[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO49533.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bwmA.bssp"
#ERROR : Can't open dsspfile "2bwrA.bssp"
#ERROR : Can't open dsspfile "3ckaA.bssp"
#ERROR : Can't open dsspfile "3ec5A.bssp"

## Summary of PDB Search
:2558
    2e-22  17%  2bwmA  [x.x.x] PSATHYRELLA VELUTINA LECTIN PVL
    5e-22  17%  2bwrA  [x.x.x] PSATHYRELLA VELUTINA LECTIN
    8e-13  12%  3ckaA  [x.x.x] OUTER SURFACE PROTEIN A
    7e-05  12%  3ec5A  [x.x.x] OUTER SURFACE PROTEIN A
:2558

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYSCLMPAGGKFDTLKVGNSTAVPVSTGQIRYNFV
2bwmA           ---------------------------------------------------------------------A
2bwrA           ------------------------------------WISTNNGNNTFVDPPKMVLANFAYAAGGWRVEKA
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DLYGDGIPGLLYSDDKATLYWKPKGNGEYEYPEPAAQFPIEKDLKKGEYTLVSLEGNGRLDLVVGTPQRG
2bwmA           DLRKTGRADIVGFGDGGIYISRNNGGGQFAPAQLALNNFGYAQGWRLDRHLRFVTGDGLLDVVGFGENQV
2bwrA           DLRKTGRADIVGFGDGGIYISRNNGGGQFAPAQLALNNFGYAQGWRLDRHLRFLAGDGLLDVVGFGENQV
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GFYEGNPDGSWHSYRDFATYPLDFTNSHKEMIDMNGDGLADLLLYEDNTAKIYPSLKKKGYGIPTRASLS
2bwmA           YIARNSGNGTFQPAQAVVNNFCTISAHPRVVADLTGDRKADILGFGVAGVYTSLNNGNGTFGAVNLVLKD
2bwrA           YIARNSGNGTFVNNFCIGAGGWTISAHPRVVADLTGDRKADILGFGVAGVYTSL-NNGNGTFGAVNLVLK
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EDYPTTSNGYAEEVLSYADMFGDGMAHRVRIRNGSVECWPNLGHGRFGKRVLFANAPRFGDTLDASRLFL
2bwmA           FGVNSGWRVEKH-VRCVSSLTNKKVGDIIGFGDAGVYVALNNGNGTFGPVKRVIDNFGYGWRVDKHPRFV
2bwrA           DFGVNSGWRVEKHVRCVSSLTNKKVGDIIGFGDAGVYVALNNGNGTFGPRVIDNFGYNQGWRVDKHPRFV
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ADLDGTGMTDLIYAYPDKVQVFFNQGGNSFSPPLSIPLPETYSNLDQLGFADVKGNGxxxxxxxxxxxxx
2bwmA           VDLTGDGCADIVGFGENSVWACMNKGDGTFGPIMKLIDDMTVSKGWTLKTVRYAANL-------------
2bwrA           VDLTGDGCADIVGFGENSVWACMNKGDGTFGPIMKLIDDMTVSKGWTLKTVRYAAN--------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKGKAVQTDRQFLADYKK
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           -----------------------------------------------------GSMKVLVSKSSNADYDL


                         .         .         .         .         *         .         .:1820
query           EANWDNVNKSSLADELFSIGCSYDALERVISETAPDGSIYTHIYNQAGLLRKVVVAFKDGSEEEFIKDIQ
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ---------------------KADASKVKLTISDDLGQTTLEVFKSDGTLVSKKVTSKDKSST--YELFN
3ec5A           IATVDA-------LELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTL-EVFKSDGSKSSTYELFN


                         .         .         +         .         .         .         .:1890
query           YNANGQRLKIIYGNGVTTEYSYTDPALRLTDILSLKPDSNNTKDFKGCLLQKIHYTYDPVGNVTRLRDNS
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           EKGELSFKYITRADKSSTYELF-NEKGELSFK---------YITRADKSSTYELFNEKGELSFKYITRAD
3ec5A           EKGELSLKYITRADKSSTYELFNEKGELSLKYITRADKSSTYELFNEKGELSEKKITRADKSSTYELFNE


                         *         .         .         .         .         +         .:1960
query           YPTVFYNQQKVEPLSDYSYNPLYQLVSATGRQHPGIFDGSHRDGFKQSKFIPIKSSNPNDGTSLENYRQD
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           KSST-----------YELFNEKGELSFKYITRADGDGSGKAKEVLKGYVLGTLTAEKTTLVVKEGTVTLS
3ec5A           KGELSLKYITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLV----VKEG------TVTLS


                         .         .         .         *         .         .         .:2030
query           YQYDEAGNLTNIRHISSSTSWTRQLDISKGTNRTVQIASLNGAKNFFKTAYDPCGNMLNLENLASINWSY
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           KNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTINSKKTKDLVFTSSYDSNGTSLEGSAVEITKLDE
3ec5A           KNISKSGEVSVELNDTDSSAATKKTAWNSGTSTLTITVNSKKTKDLVFTSYDSNGTSLEGSAVEITKLDE


                         .         +         .         .         .         .         *:2100
query           RNNLSRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           IKNALK----------------------------------------------------------------
3ec5A           IKNALK----------------------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           ----------------------------------------------------------------------
2bwrA           ----------------------------------------------------------------------
3ckaA           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bwmA           --------------------------------------
2bwrA           --------------------------------------
3ckaA           --------------------------------------
3ec5A           --------------------------------------