[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO49673.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d2rB.bssp"
#ERROR : Can't open dsspfile "2bu8A.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"
#ERROR : Can't open dsspfile "2e0aB.bssp"
#ERROR : Can't open dsspfile "2bu6A.bssp"
#ERROR : Can't open dsspfile "3crkB.bssp"
#ERROR : Can't open dsspfile "2e0aA.bssp"
#ERROR : Can't open dsspfile "2bu7A.bssp"
#ERROR : Can't open dsspfile "2btzA.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "3crlB.bssp"
#ERROR : Can't open dsspfile "3crkA.bssp"
#ERROR : Can't open dsspfile "3d2rA.bssp"
#ERROR : Can't open dsspfile "2bu5A.bssp"
#ERROR : Can't open dsspfile "3clqD.bssp"
#ERROR : Can't open dsspfile "3dgeA.bssp"
#ERROR : Can't open dsspfile "2avwB.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "3clqB.bssp"
#ERROR : Can't open dsspfile "3clqA.bssp"
#ERROR : Can't open dsspfile "2avwA.bssp"
#ERROR : Can't open dsspfile "2bu2A.bssp"
#ERROR : Can't open dsspfile "2crkA.bssp"
#ERROR : Can't open dsspfile "3ehjB.bssp"
#ERROR : Can't open dsspfile "1b3qB.bssp"
#ERROR : Can't open dsspfile "3d36A.bssp"
#ERROR : Can't open dsspfile "1b3qA.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "3ehhB.bssp"
#ERROR : Can't open dsspfile "3cgzA.bssp"
#ERROR : Can't open dsspfile "3ehfD.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"
#ERROR : Can't open dsspfile "3ehfA.bssp"
#ERROR : Can't open dsspfile "3b2mC.bssp"
#ERROR : Can't open dsspfile "3cgzB.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "2c13B.bssp"
#ERROR : Can't open dsspfile "3b2mB.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "2cg9B.bssp"
#ERROR : Can't open dsspfile "3caxA.bssp"
#ERROR : Can't open dsspfile "3ehhA.bssp"
#ERROR : Can't open dsspfile "1ah8A.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1byqA.bssp"
#ERROR : Can't open dsspfile "3cwvA.bssp"
#ERROR : Can't open dsspfile "2dvyF.bssp"
#ERROR : Can't open dsspfile "2breA.bssp"
#ERROR : Can't open dsspfile "3cgzC.bssp"
#ERROR : Can't open dsspfile "1csgA.bssp"
#ERROR : Can't open dsspfile "3ehgA.bssp"
#ERROR : Can't open dsspfile "2cgfA.bssp"
#ERROR : Can't open dsspfile "2dvyD.bssp"
#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "1drmA.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "2dvyC.bssp"
#ERROR : Can't open dsspfile "3cgyA.bssp"
#ERROR : Can't open dsspfile "2akpB.bssp"
#ERROR : Can't open dsspfile "2cg9A.bssp"
#ERROR : Can't open dsspfile "2cw9A.bssp"
#ERROR : Can't open dsspfile "3ehjA.bssp"
#ERROR : Can't open dsspfile "2c13A.bssp"
#ERROR : Can't open dsspfile "1dp8A.bssp"
#ERROR : Can't open dsspfile "2cmnA.bssp"
#ERROR : Can't open dsspfile "2ccsA.bssp"
#ERROR : Can't open dsspfile "3cgyB.bssp"
#ERROR : Can't open dsspfile "2akpA.bssp"
#ERROR : Can't open dsspfile "1ei1A.bssp"
#ERROR : Can't open dsspfile "3cgyC.bssp"
#ERROR : Can't open dsspfile "3bz1C.bssp"
#ERROR : Can't open dsspfile "2byhA.bssp"
#ERROR : Can't open dsspfile "1d06A.bssp"
#ERROR : Can't open dsspfile "1eh8A.bssp"
#ERROR : Can't open dsspfile "2dvyA.bssp"
#ERROR : Can't open dsspfile "1e51A.bssp"
#ERROR : Can't open dsspfile "1ah6A.bssp"
#ERROR : Can't open dsspfile "3c2wC.bssp"
#ERROR : Can't open dsspfile "1bknB.bssp"
#ERROR : Can't open dsspfile "3bwlB.bssp"
#ERROR : Can't open dsspfile "2b02A.bssp"
#ERROR : Can't open dsspfile "2d01A.bssp"
#ERROR : Can't open dsspfile "1b62A.bssp"
#ERROR : Can't open dsspfile "2d02A.bssp"
#ERROR : Can't open dsspfile "2bz5A.bssp"
#ERROR : Can't open dsspfile "3c2wD.bssp"
#ERROR : Can't open dsspfile "1bdvB.bssp"
#ERROR : Can't open dsspfile "3ckeD.bssp"
#ERROR : Can't open dsspfile "3eehA.bssp"
#ERROR : Can't open dsspfile "1bdtB.bssp"
#ERROR : Can't open dsspfile "3bwlC.bssp"
#ERROR : Can't open dsspfile "2cwoA.bssp"
#ERROR : Can't open dsspfile "3c11A.bssp"
#ERROR : Can't open dsspfile "3bwlD.bssp"
#ERROR : Can't open dsspfile "1ah8B.bssp"
#ERROR : Can't open dsspfile "3bwlA.bssp"
#ERROR : Can't open dsspfile "3bmyA.bssp"
#ERROR : Can't open dsspfile "3bjeA.bssp"
#ERROR : Can't open dsspfile "3c2wB.bssp"
#ERROR : Can't open dsspfile "3bnxA.bssp"
#ERROR : Can't open dsspfile "2de0X.bssp"
#ERROR : Can't open dsspfile "2a24B.bssp"
#ERROR : Can't open dsspfile "3c2wH.bssp"
#ERROR : Can't open dsspfile "1bywA.bssp"
#ERROR : Can't open dsspfile "1bknA.bssp"
#ERROR : Can't open dsspfile "3c2wA.bssp"
#ERROR : Can't open dsspfile "1d7eA.bssp"
#ERROR : Can't open dsspfile "3b33A.bssp"
#ERROR : Can't open dsspfile "3c0eA.bssp"
#ERROR : Can't open dsspfile "1bdtA.bssp"
#ERROR : Can't open dsspfile "1ea6B.bssp"
#ERROR : Can't open dsspfile "2a24A.bssp"
#ERROR : Can't open dsspfile "1ea6A.bssp"
#ERROR : Can't open dsspfile "3bnyC.bssp"
#ERROR : Can't open dsspfile "3c2wG.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "3bulA.bssp"
#ERROR : Can't open dsspfile "2c19B.bssp"
#ERROR : Can't open dsspfile "2c14B.bssp"
#ERROR : Can't open dsspfile "3c2wF.bssp"
#ERROR : Can't open dsspfile "2btvA.bssp"
#ERROR : Can't open dsspfile "3c2wE.bssp"
#ERROR : Can't open dsspfile "2dvyB.bssp"
#ERROR : Can't open dsspfile "3bs2A.bssp"
#ERROR : Can't open dsspfile "2brcA.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "2c18B.bssp"

## Summary of PDB Search
:578
    2e-37  14%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    4e-37  13%  2bu8A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    3e-36  15%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    1e-34  14%  2e0aB  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    2e-34  14%  2bu6A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    5e-34  14%  3crkB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    5e-34  13%  2e0aA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    6e-34  14%  2bu7A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    1e-33  14%  2btzA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    3e-33  31%  3d36B  [x.x.x] SPORULATION KINASE B
    3e-33  14%  3crlB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    3e-33  14%  3crkA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    3e-32  15%  3d2rA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    8e-32  16%  2bu5A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    8e-32  14%  3clqD  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-30  27%  3dgeA  [x.x.x] SENSOR PROTEIN
    7e-30   8%  2avwB  [x.x.x] IGG-DEGRADING PROTEASE
    8e-30  26%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    3e-29  12%  3clqB  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-28  12%  3clqA  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-28   8%  2avwA  [x.x.x] IGG-DEGRADING PROTEASE
    9e-28  12%  2bu2A  [x.x.x] PYRUVATE DEHYDROGENSAE KINASE ISOENZYME 2
    2e-26   8%  2crkA  [a.83.1 - d.128.1] PROTEIN (CREATINE KINASE)
    7e-26  12%  3ehjB  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    8e-26  19%  1b3qB  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    3e-25  34%  3d36A  [x.x.x] SPORULATION KINASE B
    4e-25  15%  1b3qA  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    5e-23  27%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    2e-22  13%  3ehhB  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    3e-21  22%  3cgzA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    3e-20  14%  3ehfD  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    2e-19  13%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    2e-19  18%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    2e-19  12%  3ehfA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    3e-19  12%  3b2mC  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN SPY0128
    7e-19  19%  3cgzB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    2e-18  12%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    5e-18  14%  2c13B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    6e-18  13%  3b2mB  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN SPY0128
    6e-18  20%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    7e-18  13%  2cg9B  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    7e-18  15%  3caxA  [x.x.x] UNCHARACTERIZED PROTEIN PF0695
    1e-17  10%  3ehhA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    2e-17  14%  1ah8A  [d.122.1] HEAT SHOCK PROTEIN 90
    4e-17  17%  1aj6A  [x.x.x] GYRASE
    4e-17  13%  1byqA  [d.122.1] PROTEIN (HEAT SHOCK PROTEIN 90)
    6e-17   6%  3cwvA  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    6e-17  13%  2dvyF  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    1e-16  14%  2breA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-16  20%  3cgzC  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    3e-16  12%  1csgA  [a.26.1] GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR
    6e-16  15%  3ehgA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    1e-15  14%  2cgfA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    2e-15  13%  2dvyD  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    4e-15  17%  1b63A  [d.122.1 - d.14.1] MUTL
    4e-15  17%  1drmA  [d.110.3] SENSOR PROTEIN FIXL
    8e-15   6%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    9e-15  16%  2dvyC  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    1e-14  17%  3cgyA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    2e-14  15%  2akpB  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    2e-14  13%  2cg9A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    3e-14  10%  2cw9A  [x.x.x] TRANSLOCASE OF INNER MITOCHONDRIAL MEMBRANE
    3e-14  11%  3ehjA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    4e-14  13%  2c13A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    6e-14  15%  1dp8A  [d.110.3] FIXL PROTEIN
    6e-14  15%  2cmnA  [x.x.x] SENSOR PROTEIN FIXL
    7e-14  12%  2ccsA  [x.x.x] HEAT SHOCK PROTEIN HSP-90 ALPHA
    8e-14  18%  3cgyB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    1e-13  13%  2akpA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-13  18%  1ei1A  [d.122.1 - d.14.1] DNA GYRASE B
    2e-13  22%  3cgyC  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    3e-13  11%  3bz1C  [x.x.x] PHOTOSYSTEM II CP43 PROTEIN
    4e-13  12%  2byhA  [x.x.x] HEAT SHOCK PROTEIN HSP90-ALPHA
    4e-13  14%  1d06A  [d.110.3] NITROGEN FIXATION REGULATORY PROTEIN FIXL
    5e-13   8%  1eh8A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    6e-13  17%  2dvyA  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    1e-12   8%  1e51A  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    1e-12  11%  1ah6A  [x.x.x] HEAT SHOCK PROTEIN 90
    2e-12   5%  3c2wC  [x.x.x] BACTERIOPHYTOCHROME
    3e-12  20%  1bknB  [d.122.1 - d.14.1] MUTL
    4e-12  18%  3bwlB  [x.x.x] SENSOR PROTEIN
    5e-12  14%  2b02A  [x.x.x] ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
    5e-12  15%  2d01A  [x.x.x] PHOTOACTIVE YELLOW PROTEIN
    7e-12  18%  1b62A  [d.122.1 - d.14.1] PROTEIN (MUTL)
    8e-12  14%  2d02A  [x.x.x] PHOTOACTIVE YELLOW PROTEIN
    9e-12  10%  2bz5A  [x.x.x] HEAT SHOCK PROTEIN HSP90-ALPHA
    1e-11   9%  3c2wD  [x.x.x] BACTERIOPHYTOCHROME
    2e-11  11%  1bdvB  [a.43.1] PROTEIN (ARC FV10 REPRESSOR)
    2e-11  10%  3ckeD  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-11  12%  3eehA  [x.x.x] PUTATIVE LIGHT AND REDOX SENSING HISTIDINE
    3e-11  11%  1bdtB  [a.43.1] PROTEIN (GENE-REGULATING PROTEIN ARC)
    3e-11  16%  3bwlC  [x.x.x] SENSOR PROTEIN
    3e-11  10%  2cwoA  [x.x.x] RNA SILENCING SUPPRESSOR
    3e-11  13%  3c11A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    5e-11  18%  3bwlD  [x.x.x] SENSOR PROTEIN
    5e-11  12%  1ah8B  [d.122.1] HEAT SHOCK PROTEIN 90
    7e-11  18%  3bwlA  [x.x.x] SENSOR PROTEIN
    8e-11  12%  3bmyA  [x.x.x] HEAT SHOCK PROTEIN HSP 90-ALPHA
    8e-11  14%  3bjeA  [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE
    1e-10   9%  3c2wB  [x.x.x] BACTERIOPHYTOCHROME
    1e-10  11%  3bnxA  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-10   9%  2de0X  [x.x.x] ALPHA-(1,6)-FUCOSYLTRANSFERASE
    2e-10  14%  2a24B  [x.x.x] ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
    2e-10   9%  3c2wH  [x.x.x] BACTERIOPHYTOCHROME
    2e-10  24%  1bywA  [d.110.3] PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
    3e-10  26%  1bknA  [d.122.1 - d.14.1] MUTL
    4e-10   8%  3c2wA  [x.x.x] BACTERIOPHYTOCHROME
    4e-10  17%  1d7eA  [d.110.3] PHOTOACTIVE YELLOW PROTEIN
    4e-10  17%  3b33A  [x.x.x] SENSOR PROTEIN
    5e-10  13%  3c0eA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    6e-10  12%  1bdtA  [a.43.1] PROTEIN (GENE-REGULATING PROTEIN ARC)
    1e-09  14%  1ea6B  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    2e-09  10%  2a24A  [x.x.x] ENDOTHELIAL PAS DOMAIN PROTEIN 1
    2e-09  17%  1ea6A  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    1e-08   5%  3bnyC  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-08  11%  3c2wG  [x.x.x] BACTERIOPHYTOCHROME
    4e-08   8%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    5e-08  11%  3bulA  [x.x.x] METHIONINE SYNTHASE
    2e-07  15%  2c19B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    5e-07  13%  2c14B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    6e-07   9%  3c2wF  [x.x.x] BACTERIOPHYTOCHROME
    8e-07  14%  2btvA  [e.28.1] PROTEIN (VP3 CORE PROTEIN)
    1e-06   9%  3c2wE  [x.x.x] BACTERIOPHYTOCHROME
    7e-06  15%  2dvyB  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    1e-05   8%  3bs2A  [x.x.x] LIPOCALIN
    3e-05  11%  2brcA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    5e-05   9%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    5e-04  13%  2c18B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
:578

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d2rB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
3bz1C           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
1bdtB           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3c2wH           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAEHLAGNN
3d2rB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
3bz1C           --------------------------------------------------------------GWIVSVNN
2byhA           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
1bdtB           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3c2wH           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GIGSVLATGIPLAVLGAEHFVKDFHRWSCVGSPIIGDKGDIIAVLGVFMPCGMESPYTFSLTVAATKAVE
3d2rB           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3caxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1drmA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
1dp8A           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
3bz1C           LVGGHIWIGLICIAGGIWHLTTGWARRAFIWSGEAYLSYSLGAL--SMMGFIATCFVWFNNTVYPSEFYG
2byhA           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c2wC           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3c2wD           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
1bdtB           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3c2wH           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
3c2wG           ---------------------------ASMSISIVGGKLWGLFSCHHMSPKLIPYPVRMSFQIFSQVCSA
3c2eA           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
2btvA           -----------------------------------------------------------DFTVPDVQQIL
3c2wE           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AAIKQGQMEKQLQDTRKTLRNLMQQRNIIFNAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFF
3d2rB           -------------------------------------------------PREVEHFSRYSPSPLSMKQLL
2bu8A           ------QFLDFGSSNACEKTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIM--
3crlA           ------------------------------------------------LAGAPKYIEHFSKFSPSPLSMK
2e0aB           -------------------------------------------------PREVEHFSRYSPSPLSMKQL-
2bu6A           ----------------------------------------------------------------------
3crkB           ------------------------------------------------LAGAPKYIEHFSKFSPSPLSMK
2e0aA           -------------------------------------------------PREVEHFSRYSPSPLSMKQLL
2bu7A           ---------------------------------------------------SAPKYIEHFSKFSPSPLSM
2btzA           ---------------------------------------------------APKYIEHFSKFSPSPLSMK
3d36B           ----------------------------------------------------------------------
3crlB           ------------------------------------------------LAGAPKYIEHFSKFSPSPLSMK
3crkA           ------------------------------------------------LAGAPKYIEHFSKFSPSPLSMK
3d2rA           ----------------------------------------------------------------------
2bu5A           -------------------------------------------------PKYIEHFSKFSPSPLSMKQFL
3clqD           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
2bu2A           ------------------------------------------------------------APKYIEHFSK
2crkA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3caxA           -------LKREEDIDLGTGYLNIEELKAIFEALPVDVTFIDKDDRVRFFSPGERIFTRTPSVLGRPVQLC
3ehhA           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1drmA           --------------------------------IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVN
1e51B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
1dp8A           -----------------------------------AMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVN
2cmnA           -----------------------------------AMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVN
2ccsA           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
3bz1C           PTGPEASQAQA-MTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
2byhA           ----------------------------------------------------------------------
1d06A           ------ETEDVVRARDAHLRSI-------LDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLR
1eh8A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c2wC           -------------PVTLANCEDEPIHVPGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE
1bknB           ----------------------------------------------------------------------
3bwlB           --------EKRLEETSSRLEAL--------FENSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIW
2b02A           ----------------------------NVSQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNFC
2d01A           --------AFGSEDIENTLAKMDDG---QLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFF
1b62A           ----------------------------------------------------------------------
2d02A           -------MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGQDPKQVIGKNFF
2bz5A           ----------------------------------------------------------------------
3c2wD           -------------PVTLANCEDEPIHVPGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE
1bdvB           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3eehA           ----------------------------LTEATNDILWEFTADSEVLVINSAYEDIWGRSVAKLRENPHD
1bdtB           ----------------------------------------------------------------------
3bwlC           -----------LEETSSRLEALFE--------NSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIW
2cwoA           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
3bwlD           ------RREKRLEETSSRLEALFE--------NSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIW
1ah8B           ----------------------------------------------------------------------
3bwlA           --------EKRLEETSSRLEALFE--------NSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIW
3bmyA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wB           -------------PVTLANCEDEPIHVPGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE
3bnxA           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
2a24B           ---------------------------------TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIV
3c2wH           -----------------ANCEDEPIHVPGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE
1bywA           ---------------------------------SRKFIIANENCAVIYCNDGFCELCGYSRAEVMQRPCT
1bknA           ----------------------------------------------------------------------
3c2wA           -------------PVTLANCEDEPIHVPGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE
1d7eA           -------VAFGSEDIENTLAKMDDG---QLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFF
3b33A           ----------------------------AILNNVTATLILDDGLAIRYANPAAELLFSQSAKRIVEQSLS
3c0eA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2a24A           -----------------------------------FLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAY
1ea6A           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
3c2wG           IVERLEQGRIAELLRVSTERRLALARRALAHPDDGIAALIPCDGALVMLGGRTLSIRGDFERQAGNVLQR
3c2eA           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
3c2wF           --------------TLANCEDEPIHVPG-AIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQV
2btvA           DDIKALAAEQVYKIVKVPSRHIVTQSRDRVLRVDTYYEEMSQVGDVITEDEPEKFYSTIIKKVRFIRGKG
3c2wE           --------------TLANCEDEPIHVPG-AIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE
2dvyB           ----------------------------------------------------------------------
3bs2A           -----NDAAQTATYTNLGSGNQLTQQTASASISGNAIVVGTDHSEVLYSDGSTCDVVRLNGQIELWIHSS
2brcA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           CFSRCRRAEPLLIRSLKEANSFTNIECKCSNLLHEKYILVNISLLRDEKNAVSGAIGIYTDVTELRRQEA
3d2rB           DFGSENACERTSFAFLRQE--------------LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLM
2bu8A           -----EFLDKDPEDHRTLSQFTDALVTIR----NR---------HNDVVPTMAQGV---------LEYKD
3crlA           QFLDFGSSNACEKTSFTFLRQELPVRL--ANIMKE------INLLPDRVLSTPSVQLVQSWYVQSLLDIM
2e0aB           --LDFGSCERTSFAFLRQE--------------LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLM
2bu6A           --------------------------------------MKEINLLPDRVLSTPSVQLVQSWYVQSLLDIM
3crkB           QFLDFGSSNACEKTSFTFLRQELPVRLANI----MKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLD
2e0aA           DFGSCERTSFAFLRQE-----------------LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLM
2bu7A           QFLDFGSSNACEKTSFTFLRQELPVR--------LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIM
2btzA           QFLDFGSSNACEKTSFTFLRQELPVRLAN--------IMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIM
3d36B           ----------------------------------------------------------------------
3crlB           QFLDFGSSNACEKTSFTFLRQELPVR--------LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDDK
3crkA           QFLDFGSSNACEKTSFTFLRQELPVR--------LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLLDK
3d2rA           ---------------------------------LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLF
2bu5A           DFSN-----------ACEKTSFTFLRQELPVRLAN--IMKEINLLPDRVLSTPSVQLVQSWYVQSLLDDK
3clqD           ----------------------------------ETTILHAGPPITYENCGPKGAV---QGALVFEGLAK
3dgeA           ----------------------------------------------------------------------
2avwB           ------------------------------------------------------TSVWTKGVTPPANFTQ
2c2aA           -------------------------------------------------------------MENVTESKE
3clqB           ----------------------------------ETTILHAGPPITYENCGPKGAV---QGALVFEGLAK
3clqA           ---------------------------------TETTILHAGPPITYENCGPKGAV---QGALVFEGLAK
2avwA           ------------------------------------------------------TSVWTKGVTPPANFTQ
2bu2A           FSLSMKQFLDFSNACEKTSFTFLRQEL----PVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLLDK
2crkA           --------------------------------------------------------------TGVDNPGH
3ehjB           ---------------------------------------------------------------ERERLEE
1b3qB           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3caxA           HPPKSVYVVNKILKAFKEGRKKEATFWLRL---REKYVYIKYVPLFNEKGEYIGTLEMTMDIAPYKKIEG
3ehhA           -----------------------------------------------------------------ERIAE
1ah8A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
1csgA           -----------------------------------------RRLLNLSRDTAAEMNETVEVISEMFDLQE
3ehgA           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1drmA           ILSRHDSYISRYRTTSDPHIIGIGRIVTG-KRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQA
1e51B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cw9A           -----------------------------------------------------AFIRASRALTDKVTDLT
3ehjA           ---------------------------------------------------------------DANERIA
2c13A           ----------------------------------------------------------------------
1dp8A           ILMPEDSYISRYRTTSDPHIIGIGRIVTGKR-RDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQA
2cmnA           ILMPEPDRSRHDSYISAYRTTSDPHIIGIGRIVTGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQA
2ccsA           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
3bz1C           NGDIQPWQERRAAEYMTHAPL-GSLNSVGGVATSVNFVSPRSWLATSHFVLAFFFLV--GHLWHAGRFEK
2byhA           ----------------------------------------------------------------------
1d06A           ILMPEPYRHEHYLQRYMATGEKRIIGIDRVVSGQRKPMKLAVGEMRSGG--ERFFTGFIRDLT-------
1eh8A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c2wC           QVGPEVLRMLEGLTGNGPWSNSVETRIGEHL-FDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIA
1bknB           ----------------------------------------------------------------------
3bwlB           EFDLFDAEDVQTQLSGFSVDERRKFEGLYERRDGSTSVEVHLLRFNLEG--EDRFLAISRDI--------
2b02A           HPEDQQLLRDSFQQVVKLKGQVLSVFRFRSKNQEWLWRTSSFTFQNPYSDEIEYIICTNTNV--------
2d01A           KDTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV------------
1b62A           ----------------------------------------------------------------------
2d02A           KDVAPPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV------------
2bz5A           ----------------------------------------------------------------------
3c2wD           QVEVLRMLEEGLTGNGPWSNSVET-RIGEHL-FDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIA
1bdvB           ----------------------------------------------------------------------
3ckeD           ---------------------------------------------------------------EILEPVF
3eehA           FLNGIHPEDRELMKDTMQSLMDGESADVECRVNAQRWVWIQGEPITNDAGETVRVAGFARDIT-------
1bdtB           ----------------------------------------------------------------------
3bwlC           EFDLFDAEDVQTQLSGFSVDERRKFEGLYERRDGSTSVEVHLLRFNLEG--EDRFLAISRDI--------
2cwoA           ---------------------------------------------------QSEISECVDEFNELASFNH
3c11A           ----------------------------------------------------------------------
3bwlD           EFDLFDAEDVQTQLSGFSVD--ERRKFEGLYERRDGSTSVEVHLLRFNLEGEDRFLAISRDI--------
1ah8B           ----------------------------------------------------------------------
3bwlA           EFDLFDAEDVQTQLSGFSVDERRKFEGLYERRDGSTSVEVHLLRFNLEG--EDRFLAISRDI--------
3bmyA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wB           QVEVLRMLEEGLTGNGPWSNSVETRIGEHL--FDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIA
3bnxA           ---------------------------------------------------------------ILEPVFL
2de0X           ----------------------------------------------------------------------
2a24B           EFEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNEWLWMRTSSFTFQNPYSEIEYIICTNTNV--------
3c2wH           QVVLRMLEEGLTGNGPWSNSVETRIGEHLFDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIAQVQ
1bywA           CDFLHRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVME------
1bknA           ----------------------------------------------------------------------
3c2wA           QVGPEVLRM-LEEGLTGNGPWSNSVETRIGE-HLFDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRI
1d7eA           KDTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMK---------------------------
3b33A           LIQHASLDLALLTQPLQSGQSITDSDVTFVV-DGRPLLEVTVSPITWQR---------------------
3c0eA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2a24A           EFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAGYVWLETQGTVIYNPRLQPQCIMCVNYVLSE--IE--
1ea6A           ----------------------------------------------------------------------
3bnyC           ------------------------------------------------------------------FLFM
3c2wG           LQRDPER-DIYHTDNWDCCGV---LAIRFHRQESGWIFW-----FRHEEVHRIRWGGKPEKLLTIGPSGP
3c2eA           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
3c2wF           GPEVLRMLEEGLTGNGPWSNSVETRIGEHLFDVIGHSYKEVFYLEFEIRTTLSITSFTLNAQRIIAQVQL
2btvA           SFILH-----------------------------------------------------------------
3c2wE           QV--------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bs2A           ATSNLNSCCTDKFNQEKGSRPEH-----------------------------------------------
2brcA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RIREQEKLAVVGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ
3d2rB           DLVEPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKACTVDPVQYFLDRFYMNRISTRMLMNQHIL
2bu8A           TYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPK---HIGSIDPNCNVSEVVKDAYD
3crlA           EFLDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSIQYFLDRFYLSRISIRMLINQHTL
2e0aB           DLVEFDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDVTNQNLQYFLDRFYMNRISTRMLMNQHIL
2bu6A           EFEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSIQYFLDRFYLSRISIRMLINQHTL
3crkB           KDPEDRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQYFLDRFYLSRISIRMLINQHTL
2e0aA           DLVEPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDLQYFLDRFYMNRISTRMLMNQHIL
2bu7A           EFLDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSIQYFLDRFYLSRISIRMLINQHTL
2btzA           EFLDKDPEDHRTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSIQYFLDRFYLSRISIRMLINQHTL
3d36B           ---PHMVIRAEKHLAASISHEIRNPLTAARGFIQLIEEQPLAAD-KRRQYARIAIEELDRAEAIITDYLT
3crlB           DPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSIQYFLDRFYLSRISIRMLINQHTL
3crkA           DPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSIQYFLDRFYLSRISIRMLINQHTL
3d2rA           HEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACDPVLQYFLDRFYMNRISTRMLMNQHIL
2bu5A           DPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSIQYFLDRFYLSRISIRMLINQHTL
3clqD           DLADADRVARSGAITFSPCHEHDAVGSAGVTSPNYVHIIKNETYGNTSEQLAKVLRFGANDQSVVDRLIW
3dgeA           ----KRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSLKEFLEVIIDQSNHLENLLNELLD
2avwB           G-EDVFHAPYVGWYDITKTFNGKDDLLAGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFD
2c2aA           LERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGEDLSTLKEFLEVIIDQSNHLENLLNELLD
3clqB           DLADADRVARSGAITFSPCHEHDAVGSAGVTSPNYVHIIKNETYGNTSEQLAKVLRFGANDQSVVDRLIW
3clqA           DLADADRVARSGAITFSPCHEHDAVGSAGVTSPNYVHIIKNETYGNTSEQLAKVLRFGANDQSVVDRLIW
2avwA           GVFHAPYVANQGWYDITKTFNGKDDLLAGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFD
2bu2A           DPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQYFLDRFYLSRISIRMLINQHTL
2crkA           PFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNGDDLDPHYVLSSRVRTGRSIKGYTL
3ehjB           KLEDAELVKLEERQRARDLVDTLGQKLSLGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVS
1b3qB           ------------------SQTVRVDIEKLDNLMDLMGELVIARSRILETLKKYNIKELDESLSHLSRITL
3d36A           ---PHMV----IRLAASISHEIRNPLTAARGFIQLIEEQP-LAADKRRQYARIAIEELDRAEAIITDYLT
1b3qA           ------------------SQTVRVDIEKLDNLMDLMGELVIARETLKKYNIKELDESLSHLSRITLDLQN
1bxdA           ----------------------------------------------------------------------
3ehhB           ----AELVKLEERQRARDLVDTLGQKLSLGLKSDLA--------------RKLIYKDPEQAARELKSVQQ
3cgzA           ----------------------------------------------------------------------
3ehfD           ------------RIARDLHDTLGQKLSLIGLKSDLARKLIYKD-------PEQAARELKSVQQTARTSLN
3bh1D           ---------------------------------GFDREKYIEMQS--QHIRERREALLEMGGKLFDDMHA
2ch4B           ----------------------------------------------------------------------
3ehfA           ------------RIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVR----
3b2mC           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
3bh1A           ---------------------------------GFDREKYIEMQS--QHIRERREALLEMGGKLFDDMHA
2c13B           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3caxA           EKRLLD----------------------------------------------------------------
3ehhA           LVKLEE------RQRARDLVDTLGQKLSLGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNE------
1ah8A           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
1csgA           PTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETS--CATQIITFESFKENLKDFLLVIPF
3ehgA           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1drmA           RLQELQ----------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2cw9A           EILRVDPAFDKDRFLKQCENDIIPNLEAISGELDILKDWCYEAT--YSQLAHPIQQAKALGLQFHSRILD
3ehjA           ELVKLEERQR-----ARDLVDTLGQKLSLGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVS
2c13A           ----------------------------------------------------------------------
1dp8A           RLQELQ----------------------------------------------------------------
2cmnA           RLQELQ----------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
3bz1C           GIDRESEPV-------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
1d06A           ----------------------------------------------------------------------
1eh8A           -------------------------------------------------------------------EIK
2dvyA           ----------------------------------------------------------------------
1e51A           ------------------------------------------------------MQPQSVLHSGYFHPLW
1ah6A           ----------------------------------------------------------------------
3c2wC           QVQ-------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3bwlB           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2d02A           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3c2wD           QVQL------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3ckeD           LFMRAQTDRTRRPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPELQRVREIDANCSKHLSVVNDIYS
3eehA           ----------------------------------------------------------------------
1bdtB           ----------------------------------------------------------------------
3bwlC           ----------------------------------------------------------------------
2cwoA           LLVTV-------EHREWMEQRIGEMLKEIRAFLKVRVV-TPMHKETASDTLNAFLEEYCRITGLAREDAL
3c11A           ----------------------------------------------------------------------
3bwlD           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3bwlA           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3c2wB           QVQLHNDTASLLSNVTDELRRMTGYDRVMAYRFRHDDSGEVVAES-RREDLESYLGQRYPASDIPAQARR
3bnxA           FMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPELQRVREIDANCSKHLSVVNDIYS
2de0X           --KDHE------ILRRRIENGAKELWFFLQS--ELKKLKNLEGNELQRHADEFLLDLGHHERSIMTDLYY
2a24B           ----------------------------------------------------------------------
3c2wH           LHNDTA----------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3c2wA           IAQVQ-----------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2a24A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3bnyC           RAQTDRTRARPMGLGGYLERERDVGKELLAALMRFSMGLKLSPSE--LQRVREIDANCSKHLSVVNDIYS
3c2wG           RLTPRGSFEAWEEVVRGIAEKLRLDLMEL-----------------------------------------
3c2eA           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
3c2wF           HNDTA-----------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
3bs2A           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNLCQNALQAMNM
3d2rB           IFSDSQTGNPSQDAFECSRMLCDQYYLSSPELKLTQVNGKDQPIHIVYVPSHLHHMLFELFKNAMRATVE
2bu8A           MAKLLCDKYY--------------MASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVE
3crlA           IFDHIGSIDPNCSVSDVVKDAYDMAKLLCDKIQEVNATNATQPIHMVYVPSHLYHMLFELFKNAMRATVE
2e0aB           IFSDSPSHIGSIDPNCDVVAVVQDAFECSRMLCQVNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVE
2bu6A           IFDKHIGSIDPSEVVKDAYDMAKLLCDKYYMASPDLEANSKQPIHMVYVPSHLYHMLFELFKNAMRATVE
3crkB           ICSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNA-TNATQPIHMVYVPSHLYHMLFELFKNAMRATVE
2e0aA           IFSDSQTGNPVQDAFECSRMLCDQYYLSSPELKLTQVKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVE
2bu7A           IFDPKHIGSIDPNVSEVVKDAYDMAKLLCDKYYMANAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVE
2btzA           IFDKIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEKQPIHMVYVPSHLYHMLFELFKNAMRATVE
3d36B           FAKPAPETPEKLNVKLEIERVIDILRPLANMSCVDIQAT-LAPFSVIGEREKFRQCLLNVMKNAIEAMPN
3crlB           IFDGSTNPAHPKDAYDMAKLLCDKYYMASPDLEIQEVNNATQPIHMVYVPSHLYHMLFELFKNAMRATVE
3crkA           IFDPKHIGSIDKDAYDMAKLLCDKYYMASPDLEIQEVNATNAPIHMVYVPSHLYHMLFELFKNAMRATVE
3d2rA           IFSDSDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVE
2bu5A           IFDKHIGSIDPNCVVKDAYDMAKLLCDKYYMASPDLEANSKQPIHMVYVPSHLYHMLFELFKNAMRATVE
3clqD           RDVLGPLLHDAPEGIDLRLLSQALHGDECHNRNVAGSTALTPYVQTDFSREQLKEVFEFLGSSDYFSGPT
3dgeA           FSRLLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEADPTRIRQVLLNLLNNGVKYSKK
2avwB           VKEAIDTKN--HQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPR
2c2aA           FSRLLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESPCPVEAYIDPTRIRQVLLNLLNNGVKYSKK
3clqB           RDVLGTFCPEGIDLRLLSQALHGDECHNRNVAGTLLVQALTPYVQTDFSREQLKEVFEFLGSSDYFSGPT
3clqA           RDVLGTFCPEGIDLRLLSQALHGDECHNRNVAGTLLVQALTPYVQTDFSREQLKEVFEFLGSSDYFSGPT
2avwA           VKEAIDTKN--HQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPR
2bu2A           IDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEIANSKQPIHMVYVPSHLYHMLFELFKNAMRATVE
2crkA           PPHCSR--GERRAVEKLSVEALNSLTGEFKGKYYPLKSMTQEQQQLIDDHFLFDKPVSPLLLASGM-ARD
3ehjB           SKGI------------RLKDELINIKQILEAADIFIYEEEKWPENISLLNENILSCLKEAVTNVVKHS-Q
1b3qB           DLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNVNFIMRGEDTELDRTFVEEIGEPLLHLLRNAIDHGIE
3d36A           FAKPAPETPEKLNVKLEIERVIDILRPLANMSCVDIQATLA-PFSVIGEREKFRQCLLNVMKNAIEAMPN
1b3qA           VVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGE--DTELDRTFVEEIGEPLLHLLRNAIDHGIE
1bxdA           -----EMPMEMADLNAVLGEVIAAESGYE----REIETALPGSIEVKMHPLSIKRAVANMVVNAARYGNG
3ehhB           TARTSLNEVIVSSKGIRLKDELINIKQILEAADIFIYEEEKWPENISLLNENILSCLKEAVTNVVKHSQA
3cgzA           ------LSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLE
3ehfD           EVRKIVSSKGIRLKDELINIK-------QILEAADIFIYEEWPENISLLNENILSCLKEAVTNVVKHS-Q
3bh1D           SRVPDNKIAMLDRIKDEVEILVCINAKDLERHKLGISYEEDVLRLVDVFRDRGFLVEHVVLTQLENDNRL
2ch4B           ---------HMVPISFVFNRFPRMVRDLAKKMNKEVNFIMEDTELDRTFVEEIGEPLLHLLRNAIDHGIE
3ehfA           --------KIVSSKGIRLKDELINIKQILEAADIFIYEEEKWPENISLLNENILSCLKEAVTNVVKHS-Q
3b2mC           ---------------------LDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTNS
3cgzB           ---------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLE
3bh1A           SRVPDNKIAMLDRIKDEVEILVCINAKDLERHKIRADLEEDVLRLVDVFRDRGFLVEHVVLTQLENDNRL
2c13B           -----------------------------LILPVFVLDGVNQRESIPSMPGVERLSIDQLLIEAEEWVA-
3b2mB           ---------------------LDLVNSNALIPNTDFTFKIEPDTTVNEDGNKFKGVALNTPMTKVTYTSD
2ch4A           --------SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMEDTELDRTFVEEIGEPLLHLLRNAIDHGIE
2cg9B           --------------------------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
3caxA           ----------------------------------------------------------------------
3ehhA           ------VRKIVSSKGIRLKDELINIKQILEAADIFIYEEEKWPENISLLNENILSCLKEAVTNVV-----
1ah8A           --------------------------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
1aj6A           ------------------------------LKGLDAVRKRGMYIGDTDDGTGLHHMVFEVVDNAIDEALA
1byqA           -----------------------MEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK
3cwvA           --------------------------------IVENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARR
2dvyF           -------------------------------------------------------------EASVSFENG
2breA           --------------------------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
3cgzC           ---------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLE
1csgA           DCW-------------------------------------------------------------------
3ehgA           ----------GIRLKDELINIKQILEAAD--IMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQA
2cgfA           --------------------------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
2dvyD           -------------------------------------------------------------EASVSFENG
1b63A           --------------------------------PIQVLPPQANQIAAGEVVERPASVVKELVENSLDAGAT
1drmA           ----------------------------------------------------------------------
1e51B           -------------------------------------------SGYFHPLLRAWQTATTTLNASNLIYVT
2dvyC           --------------------------------------------------------MIHLTSVEASVSFE
3cgyA           ------LSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLE
2akpB           ---------------------------------------------ISNASDALDKIRYKSLSDPKQLE-T
2cg9A           --------------------------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
2cw9A           IDNVDLAGKVEQGPVLIITFQAQLVVVRNP-----------KGEVVEGDPDKVLRLYVWALCRDQDELNP
3ehjA           SKGIRLKDELIN------------IKQILEAADIFIYEEEKWPENISLLNENILSCLKEAVTNVVKHS--
2c13A           --------------------------------------GVNQRESIPSMPGVERLSIDQLLIEAEEWV-A
1dp8A           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
2ccsA           ---------------------------EVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK
3cgyB           ---------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLE
2akpA           ---------------------------------------------ISNASDALDKIRYKSLSDPKQLE-T
1ei1A           ------------------------SSSIKVLKGLDAVRKRGMYIGDTDDGTGLHHMVFEVVDNAIDEALA
3cgyC           ---------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLE
3bz1C           ----------------------------------------------------------------------
2byhA           -----------------------MEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK
1d06A           ----------------------------------------------------------------------
1eh8A           LLGEVPAPAAVLGGPEPLMQCTAWLN--AYFHQPEAIEEF-PVPALHHPVFQQESFTRQVLWKLLKVVKF
2dvyA           --------------------------------------------------------MIHLTSVEASVSFE
1e51A           QTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKREEMLRPLVEEGLRCVLIFGVPSRVPKDER
1ah6A           --------------------------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
3c2wC           ----------------------------------------------------------------------
1bknB           --------------------------------------------------ERPASVVKELVENSLDAGAT
3bwlB           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1b62A           -------------------------------HHMPIQVLPANQIAAGEVVERPASVVKELVENSLDAGAT
2d02A           ----------------------------------------------------------------------
2bz5A           ---------------------------EVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK
3c2wD           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------MKGMSK
3ckeD           YEKCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLS----AEGLETPGLAAYVEGLE-----
3eehA           ----------------------------------------------------------------------
1bdtB           ----------------------------------------------------------------MKGMSK
3bwlC           ----------------------------------------------------------------------
2cwoA           REKMRLFHHSELLKFEVTENMFSYTELLK--LNLSLRVISSQILGMAI----------------------
3c11A           ---------------------------------FQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
3bwlD           ----------------------------------------------------------------------
1ah8B           --------------------------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
3bwlA           ----------------------------------------------------------------------
3bmyA           ------------------------MEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDPSKL
3bjeA           -----------------------------------LKCKSDELADRIIDPGRVDVISGYFDKDSIRASRD
3c2wB           LYIQNPIRLI------------------------------------------------------------
3bnxA           YEKQILAQEADVTAEAAKRVLFVMCREWE-LRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQT
2de0X           LSQTDGAGDEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLIL
2a24B           ----------------------------------------------------------------------
3c2wH           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1bknA           --------------------------------------------------ERPASVVKELVENSLDAGAT
3c2wA           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c0eA           -------------------------------ETFEFQAEITQLMSLIIVYSNKEIFLRELISNASDALDK
1bdtA           ----------------------------------------------------------------MKGMSK
1ea6B           -----------------------------------------------QVVLSLSTAVKELVENSLDAGAT
2a24A           ----------------------------------------------------------------------
1ea6A           -----------------------------------------------QVVLSLSTAVKELVENSLDAGAT
3bnyC           YEKCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGTGLAAYVEGLEYQMSGNELWSQT
3c2wG           ----------------------------------------------------------------------
3c2eA           --------------------------------------------------------------------VY
3bulA           ----------------------------------------------------------------------
2c19B           ---------------------------------VLDGVNQRE--SIPSMPGVERLSIDQLLIEAEEWVA-
2c14B           ---------------------------------VLDGVNQRE--SIPSMPGVERLSIDQLLIEAEEWVA-
3c2wF           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2dvyB           --------------------------------------------------------------ASVSFENG
3bs2A           ----------------------------------------------------------------------
2brcA           -----------------------------IINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETE
2ayxA           --------------------------------------------------------------SGVEGLS-
2c18B           --------------------------------------GVNQRESIPSMPGVERLSIDQLLIEAEEWV-A


                         *         .         .         .         .         +         .:560
query           QGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGLGLSISYTIVDKHQGRIEVES
3d2rB           HQENQPSLIVVLGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPAGFGYGLPISRLYAKYFQGDLNLYS
2bu8A           SHESSLIVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTPLAGFGYGLPISRLYAKYFQGDLQLFS
3crlA           SHESSLTLMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPAGFGYGLPISRLYAKYFQGDLQLFS
2e0aB           HQENQPSLTPILGKEDLTIKISDRGGGVPLRIIDRLFSYTYTAPLAGFGYGLPISRLYAKYFQGDLNLYS
2bu6A           SHESSLILMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA---PGYGLPISRLYAKYFQGDLQLFS
3crkB           SHESSLTLMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYST---APGYGLPISRLYAKYFQGDLQLFS
2e0aA           HQENQPSLTPIEVKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPFGYGLPISRLYAKYFQGDLNLYS
2bu7A           SHESSLILPVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYST---APGYGLPISRLYAKYFQGDLQLFS
2btzA           SHESSLILPPALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP---GYGLPISRLYAKYFQGDLQLFS
3d36B           GGTLQVYVSID--NGRVLIRIADTGVGMTKEQLERLGEPYFTTKGVKGGLGMMVVYRIIESMNGTIRIES
3crlB           SHESPIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPLAFGYGLPISRLYAKYFQGDLQLFS
3crkA           SHESSLTLPPIKGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP---GYGLPISRLYAKYFQGDLQLFS
3d2rA           HQENQPSLTPIEGKEDLTIKISDRGGGVPLRIIDRLFSYTYTAPLAGFGYGLPISRLYAKYFQGDLNLYS
2bu5A           SHESSLILPPIKVMEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP---GYGLPISRLYAKYFQGDLQLFS
3clqD           WGAAKCALDGHNVENSTIVTTCRNGVEFGIRVSGIGGNHWFAQRVIGPFAGYTQEDAGLDGDSAITETYG
3dgeA           DAPDKYVKVILDEDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTGLGLAITKEIVELHGGRIWVES
2avwB           GGIFDATRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKYANVRINHVINLWGADFDSNGNLKAIYVT
2c2aA           DAPDKYVKVILDEKDGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTG---LGLAITKEIVELHGGRIWVES
3clqB           WGAAKCALDAGHNVENTIVTTCRNGVEFGIRVSGIGGNHWFAQRVIGPFAGYTQEDAGLDGDSAITETYG
3clqA           WGAAKCALDAGHNVENTIVTTCRNGVEFGIRVSGIGGNHWFAQRVIGPFAGYTQEDAGLDGDSAITETYG
2avwA           GGIFDAVFTRGDQSLTSRHDFKEKNLKEISDLIKKELTEGKALGLRINHVINLWGADFDSNGNLKAIYVT
2bu2A           SHESSLILPPI--KVMVALGEEDLSIKMSDRGGGVPLRKIEYSTLAGFGYGLPISRLYAKYFQGDLQLFS
2crkA           WPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFCVGLQKIEFKKAGHPFMWNEHLGYVLTCPS
3ehjB           AKTCR--VDIQQLWKEVVITVSDDGTFKG---------------EENSFHGLLGRE-RLEFANGSLHIDT
1b3qB           PKEETLILSARHEGNNVVIEVEDDGRGIDQEILNFLFVPGFVSEVSGRGVGMDVVKNVVESLNGSMGIES
3d36A           GGTLQV--YVSIDNGRVLIRIADTGVGMTKEQLERLGEPYFTTKGKGTGLGMMVVYRIIESMNGTIRIES
1b3qA           PKEERIAKGKPPIGTLILIEVEDDGRGIDKEKIIRKAIEKGLIDEGFSGVGMDVVKNVVESLNGSMGIES
1bxdA           WIKVSSGTE----PNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTGLGLAIVQRIVDNHNGMLELGT
3ehhB           KTCRVDIQQLW---KEVVITVSDDGTFKGEENSHGLLGRE-----------------RLEFANGSLHIDT
3cgzA           FVEISARQTDDH----LHIFVEDDGPGI------------PHTLRPGQGVGLAVAREITEQYAGQIIASD
3ehfD           AKTCRV--DIQQLWKEVVITVSDDGTFKGEHGL--------------------LGRERLEFANGSLHIDT
3bh1D           ALAFIERLQRL----GIKVSRHRVIPGYPTDMDRIVSDEGFGLNETAPGPGSGKLATQVYHEHKRGVAAG
2ch4B           PKEERIAKGARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDEFVPGFSMDVVKNVVESLNGSISIES
3ehfA           AKTCRVDIQQL--WKEVVITVSDDGTFKGEH-------------------GLLGR-ERLEFANGSLHIDT
3b2mC           DKGSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYVHVLWNEEQQKPVATYIVGYKEGSKVPIQ
3cgzB           FVEISARQTD------------DHLHIFVEDDGPGIPHSKRSTLRPGQGVGLAVAREITEQYAGQIIASD
3bh1A           ALAFIERLQRLGIK----VSRHRVIPGYPTDMDRIVSDEGFGLNEVVTAPGPGTCLSQVYHEHKRGVAAG
2c13B           LGIPALALFPVTPVKSLDAAEAYNPEGIAQRATRALRERFPFTTHGQDGILDDDGYVLNDVSIDVLVRQA
3b2mB           KGGSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYDTVLWNEEQQKPVATYIVGYKEGSKVPIQ
2ch4A           PKEERIAKGIRKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKGRGVGMDVVKNVVESLNGSISIES
2cg9B           IRYKSLSDRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAGTKAFMEALSAGADVSMIGQFGVGFYSLF
3caxA           ----------------------------------------------------------------------
3ehhA           ---------KHSQAKTCRVDIQQLWKEV---------VITVSDDGTFKGHGL-LGRERLEFANGSLHIDT
1ah8A           IRYKSLSDRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAGTKAFMEALSAGADVSMIGQFGVGFYSLF
1aj6A           GHCKEI---IVTIHADNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGHGVGVSVVNALSQKLELVI
1byqA           IRYETLTDPLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGAMIGQFGVGFYSAYL
3cwvA           GECRDVVLEVG---GDGSIALFCTSRTVTAENLVRVATGAGFLGRGWGWDSMLVVSLALSSRYQVDIWAD
2dvyF           KIVVRLPITRP--TSKIRVKKIENGVGIPVSTRKKSFPSDENLRDGKYDYELSRMVRLAHEHGILTYNDI
2breA           IRYKDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAGTKAFMEALSAGADVSMIGQFGVGFYSLF
3cgzC           FVEISARQTDDHLH----IFVEDDGPGIPHTLRPGQGVGLAVARE------------ITEQYAGQIIASD
1csgA           ----------------------------------------------------------------------
3ehgA           KTCRVDIQQLW---KEVVITVSDDGTFKGEENSFSKGHGLLGMR------------ERLEFANGSLHIDT
2cgfA           IRYKSLSDRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAGTKAFMEALSAGADVSMIGQFGVGFYSLF
2dvyD           KIVVRLPITRP--TSKIRVKKIENGVGIPVSTRKKSFPSDENLRDGKYDYELSRMVRLAHEHGILTYNDI
1b63A           RIDIDIERGGAK-----LIRIRDNGCGIKKDELALALARHATSKIAFRGEALALTLTSRTAEQRDMNVTV
1drmA           ----------------------------------------------------------------------
1e51B           DVPDDIQPITSLPGRLEEMLRPLVEEGLRCVLIFGVPSRVPKDADEAIHLLRKTFPNLLVACDVCLCPYA
2dvyC           NGKIVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSD------ENLRDYYIEWQISYARDGKYDYEL
3cgyA           FVEISARQTDDHL------------------------HIFVEDDGPGIPVGLAVAREITEQYAGQIIASD
2akpB           EPDLFI--RITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKTKAFMEALSAGADVMIGQFGVGFYSLFL
2cg9A           IRYKSLSDRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMLSAGADVSMIGQFGVGFYSLF
2cw9A           YAAWRLLDI-------------------------------------------------------------
3ehjA           -QAKTCRVDIQQLWKEVVITVSDDGTFKG---------------EENSFHGLLGR-ERLEFANGSLHIDT
2c13A           LGIPALALFPPVEKKSLDAAEAYNPEGIAQRATRALRERFPEL---GIITDVALDPFTTHGQDGILDDDG
1dp8A           ----------------------------------------------------------------------
2cmnA           ----------------------------------------------------------------------
2ccsA           IRYETLTDPSKLNKQDRTLTIVDTGIGMTKADLINNLGTIATKAFMEALQAGADISMIGQFGVGFYSAYL
3cgyB           FVEISARQTDDHLH------------------------IFVEDDGPGIPHGLAVAREITEQYAGQIIASD
2akpA           EPDLFI--RITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTFMEALSAGADSMIGQFGVGFYSLFL
1ei1A           GHCKEIIVT---IHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSY-----------
3cgyC           FVEISARQTDD----HLHIFVEDDGPGIPGLAVARE---------------------ITEQYAGQIIASD
3bz1C           ----------------------------------------------------------------------
2byhA           IRYESLHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAEALQAGADISMIGQFGVGFYSAY
1d06A           ----------------------------------------------------------------------
1eh8A           GEVISY----QQLAALAGNPKAARAVGGAMRGNPVPILIPHSGAVGNYSGGLAVKEWLLAHEGHRL----
2dvyA           NGKIVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSD------ENLRDYYIEWQISYARDGKYDYEL
1e51A           GSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGRAEESRQRLAEVALAYAKAGC------
1ah6A           IRYKSLSDPITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTFMEALSAGADVSMIGQFGVGFYSLF
3c2wC           ----------------------------------------------------------------------
1bknB           RIDIDIERGGA-----KLIRIRDNGCGIKKDELAALAEAIISLGFRGEALATAEQQEAWQAYMNVTVKPA
3bwlB           ----------------------------------------------------------------------
2b02A           ----------------------------------------------------------------------
2d01A           ----------------------------------------------------------------------
1b62A           RIDIDIERGGAK-----LIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEAL------
2d02A           ----------------------------------------------------------------------
2bz5A           IRYESLHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTMEALQAGADISMIGQFGVGFYSAYL
3c2wD           ----------------------------------------------------------------------
1bdvB           MPQVNLRWPREVLDL-VRKVAEENGRSVNSEIYQRVMESFKKEGRIGA----------------------
3ckeD           ----------------------------------------------------------------------
3eehA           ----------------------------------------------------------------------
1bdtB           MPQFNLRWPREVLDL-VRKVAEENGRSVNSEIYQRVMESFKKEGRIGA----------------------
3bwlC           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
3c11A           IRYKSLSDPITPKPEQKVLEIRDSGIGMTKAELINNLGTIAAAGTKAEALSAGADVSMIGQFGVGFYSLF
3bwlD           ----------------------------------------------------------------------
1ah8B           IRYKDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGAFMEALSAGADVSMIGQFGVGFYSLF
3bwlA           ----------------------------------------------------------------------
3bmyA           DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALSMIGQFGVGFYSAYLVAE
3bjeA           HREIRFATGTYKGTTVISTGMGVDNIEIVLNEIHALKEYDMER--GQWRHRKGDADAPSAGPFFDPSTMK
3c2wB           ----------------------------------------------------------------------
3bnxA           TLRYSV----------------------------------------------------------------
2de0X           ESQNWRYATGG-----------------------------------------------------------
2a24B           ----------------------------------------------------------------------
3c2wH           ----------------------------------------------------------------------
1bywA           ----------------------------------------------------------------------
1bknA           RIDIDIERGGA-----KLIRIRDNGCGIKKDEIASLDDLEAIISLGFRGEALA-----------------
3c2wA           ----------------------------------------------------------------------
1d7eA           ----------------------------------------------------------------------
3b33A           ----------------------------------------------------------------------
3c0eA           IRYKSLSDPKQLETEQKVLEIRDSGIGMTKAELINNLGTIAAAGTKEALSAGADVSMIGQFGVGFYSLFL
1bdtA           MPQFNLRWPREVLDL-VRKVAEENGRSVNSEIYQRVMESFKKEGRIG-----------------------
1ea6B           NIDLKLKD-----YGVDLIEVSDNGCGVEEENFEGLTLEALDVTISTCHASAKVGTRLMFDHNGKIIQKT
2a24A           ----------------------------------------------------------------------
1ea6A           NIDLK-----LKDYGVDLIEVSDNGCGVEEENFEGLTLEALSSLC-------------------------
3bnyC           TLRYSV----------------------------------------------------------------
3c2wG           ----------------------------------------------------------------------
3c2eA           EHLLPVNGAWRQDVTNWL--SEDVPSFDFGGVGSDLKEANLYCKQDGMLCGVPFAQEVFNQCELQVEWLF
3bulA           ------------------------------WRSWEVNKRLEITEFIEQDTEEARQQATRPLMDGMNVVGD
2c19B           LGIPALALFPVTPEGIAQRATRALRERFPELGIITDVALDPFTTHGQDGILDDDGYVLNDVSIDVLVRQA
2c14B           LGIPALALFPVTPVEKAQRATRALRERFPELGIITDVALDPFTTQDGILDDDGYVLNDVSIDVLVRQALS
3c2wF           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2dvyB           KIVVRLPITRP--TSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYYI----------------------
3bs2A           ----------------------------------------------------------------------
2brcA           P---DLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAEALSAGADVSMIGQFGVGFYSLF
2ayxA           GKRCWLAVRNASLCQFLETSLQRSGIVVTYEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEK
2c18B           LGIPALALFPVTPVKSLDAAEAYNPEGIAQRATRALRERFPELGTDVALDPFTGQDGILDDDGYVLNDVS


                         .         .         .         *         .         .         .:630
query           TIDEGTCFKVYLPVYEQF
3d2rB           LSGYGTDAIIYLKA----
2bu8A           MEGFGTDAVIYLKA----
3crlA           MEGFGTDAVIYLKA----
2e0aB           LSGYGTDAIIYLKA----
2bu6A           MEGFGTDAVIYLKA----
3crkB           MEGFGTDAVIYLKA----
2e0aA           LSGYGTDAIIYLKA----
2bu7A           MEGFGTDAVIYLKA----
2btzA           MEGFGTDAVIYLKA----
3d36B           EIHKGTTVSIYLPL----
3crlB           MEGFGTDAVIYLKALS--
3crkA           MEGFGTDAVIYLKA----
3d2rA           LSGYGTDAIIYLKA----
2bu5A           MEGFGTDAVIYLKA----
3clqD           VGGFAAAAPAIVP-----
3dgeA           EVGKGSRFFVWIPK----
2avwB           DSDSNASIGMKKYFVGV-
2c2aA           EVGKGSRFFVWIPK----
3clqB           VGGFAAAAPAIVP-----
3clqA           VGGFAAAAPAIVP-----
2avwA           DSDSNASIGMKKYF----
2bu2A           MEGFGTDAVIYLKA----
2crkA           NLGTGLRGGVHVKL----
3ehjB           ENGTKLTA----------
1b3qB           EKDKGTKVTIRLPLTLA-
3d36A           EIHKGTTVSIYLPL----
1b3qA           EKDKGTKVTIRLPLTLA-
1bxdA           SERGGLSIRAWLPV----
3ehhB           ENGTKLTA----------
3cgzA           SLLGGARMEVVFGR----
3ehfD           ENGTKLTA----------
3bh1D           YAKFETFPIWNLP-----
2ch4B           EKDKGTKVTIR-------
3ehfA           ENGTKLTA----------
3b2mC           FKNSLDSTTLTV------
3cgzB           SLLGGARMEVVFGR----
3bh1A           YAKFETFPIWNLP-----
2c13B           LSHAEAGAQV--------
3b2mB           FKNSLDSTTLTV------
2ch4A           EKDKGTKVTIR-------
2cg9B           LVADRVQVISKSN-----
3caxA           ------------------
3ehhA           ENGTKLTA----------
1ah8A           LVADRVQVISKSNDDEQY
1aj6A           QHEGKIHRQIYEHGVPQ-
1byqA           VAEKVTVITKHN------
3cwvA           GRQWRVMGEHGHP-----
2dvyF           YELLKFADDVKSYLEDKG
2breA           LVADRVQVISKSNDDEQY
3cgzC           SLLGGARMEVVFGR----
1csgA           ------------------
3ehgA           --ENGTKLTMAIP-----
2cgfA           LVADRVQVISKSNDDEQY
2dvyD           YELLKFADDVKSYLEDK-
1b63A           KPAAHPVGTTLEVLDLFY
1drmA           ------------------
1e51B           EESRQRLAEVA-------
2dvyC           SREHGILTYNDIYELLKF
3cgyA           SLLGGARMEVVFGRQHP-
2akpB           VADRVQVISKSND-----
2cg9A           LVADRVQVISK-------
2cw9A           ------------------
3ehjA           ENGTKL------------
2c13A           YVLNDVSIDVLV------
1dp8A           ------------------
2cmnA           ------------------
2ccsA           VAEKVTVITKHND-----
3cgyB           SLLGGARMEVVFGR----
2akpA           VADRVQVISKSNDDE---
1ei1A           ------------------
3cgyC           SLLGGARMEVVFG-----
3bz1C           ------------------
2byhA           LVAEKVTVITKHNDDEQ-
1d06A           ------------------
1eh8A           ------------------
2dvyA           ------------------
1e51A           ------------------
1ah6A           LVADRVQVISK-------
3c2wC           ------------------
1bknB           AHPVGTTLEVLDL-----
3bwlB           ------------------
2b02A           ------------------
2d01A           ------------------
1b62A           ------------------
2d02A           ------------------
2bz5A           VAEKVTVITKHND-----
3c2wD           ------------------
1bdvB           ------------------
3ckeD           ------------------
3eehA           ------------------
1bdtB           ------------------
3bwlC           ------------------
2cwoA           ------------------
3c11A           LVADRVQVISKSNDDEQY
3bwlD           ------------------
1ah8B           LVADRVQV----------
3bwlA           ------------------
3bmyA           KVTVITKHNDDE------
3bjeA           IIRLGTCGSPAESV----
3c2wB           ------------------
3bnxA           ------------------
2de0X           ------------------
2a24B           ------------------
3c2wH           ------------------
1bywA           ------------------
1bknA           ------------------
3c2wA           ------------------
1d7eA           ------------------
3b33A           ------------------
3c0eA           VADRVQVI----------
1bdtA           ------------------
1ea6B           PYPRPRGTTVSVQQLFST
2a24A           ------------------
1ea6A           ------------------
3bnyC           ------------------
3c2wG           ------------------
3c2eA           KEGSFLEPSKNDSG----
3bulA           LFGEGKMFLPQVVKSAR-
2c19B           LSHAEAGAQVVAPSD---
2c14B           HAEAGAQVVAPSDMMD--
3c2wF           ------------------
2btvA           ------------------
3c2wE           ------------------
2dvyB           ------------------
3bs2A           ------------------
2brcA           LVADRVQVISKSNDDEQY
2ayxA           APGEWVHS----------
2c18B           IDVLVRQALSHAEAGAQ-