[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO49703.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ad3A.bssp"
#ERROR : Can't open dsspfile "1co3A.bssp"
#ERROR : Can't open dsspfile "1co3B.bssp"
#ERROR : Can't open dsspfile "1bxsA.bssp"
#ERROR : Can't open dsspfile "1a4sA.bssp"
#ERROR : Can't open dsspfile "2bjaA.bssp"
#ERROR : Can't open dsspfile "2bhpA.bssp"
#ERROR : Can't open dsspfile "3ed6A.bssp"
#ERROR : Can't open dsspfile "3b4wA.bssp"
#ERROR : Can't open dsspfile "2d4eC.bssp"
#ERROR : Can't open dsspfile "1bi9D.bssp"
#ERROR : Can't open dsspfile "1bi9A.bssp"
#ERROR : Can't open dsspfile "3ek1B.bssp"
#ERROR : Can't open dsspfile "3ek1A.bssp"
#ERROR : Can't open dsspfile "2d4eA.bssp"
#ERROR : Can't open dsspfile "1bi9B.bssp"
#ERROR : Can't open dsspfile "1a4zA.bssp"
#ERROR : Can't open dsspfile "3ek1G.bssp"
#ERROR : Can't open dsspfile "1bi9C.bssp"
#ERROR : Can't open dsspfile "3efvC.bssp"
#ERROR : Can't open dsspfile "3efvA.bssp"
#ERROR : Can't open dsspfile "3dorA.bssp"
#ERROR : Can't open dsspfile "3e2pK.bssp"
#ERROR : Can't open dsspfile "3cyvA.bssp"
#ERROR : Can't open dsspfile "2c8eG.bssp"
#ERROR : Can't open dsspfile "3cgwA.bssp"
#ERROR : Can't open dsspfile "3c3dA.bssp"
#ERROR : Can't open dsspfile "3e08A.bssp"
#ERROR : Can't open dsspfile "1e0tA.bssp"
#ERROR : Can't open dsspfile "3dorB.bssp"
#ERROR : Can't open dsspfile "3cskA.bssp"
#ERROR : Can't open dsspfile "2e3kB.bssp"
#ERROR : Can't open dsspfile "3bjzB.bssp"
#ERROR : Can't open dsspfile "2e7nA.bssp"

## Summary of PDB Search
:415
    2e-52  17%  1ad3A  [c.82.1] ALDEHYDE DEHYDROGENASE (CLASS 3)
    6e-52  13%  1co3A  [x.x.x] ALDEHYDE DEHYDROGENASE
    4e-51  13%  1co3B  [x.x.x] ALDEHYDE DEHYDROGENASE
    7e-48  17%  1bxsA  [c.82.1] ALDEHYDE DEHYDROGENASE
    1e-47  15%  1a4sA  [c.82.1] BETAINE ALDEHYDE DEHYDROGENASE
    3e-47  17%  2bjaA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    4e-46  17%  2bhpA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE
    8e-46  17%  3ed6A  [x.x.x] BETAINE ALDEHYDE DEHYDROGENASE
    2e-45  17%  3b4wA  [x.x.x] ALDEHYDE DEHYDROGENASE[MASQUE : MEMB(X) 46 / COIL(x)
    1e-44  21%  2d4eC  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    4e-44  18%  1bi9D  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    5e-43  17%  1bi9A  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    5e-43  17%  3ek1B  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-42  17%  3ek1A  [x.x.x] ALDEHYDE DEHYDROGENASE
    7e-42  20%  2d4eA  [x.x.x] 5-CARBOXYMETHYL-2-HYDROXYMUCONATE SEMIALDEHYDE
    2e-40  17%  1bi9B  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    2e-39  17%  1a4zA  [c.82.1] ALDEHYDE DEHYDROGENASE
    5e-39  17%  3ek1G  [x.x.x] ALDEHYDE DEHYDROGENASE
    1e-38  17%  1bi9C  [c.82.1] RETINAL DEHYDROGENASE TYPE II
    3e-31  21%  3efvC  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    1e-30  21%  3efvA  [x.x.x] PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
    1e-19   8%  3dorA  [x.x.x] PROTEIN CT_858
    2e-17  18%  3e2pK  [x.x.x] ASPARTATE CARBAMOYLTRANSFERASE
    2e-17   8%  3cyvA  [x.x.x] UROPORPHYRINOGEN DECARBOXYLASE
    2e-17   6%  2c8eG  [x.x.x] MONO-ADP-RIBOSYLTRANSFERASE C3
    7e-15   7%  3cgwA  [x.x.x] LPPG:FO 2-PHOSPHO-L-LACTATE TRANSFERASE
    2e-14   7%  3c3dA  [x.x.x] 2-PHOSPHO-L-LACTATE TRANSFERASE
    2e-08   8%  3e08A  [x.x.x] TRYPTOPHAN 2,3-DIOXYGENASE
    1e-07  12%  1e0tA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    2e-06  10%  3dorB  [x.x.x] PROTEIN CT_858
    3e-06   7%  3cskA  [x.x.x] PROBABLE DIPEPTIDYL-PEPTIDASE 3
    5e-04  20%  2e3kB  [x.x.x] BROMODOMAIN-CONTAINING PROTEIN 2
    6e-04   9%  3bjzB  [x.x.x] PHOSPHOHEPTOSE ISOMERASE
    9e-04  20%  2e7nA  [x.x.x] BROMODOMAIN-CONTAINING PROTEIN 3
:415

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNVKNLAKKAKIAARTLSVLDTEAKNSALEAIASQLLADKETILQANGKDLDNGKKMGLSPSLLDRLAL
1ad3A           --SISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLG----KNEWTSYYEEVAH
1co3A           -------ATAAAKVARDFRRLNNSKRASLLRTIASELEARSDDIIARA--HLETAL--PEVRLTGE-IAR
1co3B           ---VNQAATAAAKVARDFRRLNNSKRASLLRTIASELEARSDDIIARAHLETALPEVRLT-----GEIAR
1bxsA           -------ARQAFQIGSPWRTMDASERGRLLNKLADLIERDRLLLATMEA--MNGGK------LFSNAYL-
1a4sA           ---VDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEVINNGKT------------ITE
2bjaA           ----------------------------------------------------------------------
2bhpA           ----------------------------------------------------------------------
3ed6A           -----------------------------------------------------------ETLDTGKTLEE
3b4wA           -------------------------------------------MLAERKDLFTKLLAAETGQPPTIIET-
2d4eC           ----------------------------------------------------------------------
1bi9D           -------ARLAFSLGSVWRRMDASERGRLLDKLADLVERDRA--TLATMESLNGGK------PFLQAFY-
1bi9A           -------------------------------------------LVERDRATLATMESLNGGKPFLQAFY-
3ek1B           ----------SAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMT--SEQGK----------PLAE
3ek1A           ----------SAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMT--SEQGK----------PLAE
2d4eA           ----------------------------------------------------------------------
1bi9B           -------ARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFY---------
1a4zA           ----------------------------------------------------------------------
3ek1G           ----------SAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMT--SEQGK----------PLAE
1bi9C           -------ARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFY---------
3efvC           -------------------------------------------------------------------IKQ
3efvA           -------------------------------------------------------------------IKQ
3dorA           ----------------------------------------------------------------------
3e2pK           ----------------------------------------------------------------------
3cyvA           ----------------------------------------------------------------------
2c8eG           ----------------------------------------------------------------------
3cgwA           ----------------------------------------------------------------------
3c3dA           ----------------------------------------------------------------------
3e08A           ----------AQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAI--VHLQRD----------EVWQ
1e0tA           ----------------------------------------------------------------------
3dorB           ----------------------------------------------------------------------
3cskA           ----------------------------------------------------------------------
2e3kB           ----------------------------------------------------------------------
3bjzB           ----------------------------------------------------------------------
2e7nA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSARIDGMVEGIKQVVELEDPVGQVMETWQRPNGLEIAKVRVPMGVIGMVYEARPNVTVDTCALCLKAGS
1ad3A           VLEELDTTIKELPDWAEDEPV-----AKTRQTQQDDLYIHSEPLGVVLVIWNYPFNLTIQPMVGAVAAGN
1co3A           TANQLRLFADVVNSGSYHQAILDTPNPTRAPLPKPDIRRQQIALGPVAVFFPLAFSAAGGDTASALAAGC
1co3B           TANQLRLFADVVNSGSYHQAILDTPNPTRAPLPKPDIRRQQIALGPVAVFFPLAFSAAGGDTASALAAGC
1bxsA           --MDLGGCIKTLRYCAGWADKIQG--RTIPMDGNFFTYTRSEPVGVCGQIIPWNFLMFLWKIGPALSCGN
1a4sA           AEYDIDAAWQCIEYYAGLAPTLSGQHIQLPGGAFAYTRREPLGVCAGILAWNYPFMIAAWKCAPALACGN
2bjaA           ----------------------------VVPYPGEDNESFYVPLGAGVVIAPFPVAIFTGMIVGPVAVGN
2bhpA           ----------------------------VVPYPGEDNESFYVPLGAGVVIAPFPVAIFTGMIVGPVAVGN
3ed6A           SYADMDDIHNVFMYFAGLADKDGGEMIDSPIP-DTESKIVKEPVGVVTQIWNYPLLQASWKIAPALATGC
3b4wA           --MHWMGSMGAMNYFAGAADKVTW--TETRTGSYGQSIVSREPVGVVGXXXXXXXXXXXXXXXXXXXXXX
2d4eC           --------------------------RTFPVDRDWLYYTVRVPAGPVGIIWNAPLMLSTWRIAPALAFGN
1bi9D           --IDLQGVIKTLRYYAGWADKIHG--MTIPVDGDYFTFTRHEPIGVCGIPWNFPLLMFTWKIAPALCCGN
1bi9A           --IDLQGVIKTLRYYAGWADKIHG--MTIPVDGDYFTFTRHEPIGVCGIPWNFPLLMFTWKIAPALCCGN
3ek1B           ARGEVLYAASFIEWFAEEAKRVYGD-TIPAPQNGQRLTVIRQPVGVTAAIWNFPAAMITRKAAPALAAGC
3ek1A           ARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQ-RLTVIRQPVGVTAAIWNFPAAMITRKAAPALAAGC
2d4eA           --------------------------RTFPVDRDWLYYTVRVPAGPVGIIWNAPLMLSTWRIAPALAFGN
1bi9B           --IDLQGVIKTLRYYAGWADKIHG--MTIPVDGDYFTFTRHEPIGVCGIPWNFPLLMFTWKIAPALCCGN
1a4zA           --VDLDMVLKCLRYYAGWADKYHG--KTIPIDGDYFSYTRHEPVGVCGQIIPWPLLMQAWKLGPALATGN
3ek1G           ARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQ-RLTVIRQPVGVTAAIWNFPAAMITRKAAPALAAGC
1bi9C           --IDLQGVIKTLRYYAGWADKIHG--MTIPVDGDYFTFTRHEPIGVCGIPWNFPLLMFTWKIAPALCCGN
3efvC           ARAEVTKSAALCDWYAEHGPALPEPTLVENQ----QAVIEYRPLGVILAIPWNFPWQVLRGAVPILLAGN
3efvA           ARAEVTKSAALCDWYAEHGPALPEPTLVENQ----QAVIEYRPLGVILAIPWNFPWQVLRGAVPILLAGN
3dorA           ---------------------------SLVCKNALQLQVKYAPKTWKEQYLGW--DLV----QSSVSAQQ
3e2pK           ----------------------------------------------------------------------
3cyvA           -----------------------------ELKNLLRQPVDVTPVWMMRQAGRYLPYKATRAQAGDFMSLC
2c8eG           ---------------------------------------QAKAWGNAQYKKYGLSKEAIVSYTKSASEIN
3cgwA           --------------------------ETAEGIHFQDFWIGKRGEPDVRGVDIRGVASISPKVLEAFEKEE
3c3dA           --------------------------ETAEGIHFQDFWIGKRGEPDVRGVDIRGVSSISPKVLEAFEKEE
3e08A           CRKVLARSKQVLRQLTEQ-------WSVLETLTPSEYMGFRDVLGPSSGFQSL----QYRYIEFLLGNKN
1e0tA           --------------------------DVIEIREHLKAHGGENIHIISKIEQEGLNNILEASDGIMVARGD
3dorB           ---------------------------------------KYAPKTWKEQY------LGWDLVQSSVSAQQ
3cskA           ----------------------------------------------------------------------
2e3kB           ----------------------------------------------------------------------
3bjzB           ----------------------------------------QASIETKQQAVLPPYIEQASLVVNALLNEG
2e7nA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AVVLRGSSSALNSNRALVSAIKKGLAKTAIPEDTVQFVDSEDRGAVDEMLRLNGLLDLVIPRGGAGLIRR
1ad3A           AVILKPSEVSGHMADLLATLIPQYM-----DQNLYLVVKGGVPETTELLKERFDHIMYTGSTAVGKIVMA
1co3A           PVIVKGHTAHPGTSQIVAECIEQALKQEQLPQAIFTLLQGNQRALGQALVS-HPEIKAVGFTGSVGGGRA
1co3B           PVIVKGHTAHPGTSQIVAECIEQALKQEQLPQAIFTLLQG-NQRALGQALVSHPEIKAVGFTGSVGGGRA
1bxsA           TVVVKPAEQTPLTALHMGSLIKEAGFPPGVV-NIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKLIKEA
1a4sA           AVVFKPSPMTPVTGVILAEIFHEAGVPVGLV------NVVQGGAETGSLLCHHPNVAKVSFTGSVPTGKK
2bjaA           TVIAKPAEDAVVVGAKVFEIFHE-----AGFPPGVVNFLPGVGEEVGAYLVEHPRIRFINFTGSLEVGLK
2bhpA           TVIAKPAEDAVVVGAKVFEIFHEAG----FPPGVVNFL-PGVGEEVGAYLVEHPRIRFINFTGSLEVGLK
3ed6A           SLVMKPSEITPLTTIRVFELMEEVG----FPKGTINLILG-AGSEVGDVMSGHKEVDLVSFTGGIETGKH
3b4wA           TIVLKPAAETPLTANALAEVFAEVG----LPEGVLSVV--PGGIETGQALTSNPDIDMFTFTGSSAVGRE
2d4eC           TVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFG--EEAGAALVAHPLVPLLTLTGETETGKIVMR
1bi9D           TVVIKPAEQTPLSALYMGALIKEAGFPPGVV-NILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEA
1bi9A           TVVIKPAEQTPLSALYMGALIKEAG----FPPGVVNILPGYGPTAGAAIAGIDKIAFTGSTEVGKLIQEA
3ek1B           TMIVRPADLTPLTALALGVLAEK-----AGIPAGVLQIVTGKAREIGAELTSNDTVRKLSTEVGRLLMAQ
3ek1A           TMIVRPADLTPLTALALGVLAEK-----AGIPAGVLQIVTGKAREIGAELTSNDTVRKLSFTGSRLLMAQ
2d4eA           TVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQG--FGEEAGAALVAHPLVPLLTLTGETETGKIVMR
1bi9B           TVVIKPAEQTPLSALYMGALIKEAG----FPPGVVNILPGYGPTAGAAIAGIDKIAFTGSTEVGKLIQEA
1a4zA           VVVMKVAEQTPLTALYVANLIKE----AGFPPGVVNVIPGFGPTAGAAIADVDKVAFTGSTEVGHLIQVA
3ek1G           TMIVRPADLTPLTALALGVLAEK-----AGIPAGVLQIVTGKAREIGAELTSNDTVRKLSFTGGRLLMAQ
1bi9C           TVVIKPAEQTPLSALYMGALIKEAG----FPPGVVNILPGYGPTAGAAIAGIDKIAFTGSTEVGKLIQEA
3efvC           SYLLKHAPNVTGCAQIARILAEAGT-----PAGVYGWVNANNEGVSQINDPRIAAVTVTGSVRAGAAIGA
3efvA           SYLLKHAPNVTGCAQIARILAEAGT-----PAGVYGWVNANNEGVSQINDPRIAAVTVTGSVRAGAAIGA
3dorA           KLRTQENPSTSFCQQVLADFIGGLNDFHAGVTFFAIESAYLPYTVQKSSDGRFYFVDIMTFSSEIRELLE
3e2pK           ------------------------------GGEVITMTDLKSSSVADTIRVISGYADIIVLRHPSGAARL
3cyvA           KNAELACEVTLRYPLDAAILFSDILTVPDAMGLGLYFEAGEGP-RFTSPVTCKADVDKLPIPDPEDELGY
2c8eG           GKLRQNKGVIFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQ--NTLLNSNGTINKTAFEK
3cgwA           NILIGPSNPITSIGPIISLPGRE-----LLKKKKVVAVSPIIGNAPVSGPAGKLPACGIEVSSGVAEYYQ
3c3dA           NILIGPSNPITSIGPIISLPGRE-----LLKKKKVVAVSPIIGNAPVSGPAGKLPACGIEVSSGVAEYYQ
3e08A           PQMLQVFAYDPAGQARLREVLEAPS----LYEEFLRYL-ARFGHAIPQQYQARDWTAAHVADDTLRPVFE
1e0tA           LGVEIPVEEVIFAQKMMIEKCIR--ARKVVITATMRPTDAEAGDVANAILDGTDAVMLSGEPLEAVSIMA
3dorB           KLRTQENPSTSFCQQVLADFIGG---LNDFHAGVTFFAAYLPYTVQKSSDGRFYFVDIMTFSSEIRVGDE
3cskA           -------------------------SHFFADHDAPLSMLSVKTEYFPQLTDYAHFMSKASHAGSRVVMRQ
2e3kB           ----------------------------------------------------------------------
3bjzB           KILSCGNGGSAGDAQHFSSELLNRPSLPAVALTTDSSYNEVFSKQIRALGQPGDVLLAISTSGNSANVIQ
2e7nA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VVENATVPVIETGVGNCHVYVDVDADPGMALEILLNAKCQRYGVCNAAESLLVHEGIAANWLPGAVQELN
1ad3A           AAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSGTCVAPDYILCDPSIQNQIVEKLKKSLK
1co3A           LFNLAHEPFYGELGAINPTFIFPSAMRAKADLFVASMTMGCGQFCTKPGVVFALNTPETQAFIETVSRGS
1co3B           LFNLAHIPFYGELGAINPTFIFPSAMRAKADLFVASMTMGCGQFCTKPGVVFALNTPETQAFIQVVSRGS
1bxsA           AGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGCCIAASRLFVEESIYDEFVRDLIESGK
1a4sA           VMEMSVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGVCTNGTRVFVQREIMPQFLEEVVKRTK
2bjaA           IYEAAGRRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKSAASRLILTQGAYEPVLERVLKRAE
2bhpA           IYEAAGKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGKCSAASRLILTQGAYEPVLERVLKRAE
3ed6A           IMKNAVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGVCSAGSRILVQNSIKDKFEQALIDRVK
3b4wA           VGRRAAKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGGCVNQTRILAPRSRYDEIVAGYIAKGI
2d4eC           NAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGRCTASSRLLVEEKIFEDFVGGYVEAGK
1bi9D           AGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGCCTAGSRIFVEESIYEEFVKRSVERAK
1bi9A           AGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGCCTAGSRIFVEESIYEEFVKRSVERAK
3ek1B           CAPTIKRISLELGGNAPFIVFD-DADLDAAVDGAMVSKYRNAGTCVCANRIYVQRGVYDKFLAAKVKELK
3ek1A           CAPTIKRISLELG-GNAPFIVFDDADLDAAVDGAMVSKYRNAGTCVCANRIYVQRGVYDKFLAAKVKELK
2d4eA           NAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGRCTASSRLLVEEKIFEDFVLGYVEAGK
1bi9B           AGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGCCTAGSRIFVEESIYEEFVKELIQSGV
1a4zA           AGKSNLKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQGCCCAGSRTFVQEDIYAEFVEGYIKSGK
3ek1G           CAPTIKRISLELGGNAPFI-VFDDADLDAAVDGAMVSKYRNAGTCVCANRIYVQRGVYDKFLAAKVKELK
1bi9C           AGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGCCTAGSRIFVEESIYEEFVKGAKLECG
3efvC           QAGAALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGVCAAAKRFIVEEGIAAALKGDPLVEEN
3efvA           QAGAALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGVCAAAKRFIVEEGIAAALKGDPLVEEN
3dorA           VDGAPVQDVLATLYGSNHKGTAAEESAALRTLFSRMASLG---HKVPSGRTTLKIRRPFGTTREVRVKWR
3e2pK           ASEYSQVPIINAGDGSNQHPTQTLLDL----YTIMREIGRIDGIKIAFVGDLKYGRTVHSLVYALSLF--
3cyvA           VMNAVRTIRHELKGEVPLIGFS-GSPWTLATYMVEGGSSKAFTIKKMMYADPQALHAYQQFSLYYMHKIV
2c8eG           AKAKFLNKDRLEYGYISTSLMNVFAGRPIITKFKVAKGSKAGY--------IDPISAFAGQLNMLLPRHS
3cgwA           DFLDVFVFDERDR-ADEFAFERLGCHASRA------DTLTSTEKSKELAEIVVQ----------------
3c3dA           DFLDVFVFDERDR-ADEFAFERLGCHASRA------DTLTSTEKSKELAEIVVQAFLE------------
3e08A           RIYENEYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSGVGFLQQALALTF-------------
1e0tA           TICERTDRVMNSRLEITEAVCRGAVETAEKLDAPLIVVATQGGSARAVRKYFPDATILALTTNEKTA---
3dorB           LLEVDGQDVLATLYGSNHKGTAAEESAALRTLFSRMASLGHKVPSGRTTL--------------------
3cskA           VSHESELAIHSKLNGKYPEDDITQKQQTGLYLEYVSQ-----FSNLGNFKSFGDTKFIPRCEVKFFKQLL
2e3kB           ----------------------------------------------------------------------
3bjzB           AIQDRELVVALTGRDGGGASLLLPEDVEIRVP---SKIT----ARIQEVHLLAIHCLC------------
2e7nA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TRGVEIRGCSKVVEILSGVKKAEDSDWATEFLSPVLAIKVVKDFQDALDHIQQYSSGHSESIVTNNQNTA
1ad3A           DFYGEDAKQSQKVAILVDV-DPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNEKVI
1co3A           DDGIDVTFSQAESPLFVTSSERKHPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYP
1co3B           DDGIDVTFSQAESPLFVTSSERKHPAWEEEIFGPQSLIVVCENVADMLSLSEMLAGSLTATIHATEEDYP
1bxsA           KEGAKLECGGGPWGVFSDV-TDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKA
1a4sA           AIVVGDQAKKEGARVLCGNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRA
2bjaA           RLSVGPIGKNEGQLVLGGEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHL
2bhpA           RLSVGPAEENPDLGVFTEV-PPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHL
3ed6A           KIKLGNKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKA
3b4wA           EEGARLVCGGGRPEVFADVD-NKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKG
2d4eC           REGARLLVGGERAKTSFRGEDLSRKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERA
1bi9D           RRIVGSKGFFIEPTVFSNV-TDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKA
1bi9A           RRIVGSPFDPTTPTVFSNV-TDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKA
3ek1B           VTGGKELGGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRA
3ek1A           VTGGKELGGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRA
2d4eA           REGARLLVGGERAKTSFRGEENHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERA
1bi9B           AEGAKLKGFFIEPTVFSNV-TDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKA
1a4zA           EEGLKLRGYFIQPTVFGDLQ-DGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKA
3ek1G           VTGGKELGGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRA
1bi9C           GKGLGRKGFFIEPTVFSNV-TDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKA
3efvC           DLGPARASVAEGARLLLGGEKIAGTAFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLA
3efvA           DLGPARASVAEGARLLLGGEKIAGTAFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLA
3dorA           YVPEGVGDLATIAPSIRAPQLGYN----------------------------------------------
3e2pK           -ENVEMYFVS------------------------------------------------------------
3cyvA           DGLLRENDGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTTDIADARRRVGNKPSMLYAPPARIEEEVA
2c8eG           T---------------------------------------------------------------------
3cgwA           ----------------------------------------------------------------------
3c3dA           ----------------------------------------------------------------------
3e08A           ----------------------------------------------------------------------
1e0tA           ----------------------------------------------------------------------
3dorB           ----------------------------------------------------------------------
3cskA           ELAKINQGYTSAYYLGLPVTPEDMALLKEQLFAELAILPENTRINKVGENSFQI--WVASENVKNQ-ITE
2e3kB           -------------GILKELLSKKHAAYAWPFYKPVDASA--LGLHDYHDIIKHDLSTVKRKMENRDYRDA
3bjzB           ----------------------------------------------------------------------
2e7nA           -------------SILREMLSKKHAAYAWPFYKPVDAEA--LELHDYHDIIKHDLSTVKRKMDGREYPDA


                         .         .         .         .         *         .         .:420
query           AEFLRQVDAAAVYHNASTRFTDGFEYGFGAEIGISTQKLHARGPMGLRELTSYKYVVKGTGQVRP
1ad3A           KKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYH--GKKSFETFSHRRSCLVKSLLNEE
1co3A           QVSRLEEIAGRLVFNGWPTEVEVGYAMGGPYPASTHSASTSVGAEAIHRWLRPVAYQALPESLLP
1co3B           QVSQLEEIAGRLVFNGWPTEVEVGYAMGGPYPASTHSASTSVGAEAIHRWLRPVAYQALPESLLP
1bxsA           ITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNG----RELGEYGFHEYTEVKTVTIKISQKN-
1a4sA           HRVAANLEAGTCYINTYSISPVEVPFGGYKMSGFG----RENGQATVDYYSQLKTVIVEMGDVDS
2bjaA           EWARREFHVGNLYFNRKITGALVGVQPFGG-FKLSGTNAKTGALDYLRLFLEMKAVA--------
2bhpA           EWARREFHVGNLYFNRKITGALVGVQPFG-GFKLSGTNAKTGALDYLRLFLEMKAVA--------
3ed6A           QRVANKLKLGTVWINDFHPYFAQAPWGGYKQSGIG----RELGKEGLEEYLVSKHILTNTNPQLV
3b4wA           IKISQQIRTGTYGIN-WYAFDPGSPFGGYKNSGIG----RENGPEGVEHFTQQKSVLLPMGYT--
2d4eC           HRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDR----REGGTYALDFYTDLKTIALPLRPPH-
1bi9D           LMVSSAMQAGTVWINCYNAL---------------------NGEFGLREYSEVKTVTVKIPQKN-
1bi9A           LMVSSAMQAGTVWINCYGEF--GLRE---------------------------------------
3ek1B           IRVSEALEYGMVGHNTGLISNEVAPFGGVKQSGLG----REGSKYGIEEYLETKYICSAYKR---
3ek1A           IRVSEALEYGMVGHNTGLISNEVAPFGGVKQSGLG----REGSKYGIEEYLETKYICSAYKR---
2d4eA           HRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDR----REGGTYALDFYTDLKTIALPLRPPH-
1bi9B           LMVSSAMQAGTVWINCYGEF--GLR----------------------------------------
1a4zA           NYLSQALQAGTVWVNCYDVFGAQSPFGGYKLSGSG----RELGEYGLQAYTEVKTVT--------
3ek1G           IRVSEALEYGMVGHNTGLISNEVAPFGGVKQSGLG----REGSKYGIEEYLETKYICSAYKR---
1bi9C           LMVSSAMQAGTVWINCYNAGEFGLREYSEVTVTVKI-----------------------------
3efvC           AEAAR-LECGGVFINGYSASDARVAFGGVKKSGFGR----ELSHFGLHEFCNVQTVWKNR-----
3efvA           AEAAR-LECGGVFINGYSASDARVAFGGVKKSGFGR----ELSHFGLHEFCNVQTVWKNR-----
3dorA           -----------------------------------------------------------------
3e2pK           -----------------------------------------------------------------
3cyvA           TILAGFGHGEGHVFNLGHGIHQDVPPE--------------------------------------
2c8eG           -----------------------------------------------------------------
3cgwA           -----------------------------------------------------------------
3c3dA           -----------------------------------------------------------------
3e08A           -----------------------------------------------------------------
1e0tA           -----------------------------------------------------------------
3dorB           -----------------------------------------------------------------
3cskA           TYPSGQITLSNAVTKVEFIFGDHSREMRLVA----------SYLKEAQKFAANDTQKAMLQE---
2e3kB           QEFAA--DVRLMFSNCYKYNPPDHDVVAMARK---------------------------------
3bjzB           -----------------------------------------------------------------
2e7nA           QGFAA--DVRLMFSNCYK------YNPPDHEVVAMARKLQDVFEMRFAKM---------------