA
3bcbA           SCFKSMVTAGFEPVVIENVLEGDELRT----DLKAVEAKIQELGPEHILCLHSTTACFAPRVPDRLEELA
3dc1B           QSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTKFLYTVPNGNNPTGNSLTSERKKEIY
3ecdA           ANGAVMLALAKPGDTVLGMSLFNALQYGVSRDYDQVEALAQQHKPSLIIAGFSAYPRKLD-----FARFR
3eiaB           YVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLV
1ay4B           HVSIMNFMGLPVQTY---RYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANL-TLDQWAEIA
3ecdD           ANGAVMLALAKPGDTVLGMSLFNALQYGVSIDYDQVEALAQQHKPSLIIAGFSAYPRKLD-----FARFR
1eg5B           VLETKYLSKGFKVKYVPVDS----RGVVKLEELEKLVD----EDTFLVSIAANNEVGTIQ----PVEDVT
1ax4A           TTAAHVELNGCKAINIVTEKAFDSETYDDWFDIKKLKENIAQHGVAIVSTVTCNSAGGQPVSMSNLKEVY
3e2yA           AGAVPVFIPLRSKPTDGMKWTSSDWTF----DPRELESKFSSKTKAIILNTPHNPLGKVY-TRQELQVIA
1ajrA           NHNGVFTTAGFKDIRSYRYWDTEKRGL----DLQGFLSDLENAPSIFVLHACAHNPTGTDPTPEQWKQIA
2c44B           TTQGHSQINGCTVRNVYIKEAFDTGVRYDFKDLEGLERGIEEVVPYIVATITSNSAGGQPVSLANLKAMY
2bwpA           SMIEGIKRNAGPKRIFRHND--------VAHLRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
5bj4A           YPEMVRFAGGVVVEVETLPE------EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPK-EVLEALA
5bj3A           YPEMVRFAGGVVVEVETLPEEG------FVPDPERVRRAITPRTKALVVNSPNNPTGAVYPK-EVLEALA
1bqdA           HKSVFNSAGLEVREYAYYDAENHT---LDFDALINSLNEAQAGD-VVLFHGCCHNATGIDPTLEQWQTLA
1bj4A           HLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLARLFHPKLIIAGTSCYSRNLE-----YARLR
2bwoA           SMIEGIKRNAGPKRIFRHND--------VAHLRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
3ecdC           NGAVMLALAKPGDTVLGMSLFNALQYGVSLIDYDQVEALAQQHKPSLIIAGFSAYPRKLD-----FARFR
3e9kA           DHYAIESQLQLHGLNIEESMRMEGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQH----FNIPAIT
1b8gB           FDRDLKWRTGVEIVPIHCTSSNGFQIETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRN-ELYLLL
3b46A           IELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVF-TREELTTLG
3clzA           VKYWPEKGKSGFLVWRYLLRRDDDEPGPWT--------KEGKDRIKKLGLTMQYPEGYLEA---------
1ecxB           AVLETMKYLSMKGFKVKYVPVDSRGVV----KLEELEKLVDEDTFLVSIMAANNEVGTIQ----PVEDVT
2bwnA           HASMIEGIKRNAGPKRIFRH------NDVAHLRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
3b46B           IELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFT-REELTTLG
1dfoB           HLTHGSPVNFS---GKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVV-----DWAKMR
3d6kA           KWLCPVPGYDRHFTITEHFGFEINVPTDEGPDGVVRELVKDPQVKGWTVPVFGNPTGVTFSE-QTCRELA
2c44C           TTQGHSQINGCTVRNVYIKEAFDTGVRYDFKDLEGLERGIEEVGPYIVATITSNSAGGQPVSLANLKAMY
1c7gA           ATFVDIVRDEAHDAS---LNLPFKGDIDLNKLATLIKEKGAENIAYICLAVTVNLAGGQPVSMANMRAVH
2bwnB           SMIEGIKRNAGPKRIF--------RHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
2dgkA           NLVCGPVQICWHKFARYWDVELREIPMRPGQDPKRMIEACDENTIGVVPTFGVTYTGNYPQPLHDALDKF
1b8gA           FDRDLKWRTGVEIVPIHCTSSNGFQIETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTM-TRNELYLLL
3bc8A           SCFKSMVTAGFEPVVIENVLEGDELRT----DLKAVEAKIQELGPEHILCLHSTTACFAPRVPDRLEELA
3cbfA           GAIQAFRLQGPRFLTVPAGE---EGPDLDALEEVLKRERP----RFLYLIPSFQNPTGGLTPLPARKRLL
2d66A           HKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEA----QAGDVVLFHGCCHNPTGIDPTLEQWQTLA
3e77C           AKAAEEAKKFGTINIVHPKL------GSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDF--------
2bwoB           SMIEGIKRNAGPKRIFRHND--------VAHLRELIAADDPAAPKLIAFESVYSMDGDFG----PIKEIC
3bcaA           SCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCLHSTTACFAPRVPD----RLEELA
3dwkA           DGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVWEDAKKIDLKANLVNRTPEERQNDSEYNSYVNFVK
3dzzB           FYSVIEGN-----GRRVISSDLIYENSKYSVNWADLEEKLATPSVRVFCNPHNPIGYAWS--EEEVKRIA
2dr1A           KRYKEVVES----NGRKAVVLEYEPGKAVKPEDLDDALRKNPDVEAVTITYNETSTGVLN----PLPELA
2bhgA           KTVAICCATGVVPRHLFAEKYDKILDGRATDSDYRVFE-FEIKVKGQDLSDAALVLHRGNKVRDITKHFR
3dzzA           FYSVIEGNGRRVIS-----SDLIYENSKYSVNWADLEEKLATPSVRVFCNPHNPIGYAWSEE--EVKRIA
1c0nA           NIVPWQMLCARVGAELRVIPLNPDGTL----QLETLPTLFDAATRLLAITHVSNVLGTEN----PLAEMI
1ay5B           HVSIMNFMGLPVQTYRYFDAETRGV---DFEGMKADLAAAKKGDMVLL-HGCCHNPTGANLTLDQWAEIA
3e77A           AKAAEEAKKFGTINIVHPKL------GSYTKIPDPSTWNLNPDASYVYYCANETV---------HGVEFD
3dydA           YKTLAESMGIEVKLYNLLPE------KSWEIDLKQLEYLIDEKTACLIVNNPSNPCG-SVFSKRHLQKIL
1djuA           SYAPAVILAGGKPVEVPTYEEDEFR-----LNVDELKKYVTDKTRALI-INSPCNPTGAVLTKKDLEEIA
3dydB           YKTLAESMGIEVKLYNLLPE------KSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVF-SKRHLQKIL
3cq5B           HPILAKGTHTEFIAVSRGAD-------FRIDMDVALEEIRAKQP----DIVFVTTPNNPTGDVTSLDDVE
3d6kB           PGYDR------HFTITEHFGFEINVPTDEGPDGVVRELVKDPQVKGWTVPVFGNPTGVTFSE-QTCRELA
3cq4B           MHPILAKGTHTEFIAVSRGA------DFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVT----SLDDVE
2dkjA           NMAVYMALMEPGDTLMGMDLAFSGKLYKVVSTELIDLEEVRRLALEHRP-KVIVAGASAYPRFWDFKAFR
2aevA           KKVIHYLPELPGHPSIERSCKIVNAKYFESDKVGEILNKIDKDTLVII--TGSTMDLKVIEL-ENFKKVI
1d2fB           AFYKAIEGNQRTVMPVALEKQADGWF----CDMGKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMA
1bjoA           QFAAVPLNILGDKTTADYVDAGCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDE
3d6kC           VKWLCPVPGYDR-HFTITEHFGFEINVPTDEGPDGVVREKDPQVKGWTVPVFGNPTGVTFS-EQTCRELA
3bcxA           TVNPTIQNGLIPVF----------VDVDIPTYNVNASLIEAAVSDKT----KAIMIAHTLGNLFDLAEVR
3cq4A           HPILAKGTHTEFIAV-----------SRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVE
3d6kD           KWLCPVPGYDRHFTITEHFGFEINVPTDEGPDGVVRELVKDPQVKGWTVPVFGNPTGVTFSE-QTCRELA
1ecxA           AVLETMKYLSMKGFKVKYVPVDSRGVV----KLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDVTRIVK
3cq6A           MHPILAKGTHTEFIAVSRGADFRID------MDVALEEIRAKQP----DIVFVTTPNNPTGDVTSLDDVE
3dr7B           SANSVTYCGATPVLVDNDPR-------TFNLDAAKLEALITPRTKAIMPVHLYGQICDMDP-------IL
2ch2A           ERAVEMSERYGADVRTIEGPPDRPF-----SLETLARAIELHQPKCLFLTHGDSSSGLL----QPLEGVG
1bw0A           -YETVCKAYGIGMHFYNCRP-----ENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFS-RKHVEDIV
1d2fA           AFYKAIEGNQRTVMPVALEKQADGW----FCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMA
3cq5A           MHPILAKGTHTEFIAVSRGA------DFRIDMDVALEEIRAKQPD----IVFVTTPNNPTGDVTSLDDVE
3bb8A           TVN----------PTIQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNL----FDLAEVR
1dkrA           REPITAKLFANLLETAGATRVIQGFFDIPIDHLMGVPILGKNLEDIVIVSP--DHGGVTR-ARKLADRLK
1agxA           ARDVTKGINIHTHAFRSSVKKHTNNSEFNNMMPDAYQAFAKAGVKAI----IHAGTGNGSMANYLVPEVR
1bjnA           QFAAVPLNILGDKTTADYVDAYCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDE
3bcxB           TVNPTIQNGLIPVFVDV-------DIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLF-------DLAEVR
3b8xA           TTYYPLQQYGLRVKFVDIDI------NTLNIDIESLKEAVTDSTKAILTVNLLGNPNNFDEINK------
3dr4B           SANSVTYCGATPVLVDNDPR-------TFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEV-----
1b9iA           SSSQAAQRLGAVTVPVDVD------AATYNLDPEAVAAAVTPRT-------KVIMPVHMAGLMADMDALA
1b9hA           SSSQAAQRLGAVTVPVDVD------AATYNLDPEAVAAAVTPRTKVIM-------PVHMAGLMADMDALA
2bieB           EKALKEAKLLGETH----------IAASTKANSYQ----SIPDFSEFQLNENDAYLHITSNNTIYGTQYQ
3b8xB           YYPL--------QQYGLRVKFVDIDINTLNIDIESLKEAVTDSTKAILTVNLLGNPNNFDE-------IN
2bhxB           KALKEAKLLG---------------ETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQ
2a7vA           ANLAVYTALLQPHDRI---MGYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLID-----YARMR
1c4kA           GGRPVYLQTNRNPYGFIGGIYDSDFDEKKIRELVDPERAKWKRPFRLAVIQLGTYDGTIYNAHEVVK---
3caiA           NIAPWLRAAHRYGAKVKWAEVDIETGEL---PTWQWESLISKSTRLVAVNSASGTLGGVT----DLRAMT
1bs0A           SLLEAASLSPSQLRR---------FAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDS----APLAEIQ
2bieA           EKALKEAKLLGETHIAASTKA------NSYQSIPDFS--------EFQLNENDAYLHITSNNTIYGTQYQ
1djuB           YAPAVILAGGKPV------EVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKK-DLEEIA
1eg5A           VLETKYLSKGFKVKYVPVDS----RGVVKLEELEKLVD----EDTFLVSIAANNEVGTIQPVEDVTRIVK
3bn1D           SANSVTYCGATPVLVD-------NDPRTFNLDAAKLEALITPRTKAIMPVHLYGQ-------ICDMDPIL
2douB           ----------------SLRTFLIPLREDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADW-GYFEEAL
1dfoA           HLTHGSPVNFS---GKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVD-----WAKMR
2c7tA           TATAVLNVNALPVF----------VDVEADTYCIDPQLIKSAITDKTKAIIPVHLFGSMA----NMDEIN
1bybA           LTLQAIMSFHQCGGNVGDIPQWVLDIGESNHDIFYTNRSGEYLTVGVDNEPIFHGRTAIEIYSDYMKSFR
2c0rA           KALKE---------------AKLIGDTHVAASSEASNYMTLPKLQEIQLQDNAAYLHLTSNETIEGAQFK
3e77B           AKAAEEAKKFGTINIVHPKL--GSY----TKIPDPSTWNLNPDASYVYYCANETVHGVEFDF--------
1btcA           LTLQAIMSFHQCGGNVGDIPQWVLDIGESNHDIFYTNRSGTRNTVGVDNEPIFHGRTAIEIYSDYMKSFR
1bw0B           -YETVCKAYGIGMHFYNCRP-----ENDWEADLDEIRRLKDDKTKL-LIVTNPSNPCGSNFSRKHVEDIV
2ch1A           ERAVEMSERYGADVRT-IEGPPDRP----FSLETLARAIELHQPKCLFLTHGDSSSGLL----QPLEGVG
3dr4D           SANSVTYCGATPVLVDNDPRTFN--------------LDAAKLEALITPRTKAIMPVHLYGQICDMDPIL
2bwpB           SMIEGIKRNAGPKRI---------FRHNDVAHLRELIAADDPAAPKIAFESVYSMDGDF----GPIKEIC
3dr4A           SANSVTYCGATPVLVDN-------DPRTFNLDAAKLEALITPRTKAIMPVHLYGQ-------ICDMDPIL
1ay4A           HVSIMNFMGLPVQTYRYFD--AETRGVDFEGMKADLAA--AKKGDMVLLHGCCHNPTGANLTLDQWAEIA
3bn1C           SANSVTYCGATPVLVD-------NDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDP-------IL
2c81A           TATAVLNVNALPVFVD----------VEADTYCIDPQLIKSAITD----KTKAIIPVHLFGSMANMDEIN
2e7jA           SYVAAERAGLNIA------LVPKTDYPDYAITPENFAQTIEETKRGEVVLALITYPDGNYGNLPDVKKIA
1djeA           SLLEAASLSPSQLRR---------FAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDS----APLAEIQ
2douA           ----------------SLRTFLIPLREDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADW-GYFEEAL
3ca8B           RMTGDNPDAPRWLSYPGFVPQLGNNADLLTGELPRLRDDSDGYGPIHAWQTLKHDAVLIEA---------
2bkwA           DRFADCLRSYGAQVD----VVRPLKIGESVPLELITEKLSQNSYGAVTVTHVDTSTAVLSDLKAISQAIK
3c3jC           FRHGPKSLVDDETLVVVFVSSHPYTRQYDLDLLAELRRDNQARVIAIAAESSDIVAAILPPSRHFIDVEQ
3d1rA           SELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDV-AASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRA
1cj0A           HLTHGFMTDKKKISATSIFFESMAYKVNPDTDYDRLEENARLFHPKLIIAGTSCYSRNLD-----YGRLR
2dqxA           TLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESTNRSGTREYLTVGVDNEPIFHGRTAIEIYSDYMKSFR
3ca8A           RMTGDNPDAPRWLSYPGFVPQLGADSVIFINQLQGLWPVERYLPAEVIWQTLKHDAVLIEA---------
2aeuA           -------------PSIERSCKIVNAKYFESDKVGEILNKIDKDTLVIIGSTMDLKVIEL----ENFKKVI
1cj0B           HLTHGFMTDKKKISATSIFFESMAYKVNPDTDYDRLEENARLFHPKLIIAGTSCYSRNL-----DYGRLR
2cdmA           RAQARQKIQGKTRIETTGNLVIGKFRHETSRERDPQLHTHAVILNTKRSDGQWRALKNDE----IVKATR
2a8iB           TGAHNPYSTAVSLVRTILARECSHALQAEDAHQALLETQNKFISSPFLASEDGVLGGVIVLRSCRCSAEP
1cliB           ---------------------------MCVNDLVVQGAEPLFFLDYYATGKLD-----VDTASAVISGIA
3bn1A           SANSVTYCGATPVLVDN-------DPRTFNLDAAKLEALITPRTKAIMPVHLYGQ-------ICDMDPIL
3dr4C           ASANSVTYCGATPVLVDNDP------RTFNLDAAKLEALITPRTKAIMPVHLYGQ-------ICDMDPIL
1c8nA           WRWVSLRIIY---SPKCPTTTSGTVAM----CLSYDRNDVAPGSRVQLSQTYKAINFPPYAG-YDGAAIL
3a2bA           SIIDGSRLSFSKVIK---------YGHNNMEDLRAKLSRLPEDSAKLIC--TDGEGDIVN-----LPELT
3brmA           KRPRIHEEVFRSEWETAHRNRALATNFLEAEVEETLEVYLKTEDIALIGLILA-HDGYHPIRH------E
1e5eA           THALFEHALTKFGIQVD---------FINTAIPGEVKKHMKPNTKIVYFETPANPTLKIIDMERVCK---
1awiA           --------------------------------------------------------------NAYIDNMA
3blvH           ----------------------------------------------------------------------
1e5eB           CTHALFEHALTKFGIQ--------VDFINTAIPGEVKKHMKPNTKIVYFETPANPTLKIIDMERV----C
2btwA           -TQVNQAYCGVASIIVLNSLGINAPETAQYSPYRVFTQDNFFSNEKTKAVIAPEVVARQ----GTLDELG
3e6gD           --------------------------FVDLTDPAAFKAAIRADTKMVWIETP----TNPMLKLVDIAAIA
3e6gB           --------------------------FVDLTDPAAFKAAIRADTKMVWIETP----TNPMLKLVDIAAIA
2cb1A           TIGLFGQVLSLMGVTVRYVDP----------EPEAVREALSAKTRAVFVETVANPALLVPD----LEALA
1c8fA           -------------RVVVNNMDKTAVKGNMALEIVTPWSLVDANAWGVWFNPGD-----------------
1c8eA           -------KRVVVNNMDKTAVKGNMALDDIHVEIVTPWSLVDANAWGVW----------------------
3d19E           LFEHIEQIAHSY------------TNETDPEQIKRFNAEVQQAATNIW--GFKR-------KILGLILTC
3bh1C           LGCSSSMLLNALKHLAGIDD--AIHLL----SPESIEPIQTLKTVHLGSSNPRLHTDEV----LIALSVS
3d19A           LFEHIEQIAHSY------------TNETDPEQIKRFNAEVQQAATNIW--GFKR-------KILGLILTC
3e6gA           --------------------------FVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVD----IAAIA
1dy2A           -----------------------------QCFQQARAAGLLSTFRAFLSSHLQD-----------LSTVV
1eghA           TGTTGNLISRATGMNVNAMLSGPM-----GGDQQVGALISEGKIDVLIFFWDPLNAVP---HDPDVKALL
2ctzA           -------------------------------RPEEFLALTDEKTRAWWVESIGNPALNIP----DLEALA
1bxgA           ------------------------STPCDVFAPCAMGGVITTEVARTLDCSVVAGAANNVIAD---EAAS
3blvD           ----------------------------------------------------------------------
3cogB           -------------------------------KIKLLEAAITPETKLVWIETPTNPTQKVIDIE---GCAH
2b34A           -----VLQTTYDLLERG------LNVHVVSRSHTDRHFAFKQMEQAGAILTTSEATILGLVGGSDHP---
1b1xA           GSTPGEQDLLFKDSALGFVRIPSQGLYLGANYLTATQNLTAAEVAARRERVVWCAVGPEEERKC-----K
1ei7A           -------------------------------LVTALLGAFDTRNRIIEVENQANPTAETLDATRRVDDAT
2bu3A           PEVVARQGTLDELGRLIASYGVKVKVNHASDFRKQVAENLKQDGNFVIVNYLQERGGHISPLAAYNEQLI


                         .         .         .         +         .         .         .:280
query           QLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHAS
3drdB           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
3dodA           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
3dodB           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
2bylA           ELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGLYPVSAVLCDDDIMLTIKPGEHFS
3du4A           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFKTFFHGH
2byjA           ELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALGGLYPVSAVLCDDDIMLTIKPGEHGS
2cinA           ELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVEVADNVFAVPSRLNS
3bv0A           DICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYSLAATLCTADVAHTIS---AGP
2eh6A           EICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGSHGS
2e54A           KLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNER-ANVLEPGDHGT
1dtyA           KICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGTMTLSATLTTREVAETISDGMHGP
2e7uA           HEAKAYGVLLIADEVMTGFRLAFGGATELLGLK-PDLVTLGKILGGGLPAAAYAGRREIMEKVGPVYQAG
3dxvA           DICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCA-SAFAMQ
1d7uA           RKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEEHELGYLFYT
1dgdA           RKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHGYLFYT
3dxvB           DICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEI-LDCASAFAMQ
3bv0B           DICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGYLSLAATLCTADVAHTIS---AGP
3drdA           ELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGYLPIAVTFATEDIYKAFYDFFHGH
3ei7A           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVASFSKYAGTGVRLGWTVIPKKLLYSDNRIICTC
2cfbA           ELTKQYGALLVFDEVMTG-FRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAP--AGP
3bs8A           DITEQYGSLLIFDEVMTGFRVDYNCAQGYFG-VTPDLTCLGKVIGGGLPVGAYGGKAEQIAPSGPIYQAG
1asfA           QLSVEKGWLPLFDFAFQGFARGLERAFAAMHKELIVASSYSKNFGYNERVGACTLVAADSETVSQMKAAI
2cstA           AVMKRRCLFPFFDSAYQGFASGSLDKDAWAVRYFVSAQSFSKNFLYNERVGNLSVVGKDERVLSQMEKIV
1ajsA           SVMKRRFLFPFFDSAYQGFASGNLEKDAWAIFELFCAQSFSKNFGLNERVGNLTVVAKELRVLSQMQKIV
2bwnD           DIAEEFGALTYIDEVHAVGMYGPRAGVAERDGLMHRIDIFNGTLAAYGVFGGYIAASAVDAVRSYAPGFI
1c7nA           DIVLKSDLMLWSDEIHFDLIMPGYSIDEQLADKTITFTAPSKTFNIGMGMSNIIIKNPDIREFTKSRDAT
3eiaA           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVASFSQYAGTGVRLGWTVIPKKLLYSFNRIICTC
1aamA           QLSVEKGWLPLFDFAYQGFARGLERAFAAMHKELIVASSYSKNFGLYNERVGACTLETVDRAFSQMKAAI
3clzB           ----------------------------------------------------------------------
2dgmB           QADTGIDIDMHIDAASGGFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEGGQIGTFAINFS
2aatA           QLSVEKGWLPLFDFAYQGFARGLERAFAAMHKELIVASSYSANFGYNERVGACTLVAADDRAFSQMKAAI
3ei9B           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEEEVAMETASFSNYAFTGVRLGWTVIPKKLLYSDNRIICTC
1bjwA           RLAVEHDFYLVSDEIYEHLLYEGEHFSPRVAPEHTLTVNGAAAFMTGWRIGYACGPKEVIKAMASVSSQS
1arhA           QLSVEKGWLPLFDFARQGFARGLEEAFAAMHKELIVASSYSKNFGLYNERVGACTLETVDRAFSQMKAAI
3dc1D           ELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVDSFSIISSGLRIGFLTGPKPLIERVILHIQVS
2egyB           QMVMERGLVVVEDDAYRELYFGEARLPSLFEPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGA
1aiaA           QLSVEKGWLPLFDFAYQGFARGLEEAFAAMHKELIVASSYSHNFGLYNERVGACTLETVDRAFSQMKAAI
1bkgA           RLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTAAKAFAMTGWRIGYACGPKEVIKAMASVSSQS
1ejiA           KIADDNGAYLADAHISGLVAAGVVPSPFEHCLRGCRAGIFYRKGVRVDPKTGKETYYELESLINSAVFPG
3ei6A           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEETASFSKYAGTGVRLGWTVIPKKLLYSDNRIICTC
1b4xA           QLSVEKGWLPLFDFAYQGFARGLEEDAEGLHKELIVASSYSKNFLYNERVGACTLVAADSETVSQMKAAI
3clzD           ----------------------------------------------------------------------
2cy8A           ELARQYGALFILDEVISG-FRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVL----SRG
1czcA           QLSVEKGWLPLFDFAYQGFARGLEEDAAAMHKELIVASSYSKNFGLYNERVGTCTLETVDRAFSQMKAAI
2egyD           QMVMERGLVVVEDDAYRELYFGEALAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGA
3ecdB           AIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPG
3ei7B           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVASFSKYAFTGVRLGWTVIPKKLLYSDNRIICTC
2egyC           QMVMERGLVVVEDDAYRELYFGEARLPSLFEPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGA
3ei6B           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEETASFSKYAGTGVRLGWTVIPKKLLYSDNRIICTC
2c44A           SIAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTDMLAMSAKKDAMVPMGGFDVYTECRTLCVVQEGFP
2bwnE           -IAEEFGALTYIDEVHAVGMYGPRGAGVARDGLMHRIDIFNGTLAAYGVFGGYIAASAVDAVRSYAPGFI
1ariA           QLSVEKGWLPLFDFAYQGFARGLERAFAAMHKELIVASSYSKNFGLNERVGACTLVAADDRAFSQMKAAI
1akaA           SVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFILSQSYAHNMGLYGERAGAFTVEEAKRVESQLKILI
3aatA           QLSVEKGWLPLFDFAYQGFARGLEEAFAAMHKELIVASSYSKNGLYNERVGACTLVAADSETVSQMKAAI
2bwoD           DIAEEFGALTYIDEVHAVGMYGPGAGVAERDGLMHRIDIFNGTLAKAYGVIAASARMVDAVRSYAPGFIF
3ei8A           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEETASFSNYAGTGVRLGWTVIPKKLLYSDNRIICTC
2dgmA           QADTGIDIDMHIDAASGGFLAPFVVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDLGGQIGTFAINFS
2d61A           QLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAVASSYSKNFLYNERVGACTLVAADSETVSQMKAAI
1aheA           QLSVEKGWLPLFDFAYQGFARGLERAFAAMHKELIVASSYSKNFGLYNERVGACTLETVDRAFSQMKAAI
7aatA           SVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIESQSYAKNMGYGERAGAFTVICRDAEEESQLKILI
1b5oA           RLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNKAFAMTGWRIGYACGPKEVIKAMASVSSQS
2dgkC           QADTGIDIDMHIDAASGGFLAPFVAPDIRLPRVKSISASGHKFGLAPLGCGWVIWRDEGGQIGTFAINFS
1bqaA           QLSVEKGWLPLFDFAYQGFARGLELRAFAAMHKELIVASSYSNFGLNERVGACTLVAADSETVSQMKAAI
3ei9A           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIEVAMETASFSNYAGTGVRLGWTVIPKKLLYSDNRIICTC
1b5pA           RLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTAAKAFAMTGWRIGYACGPKEVIKAMASVSRQS
2d64A           QLSVEKGWLPLFDFAYQGFARGLEEAFAAMHKELIVASSYSKNFGLYNERVGACTLETVDRAFSQMKAAI
2dr1B           KVAKEHDKLVFVDAVSAMGGADIKF---DKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMKEST
3e2fA           DLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWIGSAGTFSVTGWKLGWSIGPAHLIKHLQTVYTCA
2dgmE           QADTGIDIDMHIDAASGGFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDLGGQIGTFAINFS
2d5yA           QLSVEKGWLPLFDFAYQGFARGLEEDAEGLHKELIVASSYSKNFLYNERVGACTLVAADDRAFSQMKAAI
3dc1A           ELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVDSFSIISSGLRIGFLTGPKPLIERVILHIQVS
1arsA           QLSVEKGWLPLFDFAYQGFARGLEEAFAAMHKELIVASSYSKNFLYNERVGACTLVAADSETVSQMKAAI
2dgmC           QADTGIDIDMHIDAASGGFLAPFVAPDIRLPRVKSISASGHKFGLAPLGCGWVIWRDLGGQIGTFAINFS
1asbA           QLSVEKGWLPLFAFAYQGFARGLERAFAAMHKELIVASSYSKNGLYNERVGACTLVAADSETVSQMKAAI
3bcbA           VICANYDIPHVVNNAYGLQSSKCMHLIQQGARVGAFVQSLDNFMVPVGGAIIAGFNEPFIQDISKMYPGR
3dc1B           ELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVDSFSIISSGLRIGFLTGPKPLIERVILHIQVS
3ecdA           AIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAK-KINSAVFG
3eiaB           EFAKKNGSIIVYDSAYAMYMSDDNPRSIFEEEVAMETASFSQYAGFGVRLGWTVIPKKLLYSDNRIICTC
1ay4B           SILEKTGALPLIDLAYQGFGDGLEELIASRIPEVLIAASCSKNFGIRERTGCLLALCADAATRGAMAFLN
3ecdD           AIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAK--KINSAVG
1eg5B           RIVKKKNKETLVHVDAVQ-TIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRKGVLIHGGGQERGLR
1ax4A           EIAKQHGIFVVMDSARFCEARDPKYKNATIKEVIFDMYKYADALTLLNIGGLVAIRDNEEIFTLARQRCT
3e2yA           DLCVKHDTLCISDEVYEWLVYTGHATLPGMWERTITIGSAGKTFSTGWKLGWSIGPAHLIKHLQTVQQNS
1ajrA           SVMKRRFLFPFFDSAYQGFASGNLEKDAWAIRYFVCAQSFSNFGLYNERVGNLTVVAKEPDSISQMQKIV
2c44B           SIAKKYDIPVVMDSARFAENAYFIKQREAEYKDWTIAMSAKKDAMVPMGGLLCMKDDSFFDLCVVQEGFP
2bwpA           DIAEEFGALTYIDEVHAVGMYGRGAGVAERDGLMHRIDIFNGTLAKAYVFGGYIAASARMVDAVRSYFIF
5bj4A           RLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTAAKAFAMTGWRIGYACGPKEVIKAMASVSRQS
5bj3A           RLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTAAKAFAMTGWRIGYACGPKEVIKAMASVSRQS
1bqdA           QLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAIVASSYSNFGLYNERVGACTLVETVDRAFSQMKAAI
1bj4A           KIADENGAYLMADMAHISGLVAAGVVPSTLRGCRAGMIFYRKGVKSVDPATGKEILYNLESLINSAVFPG
2bwoA           DIAEEFGALTYIDEVHAVGMYGPRGAGVARDGLMHRIDIFNGTLAAYGVFGGYIAASMVDAVRSYAPGFI
3ecdC           AIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAK--KINSAVG
3e9kA           KAGQAKGCYVGFDLAHAVGNVELYLHDWGVAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGFR
1b8gB           SFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKHVVYSLSKDLGPGFRVGAIYSNDDMVVAAATKMSSF
3b46A           NICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLSAGSFAATGWRIGWVLLNAELLSYAAKAHTRI
3clzA           ----------------------------------------------------------------------
1ecxB           RIVKKKNKETLVHVDAVQTIGKIPFSL-EKLEVDYASFSAHKFHGPKGVGITYIRKGVPIRPLIHGLRSG
2bwnA           DIAEEFGALTYIDEVHAVGMYGPGAGVAERDGLMHRIDIFNGTLAAYGVFGGYIAASAVDAVRSYAPGFI
3b46B           NICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLSAGSFAATGWRIGWVLSNAELLSYAAKAHTRI
1dfoB           EIADSIGAYLFVDMAHVGLVAAGVYPNVPHAHVVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPG
3d6kA           ESTAAPDFRIVWDNAYALHTLSDEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVR
2c44C           SIAKKYDIPVVMDSARFAENAYFIKQRTRETYKYADMLAMSAKKDMVPMGGLLCMKDDSFFDVYTQEGFP
1c7gA           EMASTYGIKIFYDATRCVEENVSIKDIVHEMFSYADGCTMSGKKDCLVNIGGEMFSAAKELVVVYEGMPS
2bwnB           DIAEEFGALTYIDEVHAVGMYPRGAGVAERDGLMHRIDIFNGTLAAYGVFGGYIAASARMVDAVRSYAPG
2dgkA           QADTGIDIDMHIDAASGGFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNFS
1b8gA           SFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQGFRVGAIYSNDDMVVAAATKMSSF
3bc8A           VICANYDIPHVVNNAYGLQSSKCMHLIQQGARIDAFVQSLDNFMVPVGGAIIAGFNEPFIQDISKMYPGR
3cbfA           QMVMERGLVVVEDDAYRELYFGEALAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGA
2d66A           QLSVEKGWLPLFDFAYQGFARGLEEDAAAMHKELIVASSYSKNFGLYNERVGACTLETVDRAFSQMKAAI
3e77C           -IPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFSVLEYKVQAGNSSL
2bwoB           DIAEEFGALTYIDEVHAVGMYPRGAGVAERDGLMHRIDIFNGTLAKAYFGGYIAASARMVDAVRSYAPGF
3bcaA           VICANYDIPHVVNNAYGLQSSKCMHLIQQGARVGRIDASLDNFMVPVGGAIIAGFNEPFIQDISKMYPGR
3dwkA           SELMNNKAFNLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYNKDQQVGATILDSKTGGLVAISGGRDF
3dzzB           ELCAKHQVLLISDEIHGDLVLTDEDVDWDAKNWVVSLISPSTFNLAALHAACAIIPNPDLRARAEESFFL
2dr1A           KVAKEHDKLVFVDAVSAMGGADIKF---DKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMPERT
2bhgA           DTARKKGTPVVGVVNNADVGRSGEALTYKDIVVTPGLFAYKAATRAGYAGGAVLAKDGADTFI-VGTHSA
3dzzA           ELCAKHQVLLISDEIHGDLVLTDEDVDWDAKNWVVSLISPSTFNLAALHAACAIIPNPDLRARAEESFFL
1c0nA           TLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKEALLSEGTTWTKAPWRFE
1ay5B           SILEKTGALPLIDLAYQGFGDGLERLIASRIPEVLIAASCSKNFGIRERTGCLLALCADAATRGAMAFLN
3e77A           FIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALLEYKVQAGNSSL
3dydA           AVAARQCVPILADEIYGDMVFSDCLATLSTDVPILSCGGLAKRWVPGWRLGWILIHDRRDIFGNEIRDGR
1djuA           DFVVEHDLIVISDEVYEHFIYDDARHYSGMFERTITVNGFSKTFAMGWRLGFVAAPSWIIERMVKFQMYN
3dydB           AVAARQCVPILADEIYGDMVFSDCKYEPLATLSTLSCGGLAKRWLPGWRLGWILIHDRRDIFGNEVKLSQ
3cq5B           RIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVTMSKAFDFAGGRLGYFVANPAFIDAVML-VRL
3d6kB           ESTAAPDFRIVWDNAYALHTLSDEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVR
3cq4B           RIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVRTMSKAFFAGGRLGYFVANPAFIDAVML--VRL
2dkjA           EIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPG
2aevA           NTAKNKEAIVFVDDASGARVRLLFNQPPALKLGADLVVTSTDLMEGP-RGGLLAGKKELVDKIYIEGTKF
1d2fB           DLCERHGVRVISDEIHMDMVWGEQPWSNVARGDWALLTSGSKSFNPALTGAYGIIENSSSRDAYLSAKGR
1bjoA           TPDFGADVVVAADFSSTILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSLNDNGSM
3d6kC           ESTAAPDFRIVWDNAYALHTLSDEFAQAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVR
3bcxA           RVADKYNLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPAHHITMGEGGAVFTQSAELKSIIESFRDWG
3cq4A           RIINVAPGIVIVDEAYAEFSPSPSATTEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLP
3d6kD           ESTAAPDFRIVWDNAYALHTLSDEFPIAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVR
1ecxA           --KKNKETLVHVDAVQTIGKIPFSLEKLEVDYA---SFSAHKFHGPKGVGITYIRKGVPIRPLERGLRSG
3cq6A           RIINVAPGIVIVDEAYAEFSPSPSATTLEKYPTKLVVSRTMSADFAGGRLGYFVANPAFIDAVML--VRL
3dr7B           EVARRHNLLVIEDAAEA----VGATYRGKKSGSLGDCATFSFNDDDLAAKMRLLRGQGMDPNRRYWFPIV
2ch2A           QICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQVLGAPPGRTKSKVFYWDLLLLGNYWGCYDHHT
1bw0A           RLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFLGGTANLVVPGWRLGWLLYVDPHGNGPSFLEGML
1d2fA           DLCERHGVRVISDEIHMDMVWGEQPWSNVARGDWALLTSGSKSFNIPALTGAYGIIENSRDAYLSALKGR
3cq5A           RIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVTMSKAFDAGGRLGYFVANPAFIDAVML--VRL
3bb8A           RVADKYNLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPAKHITMG-EGGAVFTQSAELKSIIESFRDW
1dkrA           API-------------------------------------------------------------------
1agxA           KLHDEQGLQIRSSRVAQGFVLRNAEQPDDKGWIAAHDLNPQKARLMALALTKTNDAKEIQNMFWN-----
1bjnA           TPDFGADVVVAADFSSTILSRPIDVSRYGVIYAGAQNIGPAGLTIVIVREDLLGLDYSILNDNGSMFNTP
3bcxB           RVADKYNLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPAHHITMG-EGGAVFTQSAELKSIIESFRDW
3b8xA           -IIGGRDIILLEDNCESMGATFNNKCAGTFGLMGTFSSFYSNHIATMEGGCIVTDDEEIYHILLCIRAHG
3dr4B           --ARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNAIIDDLAAKMRLLRGQGMDPNRRYWFPIV
1b9iA           KISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHS
1b9hA           KISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHS
2bieB           NFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVLLVEQVPTMLQYATHIKSDSL
3b8xB           KIIGGRDIILLEDNCESMGATFNNKCAGTFGLMGTFSSFYSNHIATMEGGCIVTDDEEIYHILLCIRAHG
2bhxB           NFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLVEQVPTMATHIKSDSL
2a7vA           EVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGA-RSGLIFYRKGVKAVDPKTGREI
1c4kA           -RIGHLCDYIEFDSAWVGYEQFIPMMRNSSPLLIDDVQSVHKQQAGFSQTSQIHKKDSHIKGQLRYCDHK
3caiA           KLVHDVGALVVVDHSAAAPYRLLDIRET---DADVVTVNAHAWGGPP-IGAMVFRDPSVMNSFGSVSTNP
1bs0A           QVTQQHNGWLMVDDAHGTIGEQGRGS-CWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHL
2bieA           NFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTHIKSDSL
1djuB           DFVVEHDLIVISDEVYEHFIYDDAASLDGMFERTITVNGFSKTFMTGWRLGFVAAPSWIIERMVKFQMYN
1eg5A           KKN--KETLVHVDAVQTIGKIPFSLE---KLEVDYASFSAHKFHGPKGVGITYIRKGPLIHGGGQERGLR
3bn1D           EVARRHNLLVIEDAAEAV----GATYRGKKSGSLGDCATFSFNDDDLAAKMRLLRGQGMDPNRRYWFPIV
2douB           GLARKHGLWLIHDNPYVDQVYEGEAPSPLAKERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVI
1dfoA           EIADSIGAYLFVDMAHVGLVAAGVYPNVPHAHVVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPG
2c7tA           EIAQEHNLFVIEDCAQSHGSVWNNQRAGTIGDIGAFSCQQGKVLTAG-EGGIIVTKNPRLFELIQQLRAD
1bybA           ENMSDFLESGLIIDIEVGLGPAGELRYPSYPQSQGWEFPRIGEFQC------------------------
2c0rA           AFPDTGSVPLIGDMSSDILSRPFDLNQFGLVYAGAQKNLGPSGVTVVIVREDLVAESPKHYDTYVKNNSL
3e77B           -IPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFSVLEYKVQAGNSSL
1btcA           ENMSDFLESGLIIDIEVGLGPAGELRYPSYPQSKADFKAAVA--RAGHPEWELPDDAGKYNDVPESTGFF
1bw0B           RLAEELRLPLFSDEIYAGMVFKGKDPNFETTVPRVILGGTANLVVPGWRLGWLLYVDPHGNGPSFLEGML
2ch1A           QICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQVLGAPPGITPISISPLGNYWGCYDEPKRYHHT
3dr4D           EVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNAIIDDLAAKMRLLRGQGMDPNRRYWFPIV
2bwpB           DIAEEFGALTYIDEVHAMYGPRGAGVA-ERDGLMHRIDIFNGTLAKAYFGGYIAASARMVDAVRSYAPGF
3dr4A           EVARRHNLLVIEDAAEAVGATYRGKKSGSLGDCATFSFFGNAIIDDLAAKMRLLRGQGMDPNRRYWFPIV
1ay4A           SILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIALIAASCSKNFGIRERTGCLLALCADAATRGAMAFLN
3bn1C           EVARRHNLLVIEDAAEA----VGATYRGKKSGSLGDCATFSFNDDDLAAKMRLLRGQGMDPNRRYWFPIV
2c81A           EIAQEHNLFVIEDCAQSHGSVWNNQRAGTIGDIGAFSCQQGKVLTAGEGGIIVTKNPRLFELIQQLRADS
2e7jA           KVCSEYDVPLLVNGAYAIGRMPVSL---KEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSEKY
1djeA           QVTQQHNGWLMVDDAHGTIGEQGRGSCW-LQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHL
2douA           GLARKHGLWLIHDNPYVDQVYEGEAPSPGAKERVVELFSLSKSYNAGFRLGFALGSEEALARLERVKGVI
3ca8B           ----------------------------------------------------------------------
2bkwA           --QTSPETFFVVDAVCSIGCEEFEFDGLSISLCSSRFDYALNDSKNGHVHGYFSSLRRWTPIENYEAGKG
3c3jC           AFCFLYAQTFALQSLHGNTPDTGVIIPWQ-----------------------------------------
3d1rA           LDGDMNGRLLARHDVKNRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKG
1cj0A           KIADENGAYLMADMAH-ISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRGVRSVDILYNLES
2dqxA           ENMSDFLESGLIIDIEVGLGPAGELRYPSYPQSQGWEFDFKAAVRAGHPEWELPDDAGKYNDVGFFKSNG
3ca8A           ----------------------------------------------------------------------
2aeuA           NTAKNKEAIVFVDDASGRVRLLFNQPPALKLGADLVVTSTDKLMEGP-RGGLLAGKKELVDKIYIEGTKF
1cj0B           KIADENGAYLMADMAHVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFSVDKEILYNLESLINSAVFPG
2cdmA           YLGAVYNAELAHELQKLGLRYGKDGN-FDLAHIDRQ-----------QIEGFSKRTEQIAEWYAARGLDP
2a8iB           DKQTLLVEFLWSTESCVGYSAQDGKAKTHISRLPPGAVAGQSVAIEGG-VCR------------------
1cliB           EGCLQSGCSLVGGETAEMPGM--------YHGEDYDVAGFCVGVKSEIIDGSKVSDGDVLIALGSHSNGY
3bn1A           EVARRHNLLVIEDAAEA----VGATYRGKKSGSLGDCATFSFMITTNDDDLAAKMRLLRGQGMDPNRRGF
3dr4C           EVARRHNLLVIEDAAEA----VGATYRGKKSGSLGDCATFSFFGNANDDDLAAKMRLLRGQGMDPNRRGF
1c8nA           NTDVTPTSAIYVDVDVTRFDKAWYSTIGALTAFDQNQFCPCTVHISDGGPAVAVPPGDIFFKYVIELIEP
3a2bA           SIANEFDAAVMVDDAHSVIGHKGAGT-ASHFGLNDDVGTFSKSLAS--LGGFVAGDADVIDFLKHNARSV
3brmA           QVIPKDVAKLAKALLTCGYNASGKYAAFVGVPVSGGIALVPPSQPFQSGCGIGI--------YGP--AID
1e5eA           DAHSQEGVLVIADNTFCSPM----ITNPVDFGVDVVVHSATKYINGDVVAGLICGKADLLQQMVGIKDIT
1awiA           DGTCQDAAIVGYKDSPWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFS
3blvH           ----------------------------------------------------------------------
1e5eB           KDAHSQEGVLVIADNTFCSPMITNPVDFGV-DVVVHSATKYINGHTDVVAGLICGKADLLQQMVGIKDIT
2btwA           RLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGIVNYLRKEIGQERGGHISPLAAYNEQTDRFLIDVS
3e6gD           VIARKHGLLTVVDNTFA----SPMLQRPLSLGADLVVHSATKYLNGSDMVGGIADNAELAEQMAFLQNSI
3e6gB           VIARKHGLLTVVDNTFA----SPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIANAELAEQMAFLQNSI
2cb1A           TLAEEAGVALVVDNTFGAAGALCRPLA---WGAHVVVESLTWASHGSVLGGAVLSRETELWRNYPQFLQP
1c8fA           ----------------------------------------------------------------------
1c8eA           ----------------------------------------------------------------------
3d19E           KLPGQNNFPLLVDHTSREADYFRKRLIQLNEGKLPDAIILRIMADHAKFIGHLLDPSERKLVDTARNFSN
3bh1C           AATDSNAQKALDQLKNL--------RGCDVHTTTILGSVDEGIFRNL---GVLVTSPKFQK---------
3d19A           KLPGQNNFPLLVDHTSREARLIQLNEGKLDALPDAIIKENVFFLRIAKFIGHLLDPSERKLVDTARNFSN
3e6gA           VIARKHGLLTVVDNTFA----SPMLQRPLSLGADLVVHSATKYLNGHSMVGGIAVNAELAEQMAFLQNSI
1dy2A           RKAERFGLPIVNLKGQVFNNWDSIFSGDGGQ---------------------------------------
1eghA           RLATVWNIPVATNVATA----DFIIQSPHFND-AVDILDYQRYLAD------------------------
2ctzA           QAAREKGVALIVDNTFGMGGYLLRPLA---WGAALVTHSLTKWVGG------------------------
1bxgA           DILHARGILYAPDFVA------------------------------------------------------
3blvD           ----------------------------------------------------------------------
3cogB           IVHKHGDIILVVDNTFMSPY----FQRPLALGADISMYSATKYMSDVVMGLVSVNCESLHNRLRFLQNSL
2b34A           --KFKEVQKLILTSAP------------------------------------------------------
1b1xA           QWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRP
1ei7A           VAIRSAINNLIVELIRGTGSYNRS----------------------------------------------
2bu3A           DVSRYKYPPVWVKTTDLWKANTVDSVSQKTRGFV------------------------------------


                         .         *         .         .         .         .         +:350
query           TFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRXXXXXXXXXXXXXXKDI
3drdB           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
3dodA           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
3dodB           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKEKV
2bylA           TYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS--DVVTAVRLNAIVIKETKDWDAWKV
3du4A           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDL-HALPHVGDIRKETKEPYPADRRIGYKV
2byjA           TYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS--DVVTAVRLNAIVIKETKDWDAWKV
2cinA           TWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFAVVLDPRGLMCAFSLPTTADRDEL
3bv0A           TFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGL-DTARALPAVTDVRGAIGVIECDRPVDLAVA
2eh6A           TFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELGK-----GKVKGRGLMLGLELERECKDY
2e54A           TFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGLMIGIQFREEVSNREV
1dtyA           TFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPA-RDAEMVADVRGAIGVVETTHPVNMAAL
2e7uA           TLSGNPLAMAAGLATLELLEEPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEGPKRF
3dxvA           TLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRVCDRQSREPARAETAKL
1d7uA           THVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRVKDRRTKEPADGLGAKI
1dgdA           THVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRVKDRRTKEPADGLGAKI
3dxvB           TLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDILVCDRQSREPARAETAKL
3bv0B           TFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGL-DTARALPAVTDVRGAIGVIECDRPVDLAVA
3drdA           SYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQD-LHALPHVGDIRQLGFMCGAELVRSKETK
3ei7A           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVF
2cfbA           TLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGTNYEQAKQSDLKKFAAF
3bs8A           TLSGNPLAMTAGLETLKQLTPDSYKNFIKKGDRLEEG-ISKAAEAHGIPHTFNRAGSMIGFFFTNEPVIL
1asfA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
2cstA           RTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELPGTWNHITDQIGMFSFTGLNPKQV
1ajsA           RVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRGTWNHITDQIGMFSFTGLNPKQV
2bwnD           FSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPDHGSHIVPVVIGDPVHTKAVS
1c7nA           SGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKAPLYLQWIDFRALKMDHKAM
3eiaA           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFSLGYDVYGGKNAPYVWVHFPNQSSWDVF
1aamA           DANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
3clzB           ----------------------------------------------------------------------
2dgmB           RPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDL
2aatA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLANRDFSFIIKQNGMFSFSGLTKEQV
3ei9B           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVF
1bjwA           TTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRFYVLMDTSPIAPDEVRA
1arhA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
3dc1D           TLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLMFLWIKVKGINDVKELI
2egyB           DLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKTRPKGGMFVWMELPKGLSAEGL
1aiaA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
1bkgA           TTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIVRA
1ejiA           LQGGPHNHAIAGVAVALKQATTEFKIYQLQVLANCRALSDALTEYKIVTGGSDNHLILDLRSKGTDGGRA
3ei6A           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVF
1b4xA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
3clzD           ----------------------------------------------------------------------
2cy8A           SFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLPPNTTDTGSITRAEVARPDVKM
1czcA           RVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFTIKQNGMFFFGGLTKEQV
2egyD           DLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPYTRPKGGMFVWMELPKGLSAEGL
3ecdB           PLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQV
3ei7B           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVF
2egyC           DLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPEVRYTRPKGGMFVWMELPKGLSL
3ei6B           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVF
2c44A           TYGGLEGGAMERLAVGLYDGMLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAKLLPHIPADQFPAQALA
2bwnE           FSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAMPIIDHGSHIVPVVIGDPVHTKAVS
1ariA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
1akaA           RPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLSHNWQHITDQIGMFCFTGLKPEQV
3aatA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
2bwoD           STSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAGMPIIDHGSHIVPVVIGDPVHTKAVS
3ei8A           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVF
2dgmA           RPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPEDPGYTLYDLSERLRLR
2d61A           RVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
1aheA           RANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
7aatA           RPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLSHNWQHITDQIGMFCFTGLKPEQV
1b5oA           TTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRFYVLMDTSPIAPDEVRA
2dgkC           RPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDP
1bqaA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMEKGANRDFSFIIKQNGMFSFSGLTKEQV
3ei9A           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVF
1b5pA           TTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRFYVLMDTSPIAPDEVRA
2d64A           RVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFTIKQNGMFFFGGLTKEQV
2dr1B           PSTPPMPQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPTITAVLTPPGIKGDEV
3e2fA           TPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPADLSDMNSDEPYDYKFV
2dgmE           RPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPCFKLKDGEDPGYTLYDL
2d5yA           RVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFTIKQNGMFFFGGLTKEQV
3dc1A           TLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLMFLWIKVKGINDVKELI
1arsA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
2dgmC           RPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPCFKLKDGEDPGYTLYDL
1asbA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
3bcbA           ASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLEAHNERLLQTPMTLKTIDGHHDKAVTQL
3dc1B           TLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLMFLWIKVKGINDVKELI
3ecdA           PLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQV
3eiaB           FNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSGYDVYGGKNAPYVWVHFPNQSSWDVF
1ay4B           RQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLVAEHRGMFSRLGATPEQ
3ecdD           PLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQV
1eg5B           SGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPLEISLPNTLSVSFPNIRG-STL
1ax4A           YGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCKKLVPQIPGDI
3e2yA           FYTCATPLQAALAEAFWIDIPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADL
1ajrA           RVTWSNPPAQGARIVARTLSDPELFHEWTGNVDRILSMRSELRARLEALKNHITDQIGMFSFTGLNPKQV
2c44B           TYGGLEGGAMERLAVGLYDGMLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAKLLPHIPADQFPAQALA
2bwpA           STSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIDHGSHIVPVVIGDPVHTKAVS
5bj4A           TTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRFYVLMDTSPIAPDEVRA
5bj3A           TTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRFYVLMDTSPIAPDEVRA
1bqdA           RANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLANRDFSFIIKQNGMFSFSGLTKEQV
1bj4A           LQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTI
2bwoA           FSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKAMPIIDHGSHIVPVVIGDPVHTKAVS
3ecdC           PLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQV
3e9kA           ISNPPILLVCSLHASLEIFKQATLRKKSVLLTGYLEYLIKHNYGVVNIITPSHERGCQLTITFSVPNKDV
1b8gB           GLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGDMRHLLRSNTFEAEMEL
3b46A           CFASPSPLQEACANSINDALKIGYFEKMINKFKIFTSIFDEVLVDFSKVKIPEDYPYPEEILNKGKDFRI
3clzA           ----------------------------------------------------------------------
1ecxB           TQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTL
2bwnA           FSTSLPPAAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMIIDHGSHIVPVVIGDPVHTKAVS
3b46B           CFASPSPLQEACANSINDALKIGYFEKMINKFKIFTSIFDEVLVDFSKVKIPEDYPYPEEILNKGKDFRI
1dfoB           GQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEA
3d6kA           GIGPNKLNQLAHAQFFGDVALKAHLKHAASLAPKFERVLDSRLSEYGVAKWTSPTGGYFISVDVVPGTAV
2c44C           TYGGLEGGMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPADLA
1c7gA           YGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLREAGVPIVEPTGGHAVFLDARRFCPHLTQLA
2bwnB           STSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAV
2dgkA           RPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDL
1b8gA           GLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGMRHLLRSNTFEAEMELW
3bc8A           ASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAMTLKTIDGHHDKAVTQLGSMLFTRQVS
3cbfA           DLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDREVPKTRPKGGMFVWMELPKGLSAEGL
2d66A           RVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFNRDFSFIIKQNGMFSFSGLTKEQV
3e77C           YNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGD
2bwoB           STSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIDHGSHIVPVVIGDPVHTKAVS
3bcaA           ASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKAEAHNERLLQTPHNPISLAMTLKTIDGVS
3dwkA           KDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWA-----------------------------------
3dzzB           AGIGEPLAIPAAIAAYE-EGHDWLRELKQVLRDNFAYAREFLAKEVPEVKVLDSNASYLAWVDISALGNC
2dr1A           PSTPPMPQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTITAVLTPPEV
2bhgA           GGNGVGYCSCVSRSLQK-----------------------------------------------------
3dzzA           AGIGEPLAIPAAIAAY--EEGHDWLRELKQVLRDNFAYAREFLAKEVPESNASYLAWVDISALGNAEDFC
1c0nA           AGTPNTGGIIGLGAALE-YVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQARLGVIAFNLGAHHV
1ay5B           RQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLVAEHRGMFSRLGATPEQ
3e77A           YNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGF
3dydA           ILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGAL-AAIPGLRPVRVGIEMEHFPEFENDVEF
1djuA           ATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPFYIFPRIRDTGLTSKKF
3dydB           RILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRVGIEMEHFPEFENDVEF
3cq5B           PYHLSALSQAAAIVALRHSDTLGTVEKLSVERVRVAARLEELG-----YAVVPSESNFVFFGDFSDQHAA
3d6kB           GIGPNKLNQLAHAQFFGDVALKAHLKHAASLAPKFERVLDSRLSEYGVAKWTSPTGGYFISVDVVPGTAV
3cq4B           PYHLSALSQAAAIVALRHSDTLGTVEKLSVERVRVAARLEEL--------GYAVVPSESNFVFFGDQHAA
2dkjA           IQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGHLFLVDLRPKGLTGKEA
2aevA           GLEAQPPLLAGIYRALKNFNLERIRKAFERAKNFDLSKIEKLNKELKAIDDNIKRVYKDDTINIKKLIEI
1d2fB           DGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYLAWLDLRPLNI
1bjoA           FNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVRMNVPFQLADSALDKLF
3d6kC           GIGPNKLNQLAHAQFFGDVALKAHLKHAASLAPKFERVLDSRLSEYGVAKWTSPTGGYFISVDVVPGTAV
3bcxA           RDCLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSDPSWFGFPITLKIDL
3cq4A           YHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELG-----YAVVPSESNFVFFGDFSDQHAA
3d6kD           GIGPNKLNQLAHAQFFGDVALKAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGGYFISVDVVPG
1ecxA           TQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTL
3cq6A           PYHLSALSAIVALRHSADT--LGTVEKLSVERVRVAARLEELG-----YAVVPSESNFVFFGDFSDQHAA
3dr7B           GFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALMYTVRLGEGLSTTRDQV
2ch2A           VASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHPTVTGIMIPKGVDWWKV
1bw0A           VCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHI-GECIGLAPTMRIDLEKYRDIKTDVEFF
1d2fA           DGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQYLAWLDLRPLNIDDNAL
3cq5A           PYHLSALSQAAAIVALRHSDTLGTVEKLSVERVRVAARLEELG-----YAVVPSESNFVFFGDFSDQHAA
3bb8A           GRDCQLGSLPFGYDHKYTYSHLGYNLKITDMQAACGKYLKDALQSCADFIELPEATENSDPSWFGFPIDL
1dkrA           ----------------------------------------------------------------------
1agxA           ----------------------------------------------------------------------
1bjnA           PTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNRMNVPFQLADSALDKLF
3bcxB           GRDCLGSLPFGYDHKYTYCGLAQ-LERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSDPSWFIDL
3b8xA           WTRNLPKKNKVTGVKSDDQFEESFKFVLPGYNVRP-----------------------------------
3dr4B           GFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEQV
1b9iA           CGRPRDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDE-------------------------
1b9hA           CGRPRDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIALSRLLGAIDGVVMAMFRIPGLTEERRNAL
2bieB           YNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHLMNVTFNLRNEELNQQF
3b8xB           WTRNLPKKNKVTGVKSDDQFEESFKFVLPGYNVRP-----------------------------------
2bhxB           YNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHLMNVTFNLRNEELNQQF
2a7vA           PYTFEDRINFAVFPSLQGACTPMFSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARA
1c4kA           HFNNSFNLFMSTLDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVNGKKWEDGDTED
3caiA           YATGPARLEIGVHQFGLLAGVVASIEYLAALFDYLMVSLRSLPLVMLIGRPEAQIPVVSFAVHKVPADRV
1bs0A           IYSTPPAQAQASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLA---DSCSAIQPLIVGDNSRALQL
2bieA           YNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHLMNVTFNLRNEELNQQF
1djuB           ATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPFYIFPRIRDTGLTSKKF
1eg5A           SGTQNVPGIVGAARAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPLEISLPNTLSVSFPNIRG-STL
3bn1D           GFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALMYTVRLGEGLSTTRDQV
2douB           DFNQYAGVLRMGVEALK-TPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEF
1dfoA           GQGGPLMHVIAGKAVALKEAMKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEA
2c7tA           SRVYCDDSSELMHGDMQLVKKGDIQGSNYCLSEFQSAILLDQLQELDDKNA-IREKNAMFLNDALSKIDG
1bybA           ----------------------------------------------------------------------
2c0rA           YNTPPSFGIYMVNEVLKWIEERGGLEGVQQANRKKASLIYDAIDQSGGFYRGCDMNITFRLASEELEKEF
3e77B           YNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGF
1btcA           KSNG------------------------------------------------------------------
1bw0B           VCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMY-LYNHIGECIGLAPTMRIDLEKYRDIKTDVEFF
2ch1A           VASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHRLPTVTGIMIPKGVDWS
3dr4D           GFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALMYTVRLGEGLSTTRDQV
2bwpB           IFSSLPPAAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPII---DHGSHIVPVVIGDPVHTKAV
3dr4A           GFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEQV
1ay4A           RQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLVAEHRGMFSRLGATPEQ
3bn1C           GFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALMYTVRLGEGLSTTRDQV
2c81A           RVYCDDSSELMHGDMQLVKKGDIQGSNYCLSEFQSAILLDQLQELDDKNAIREVFRFDPVKFGGLNADQF
2e7jA           ELLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYE
1djeA           IYSTPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQL
2douA           DFNQYAGVLRMGVEALK-TPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEF
3ca8B           ----------------------------------------------------------------------
2bkwA           AYFATPNSLDVALKEILEEGLHKRWDLHRESDWFKDSLVNGLQLTSVSRYPSNSAHGLTAVYVADP-PDV
3c3jC           ----------------------------------------------------------------------
3d1rA           NIATTETLLIRGKSTIRRI---------------------------------------------------
1cj0A           LQGGPHNHAIAGVAVALKQAFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRA
2dqxA           TYVTEKGKFFLTWYSNK------LLNHGDQILDEAN----------------------------------
3ca8A           ----------------------------------------------------------------------
2aeuA           GLEAQPPLLAGIYRALKNFNLERIRKAFERAKNFDLSKIEKLNKELKAIDDNINIVYERTPTGFVIKREI
1cj0B           LQGGPHNHAIAGVAVALKQAMKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRA
2cdmA           NSVEQKQAAKVLSRAKK------TSVDREALRAEWQATAKEL----------------------------
2a8iB           ----------------------------------------------------------------------
1cliB           SLVRKILEVSGCDPQTTELDGKPLADHLLAPTRIYVKSVLELIEKVDV----------------------
3bn1A           NYRMTNIQAAIGLAQLERV--DEHLAARERVVGWYEQKLARLGNRVTKPHVALMYTVRLGEGLSTTRDQV
3dr4C           NYRMTNIQAAIGLAQLERV--DEHLAARERVVGWYEQKLARLGNRVTKPHVALMYTVRLGEGLSTTRDQV
1c8nA           I---------------------------------------------------------------------
3a2bA           MFSATPASVASTLKALEIIQNEPEHEKLWKNTDYAKAQLLDHGFDLG---ATESPILPIFIRSNEKTFWV
3brmA           EYGNSLTGGLLKHA--------------------------------------------------------
1e5eA           GSVISPHDAWLITRGLSTLNIAEYLKSHPAVEKVYYPGFEDHEGHDIAMRMYGSMITFILKSGFEGAKKL
1awiA           MDLRTKSTGGAPTF--------------------------------------------------------
3blvH           ----------------------------------------------------------------------
1e5eB           GSVISPHDAWLITRGLSTLNIRMKAESENAMKKVYYPGFEDHEGHDIAKKQMRMYGSMITFILKSGFEGL
2btwA           RYKYPPVWVKTTDL--------------------------------------------------------
3e6gD           GGVQGPFDSFLALRGLKTLPLRAHCENALALAQWL-----------------------------------
3e6gB           GGVQGPFDSFLALRGLKTLPLRMHCENALALAQWL-----------------------------------
2cb1A           WEALRA----------------------------------------------------------------
1c8fA           ----------------------------------------------------------------------
1c8eA           ----------------------------------------------------------------------
3d19E           DFDELMYQAIDLES--------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
3d19A           DFDELMYQAIDLES--------------------------------------------------------
3e6gA           GGVQGPFDSFLALRGLKTLPLRAHCENALALAQWLE----------------------------------
1dy2A           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
2ctzA           ----------------------------------------------------------------------
1bxgA           ----------------------------------------------------------------------
3blvD           ----------------------------------------------------------------------
3cogB           GAVPSPIDCYLCNRGLKTL---------------------------------------------------
2b34A           ----------------------------------------------------------------------
1b1xA           PEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLL-------------------------
1ei7A           ----------------------------------------------------------------------
2bu3A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLxx
3drdB           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
3dodA           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
3dodB           SLKMRELGMLTR-PLGDVIAFLPPLASTAEELSEMVAIMKQAI---
2bylA           CLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI---
3du4A           SLKMRELGMLTRPL-GDVIAFLPPLASTAEELSEMVAIMKQAI---
2byjA           CLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTI---
2cinA           IRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSAL---
3bv0A           TPAALDRGVWLR-PFRNLVYAMPPYICTPAEITQITSAMVEVA---
2eh6A           VLKALEKGLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL---
2e54A           ATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVL---
1dtyA           QKFFVEQGVWI-RPFGKLIYLMPPYIILPQQLQRLTAAVNRAV---
2e7uA           FHGLLDRGIYWPPSNFEAAFLSVAH--REEDVEKTLEALRKAL---
3dxvA           IYRAYQLGLVVYYMNGNVLEFTPPLTITETDIHKALDLLDRAF---
1d7uA           TRECMNLGLSMNPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI---
1dgdA           TRECMNLGLSMNPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAI---
3dxvB           IYRAYQLGLVVYYMNGNVLEFTPPLTITETDIHKALDLLDRAF---
3bv0B           TPAALDRGVWL-RPFRNLVYAMPPYICTPAEITQITSAMVEVA---
3drdA           VSLKMRELGMLTRPLGDVIAFLPPLASTAEELSEMVAIMKQAI---
3ei7A           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
2cfbA           HRGMLEQGIYLAP--SQFEAGFTSLAHTEADIERTIAAARTVL---
3bs8A           KLFASYYKGMANLPPSQFEGLFLSTAHTDEDIENTIQAAEKVF---
1asfA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
2cstA           EYMIKEKHIYLMASG-----RINMCGLTTKNLDYVAKSIHEAV---
1ajsA           EYLINQKHIYLLPSGNMCGLTTKNLDYVATSIHEAVTKIQ------
2bwnD           DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDL-----
1c7nA           EEFMIHKAQIFFFGDGGIGFERINLAAPSSVIQESLERLNKAL---
3eiaA           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
1aamA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
3clzB           ----------------------------------------------
2dgmB           SERLRLRGWQVEATDIVVMRIMCRRGFEMDFAELLLEDYKASL---
2aatA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
3ei9B           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
1bjwA           AERLLEAGVAVVPGTAAFGHVRLSYATSEENLRKALERFARVL---
1arhA           LRLREEFGVYAVASG-----AVNVAGMTPDNMAPLCEAIVAVL---
3dc1D           EEKAVKMGVLMLPAPSPYLR-ASFSSASPEQMDVAFQVLAQLI---
2egyB           FRRALEENVAFNGGGENTLRLSYAT-LDREGIAEGVRRLGRAL---
1aiaA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
1bkgA           AERLLEAGVAVVPGTAAFGHVRLSYATSEENLRKALERFARVL---
1ejiA           EKVLEACSIACNKLRPSGLRLGTPALTSRGLLEEDFQKVAHFI---
3ei6A           AEILEKTHVVTTPGSGGFVRV--SAFGHRENILEACRRFKQLY---
1b4xA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
3clzD           ----------------------------------------------
2cy8A           IAAMRMALILEGVDIGGRGSVFLSAQHEREHVEHLVTTFDRVL---
1czcA           LRLREEFGVYAVASG-----RLNVAGMTPDNLAPLCEAIVAVL---
2egyD           FRRALEENVAFNGGGENTLRLSYAT-LDREGIAEGVRRLGRAL---
3ecdB           EQALERAGDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLI---
3ei7B           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
2egyC           FRRALEENVAFVPGGPNTLRLSYAT-LDREGIAEGVRRLGRAL---
3ei6B           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
2c44A           CELYKVAGIRAVECPAELLRLIPRATYTQTHMDFIIEAFKHVK---
2bwnE           DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDLLW---
1ariA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
1akaA           ERLTKEFSIYMTKDG-----RISVAGVASSNVGYLAHAIHQVT---
3aatA           LRLREEFGVYA--VASGFVNV---AGMTPDNMAPLCEAIVAVL---
2bwoD           DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDL-----
3ei8A           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
2dgmA           GWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASL---
2d61A           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
1aheA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
7aatA           ERLTKEFSIYMTKDG-----RISVAGVASSNVGYLAHAIHQVT---
1b5oA           AERLLEAGVAVVPGTAAFGHVRLSYATSEENLRKALERFARVL---
2dgkC           GYTLYDLTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASL---
1bqaA           LRLREEFGVYAVAS-----GRVNVAGMTPDNMAPLCEAIVAVL---
3ei9A           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
1b5pA           AERLLEAGVAVVPGTAAFGHVRLSYATSEENLRKALERFARVL---
2d64A           LRLREEFGVYAVASG-----RLNVAGMTPDNLAPLCEAIVAVL---
2dr1B           YEAMRKRGFELASVKEKTFRIGHMGYMKFEDIQEMLDNLREVI---
3e2fA           KWMTKHKKLTAIPKPHFEKLVRFCFIKKDSTLDAAEEIFRA-----
2dgmE           SERLRLRGWQVEATDIVVMRIMCRRGFEMDFAELLLEDYKASL---
2d5yA           LRLREEFGVYAVASG-----RLNVAGMTPDNLAPLCEAIVAVL---
3dc1A           EEKAVKMGVLMLPGNAPYLRA-SFSSASPEQMDVAFQVLAQLI---
1arsA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
2dgmC           SERLRLRGWQVEATDIVVMRIMCRRGFEMDFAELLLEDYKASL---
1asbA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
3bcbA           GSMLFTRQVSGARYPCAYLNAAAAIGMKMQDVDLFIKRLDKC----
3dc1B           EEKAVKMGVLMLPAPSPYLR-ASFSSASPEQMDVAFQVLAQLI---
3ecdA           EQALERAGDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLI---
3eiaB           AEILEKTHVVTTPGSGGFVR--VSAFGHRENILEACRRFKQLY---
1ay4B           VKRIKEEF-GIYMVGD--SRINIAG-LNDNTIPILARAIIE-----
3ecdD           EQALERAGDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLI---
1eg5B           QNLLSGYGIYVSTIAQGAIRISLCKYNTEEEVDYFLKKIEEIL---
1ax4A           NALYLESGVRAVEADMEFMRLIARRVYTNDHMDYIADALIGLK---
3e2yA           SWMTKHKKLTAIPKPHFEKLVRFCFIKKDSTLDAAEEIFRA-----
1ajrA           EYLINQKHIYLLPS-----GRINMCGLTTKNLDYVATSIHEAV---
2c44B           CELYKVAGIRAVECPAELLRLIPRATYTQTHMDFIIEAFKHVK---
2bwpA           DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDLL----
5bj4A           AERLLEAGVAVVPGTAAFGHVRLSYATSEENLRKALERFARVL---
5bj3A           AERLLEAGVAVVPGTAAFGHVRLSYATSEENLRKALERFARVL---
1bqdA           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
1bj4A           ACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFI---
2bwoA           DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDLL----
3ecdC           EQALERAFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLI---
3e9kA           FQELEKRGVVCDKRNPNGIRVPVPLYNSFHDVYKFTNLLTSIL---
1b8gB           WKKIVYEGSSCHCTEPGWFR-VCFANLPERTLDLAMQRLKAFV---
3b46A           SHWLIELGVVAIPAAENLLRF--AVCKDDAYLENAVERLKLLK---
3clzA           ----------------------------------------------
1ecxB           QNLLSGYGIYVSRIAQGAIRISLCKYNTEEEVDYFLKKIEEIL---
2bwnA           DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDL-----
3b46B           SHWLIELGVVAIPPTENLLRF--AVCKDDAYLENAVERLKLLK---
1dfoB           DAALGRANITVNPFVTSGIRVGTPAITRRGFKEAEAKELAGWM---
3d6kA           VELAKEAIALTGAPNNENIRL--APSLPPVAELEVADGFATCV---
2c44C           CELYKVAGIRAVECPAELLRLIPRATYTQTHMDFIIEAFKHVK---
1c7gA           ASIYMETGVRSMEPKLETVRLIPRRVYTYAHMDVVADGIIKLY---
2bwnB           SDMLLDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAM-------
2dgkA           SERLRLRGWQVPATDIVVMRIMCRRGFEMDFAELLLEDYKASL---
1b8gA           KKIVYEVHLNISHCTEPGWFRVCFANLPERTLDLAMQRLKAFV---
3bc8A           GARFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCL---
3cbfA           FRRALEENVAFVPGGENTLRLSYAT-LDREGIAEGVRRLGRAL---
2d66A           LRLREEFGVYAVASG-----RVNVAGMTPDNMAPLCEAIVAVL---
3e77C           KALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFL---
2bwoB           DMLLSDYGVYVQPRGTERLRFTPSPVHDLKQIDGLVHAMDLLW---
3bcaA           GHTFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCL---
3dwkA           ----------------------------------------------
3dzzB           KYLREKTGLIISYRGNGHEFVRINLACPKELVIDGQRLKQGVL---
2dr1A           YEAMRKRGFELASVKEKTFRIGHMGYMKFEDIQEMLDNLREVI---
2bhgA           ----------------------------------------------
3dzzA           KYLREKTGLIIGYRGNGHEFVRINLACPKELVIDGQRLKQ------
1c0nA           GSFLDNYGIAVRYNVPAMCRASLAMYNTHEEVDRLVTGLQRIH---
1ay5B           VKRIKEEF-GIYMVGD--SRINIA-GLNDNTIPILARAIIE-----
3e77A           LDKALELNMLSGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFL---
3dydA           TERLVAESVHCLPATEYPNFIRVVITVPEVMMLEACSRIQEFC---
1djuA           SELMLKEARVAAFGKAGEGYVRISYATAYEKLEEAMERMERVL---
3dydB           TERLVAEQSVHCLPAEYPNFIRVVITVPEVMMLEACSRIQEFC---
3cq5B           WQAFLDRGVLIRDVGIGHLRTTI---GVPEENDAFLDAAAEII---
3d6kB           ELAKEAGIALTGAGSSENIRL--APSLPPVAELEVADGFATCV---
3cq4B           WQAFLDRGVLIRDVGIGHLRTTI---GVPEENDAFLDAAAEII---
2dkjA           EERLDAVGITVNPRVTSGIRIGTPAITTRGFTPEEMPLVAELI---
2aevA           GFNLLKNYGIIMPGASKSLRILTSRDAERIDDNYIIKAIVESI---
1d2fB           DDNALQKALIYTYGEEGRGFVRLNAGCPRSKLEKGVAGLINAI---
1bjoA           LEESFAAGLHALKGVVGGMRASIYNAMPLEGVKALTDFMVEFE---
3d6kC           VELAKEAGIALTGAGSENIRL--APSLPPVAELEVADGFATCV---
3bcxA           VKFLDEAKVGTRLLFNQTFWIGIYPGLTHDHLDYVVSKFEEF----
3cq4A           WQAFLDRGVLIRVGIAGHLRTTI---GVPEENDAFLDAAAEII---
3d6kD           TASRVVELAKALTGAGSSFPLHNDPSLPPVAELEVADGFATCV---
1ecxA           QNLLSGYGIYVSRIAQGAIRISLCKYNTEEEVDYFLKKIEEIL---
3cq6A           WQAFLDRGVLIRDVGIGHLRTTI---GVPEENDAFLDAAAEII---
3dr7B           IKDLDALGIESRPCGVDGLNLPTHAGLTEADIDRVIAALDQVLV--
2ch2A           SQYAMNFSLEVQGFGKAWRVGIMGECSTVQKIQFYLYGFKESL---
1bw0A           EKLLEEENVQVLPGTHAPGFTRLTTTRPVEVYREAVERIKAFC---
1d2fA           QKALIEQEKVATYGEEGRGFVRLNAGCPRSKLEKGVAGLINAI---
3cq5A           WQAFLDRGVLIRD--VGIAGHLRTTIGVPEENDAFLDAAAEII---
3bb8A           VKFLDEAKVGTRLLFNQTFWIGIYPGLTHDHLDYVVSKFEEF----
1dkrA           ----------------------------------------------
1agxA           ----------------------------------------------
1bjnA           LEESFAAGLHALKGHVGGMRASIYNAMPLEGVKALTDFMVEFE---
3bcxB           VKFLDEAKVGTRLLFNQTFWIGIYPGLTHDHLDYVVSKFEEF----
3b8xA           ----------------------------------------------
3dr4B           IKDLDALGIESRPVFVDGLNLPTHAGLTEADIDRVIAALDQVLV--
1b9iA           ----------------------------------------------
1b9hA           VDRLVEAGLPAFIYRTDAFWELGAPDESVDAIARRCPNTDAIS---
2bieB           LAKAKEQGFVGLNGSVGGCRASIYNAVPIDACIALRELMIQFK---
3b8xB           ----------------------------------------------
2bhxB           LAKAKEQGFVGLNGSVGGCRASIYNAVPIDACIALRELMIQFK---
2a7vA           ERVLELVSITANKITPGGLRLGAPALTSRQFREDDFRRVVDFI---
1c4kA           MAWRFEKGAKWHYVDPNKFMLTTPGINPETGDYEDFGVPATIV---
3caiA           VQRLADNGILAIANTGGAVTVGLAHYSTMAEVDQLVRALAS-----
1bs0A           AEKLRQQGCWVTAIRPARLRLTLTAAHEMQDIDRLLEVLHGN----
2bieA           LAKAKEQGFVGLNGHVGGCRASIYNAVPIDACIALRELMIQFK---
1djuB           SELMLKEARVAAFGKAGEGYVRISYATAYEKLEEAMERMERVL---
1eg5A           QNLLSGYGIYVSRIAQGAIRISLCKYNTEEEVDYFLKKIEEIL---
3bn1D           IKDLDALGIESRPVFVDGLNLPTHAGLTEADIDRVIAALDQVLV--
2douB           GLRLVERGVALAPGRGGFVR--IALVRPLEELLEAAKRIREAL---
1dfoA           DAALGRANITVNPFVTSGIRVGTPAITRRGFKEAEAKELAGWM---
2c7tA           IKVMKRPPQVSRQTYYGYVFRFDPVKFGGLNADQFCEILR------
1bybA           ----------------------------------------------
2c0rA           VKASEQEGFVGLKGSVGGLRASIYNAVPYESCEALVQFMEHFK---
3e77B           LDKALELNMLSLKGSVGGIRASLYNAVTIEDVQKLAAFMKKFL---
1btcA           ----------------------------------------------
1bw0B           EKLLEEENVQVLPGTHAPGFTRLTTTRPVEVYREAVERIKAFC---
2ch1A           QYAMNNFSLEVQGFGKAWRVGIMGECSTVQKIQFYLYGFKESL---
3dr4D           IKDLDALGIESRPCGVDGLNLPTHAGLTEADIDRVIAALDQVLV--
2bwpB           SDMLLDYGVYVQPINTERLRFTPSPVHDLKQIDGLVHAMDL-----
3dr4A           IKDLDALGIESRPVFVDGLNLPTHAGLTEADIDRVIAALDQVLV--
1ay4A           VKRIKEEFGIY-MVGD--SRINIA-GLNDNTIPILARAIIE-----
3bn1C           IKDLDALGIESRPCGVDGLNLPTHAGLTEADIDRVIAALDQVLV--
2c81A           CEILREKLNMGTFYPYLPVHKNPLFCPWTKNRYLKSVRKTEAY---
2e7jA           ISKKAKGGRFFLYRGLTRYFKLSTYGLSDEEVDYVLNAFKEII---
1djeA           AEKLRQQGCWVTGIRIARLRLTLTAAHEMQDIDRLLEVLHGN----
2douA           GLRLVERGVALAPGRGGFVR--IALVRPLEELLEAAKRIREAL---
3ca8B           ----------------------------------------------
2bkwA           IAFLKSHGVVIAGIGPKYIRIGHGVTACNKNLPNCFDLIKLAL---
3c3jC           ----------------------------------------------
3d1rA           ----------------------------------------------
1cj0A           EKVLEACSIACNALRPSGLRLGTPALTSEKDFQKVAHFIHRG----
2dqxA           ----------------------------------------------
3ca8A           ----------------------------------------------
2aeuA           GFNLLKNYGIITITASKSLRILTSRDAERIDDNYIIKAIVESI---
1cj0B           EKVLEACSIACNALRPSGLRLGTPALLLEKDFQKVAHFIHRG----
2cdmA           ----------------------------------------------
2a8iB           ----------------------------------------------
1cliB           ----------------------------------------------
3bn1A           IKDLDALGIESRPVFVDGLNLPTHAGLTEADIDRVIAALDQVLV--
3dr4C           IKDLDALGIESRPVFVDGLNLPTHAGLTEADIDRVIAALDQVLV--
1c8nA           ----------------------------------------------
3a2bA           TKMLQDDGVFVNPAEESLIRFSLMATHTYDQIDEAIEKMVKVF---
3brmA           ----------------------------------------------
1e5eA           LDNLKLITLAVSLGGDGMIRLSVGIEDADELIADFKQGLDAL----
1awiA           ----------------------------------------------
3blvH           ----------------------------------------------
1e5eB           LDNLKLITLAVSLGGCGMIRLSVGIEDADELIADFKQGLDAL----
2btwA           ----------------------------------------------
3e6gD           ----------------------------------------------
3e6gB           ----------------------------------------------
2cb1A           ----------------------------------------------
1c8fA           ----------------------------------------------
1c8eA           ----------------------------------------------
3d19E           ----------------------------------------------
3bh1C           ----------------------------------------------
3d19A           ----------------------------------------------
3e6gA           ----------------------------------------------
1dy2A           ----------------------------------------------
1eghA           ----------------------------------------------
2ctzA           ----------------------------------------------
1bxgA           ----------------------------------------------
3blvD           ----------------------------------------------
3cogB           ----------------------------------------------
2b34A           ----------------------------------------------
1b1xA           ----------------------------------------------
1ei7A           ----------------------------------------------
2bu3A           ----------------------------------------------