[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO49715.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c8cA.bssp"
#ERROR : Can't open dsspfile "2ch7A.bssp"
#ERROR : Can't open dsspfile "3by9B.bssp"
#ERROR : Can't open dsspfile "3e4pA.bssp"
#ERROR : Can't open dsspfile "2a0uB.bssp"
#ERROR : Can't open dsspfile "3e4oA.bssp"
#ERROR : Can't open dsspfile "2ch7B.bssp"
#ERROR : Can't open dsspfile "3e4pB.bssp"
#ERROR : Can't open dsspfile "3by9A.bssp"
#ERROR : Can't open dsspfile "3c9iB.bssp"
#ERROR : Can't open dsspfile "2dq6A.bssp"
#ERROR : Can't open dsspfile "2dqmA.bssp"
#ERROR : Can't open dsspfile "2dgjB.bssp"
#ERROR : Can't open dsspfile "1a87A.bssp"
#ERROR : Can't open dsspfile "3ebhA.bssp"
#ERROR : Can't open dsspfile "3cmnA.bssp"
#ERROR : Can't open dsspfile "3c3lB.bssp"
#ERROR : Can't open dsspfile "3c46B.bssp"
#ERROR : Can't open dsspfile "3c2pB.bssp"
#ERROR : Can't open dsspfile "2dgjA.bssp"
#ERROR : Can't open dsspfile "3c3lA.bssp"
#ERROR : Can't open dsspfile "3c46A.bssp"
#ERROR : Can't open dsspfile "3dyjA.bssp"
#ERROR : Can't open dsspfile "3c9iD.bssp"
#ERROR : Can't open dsspfile "1d6mA.bssp"
#ERROR : Can't open dsspfile "3by8A.bssp"
#ERROR : Can't open dsspfile "3bjqD.bssp"
#ERROR : Can't open dsspfile "2c9eA.bssp"
#ERROR : Can't open dsspfile "3c2pA.bssp"
#ERROR : Can't open dsspfile "3c9iE.bssp"
#ERROR : Can't open dsspfile "1e79D.bssp"
#ERROR : Can't open dsspfile "2d4yB.bssp"
#ERROR : Can't open dsspfile "3cwfA.bssp"
#ERROR : Can't open dsspfile "2d4yA.bssp"
#ERROR : Can't open dsspfile "1e6vB.bssp"
#ERROR : Can't open dsspfile "3c9iF.bssp"
#ERROR : Can't open dsspfile "3bt5A.bssp"
#ERROR : Can't open dsspfile "3cwfB.bssp"
#ERROR : Can't open dsspfile "2basB.bssp"
#ERROR : Can't open dsspfile "2aswA.bssp"
#ERROR : Can't open dsspfile "2basA.bssp"
#ERROR : Can't open dsspfile "3bp9Y.bssp"
#ERROR : Can't open dsspfile "1cnt4.bssp"
#ERROR : Can't open dsspfile "3bt5A.bssp"

## Summary of PDB Search
:621
    4e-33  22%  3c8cA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    2e-27  18%  2ch7A  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    3e-26  13%  3by9B  [x.x.x] SENSOR PROTEIN
    7e-26  17%  3e4pA  [x.x.x] C4-DICARBOXYLATE TRANSPORT SENSOR PROTEIN DCTB
    1e-25  12%  2a0uB  [x.x.x] INITIATION FACTOR 2B
    3e-25  17%  3e4oA  [x.x.x] C4-DICARBOXYLATE TRANSPORT SENSOR PROTEIN DCTB
    1e-24  18%  2ch7B  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    7e-24  17%  3e4pB  [x.x.x] C4-DICARBOXYLATE TRANSPORT SENSOR PROTEIN DCTB
    7e-22  12%  3by9A  [x.x.x] SENSOR PROTEIN
    3e-21   9%  3c9iB  [x.x.x] TAIL NEEDLE PROTEIN GP26
    3e-21   9%  2dq6A  [x.x.x] AMINOPEPTIDASE N
    3e-20   8%  2dqmA  [x.x.x] AMINOPEPTIDASE N
    2e-19   7%  2dgjB  [x.x.x] HYPOTHETICAL PROTEIN EBHA
    2e-19  12%  1a87A  [x.x.x] COLICIN N[MASQUE : MEMB(X) 46 / COIL(x) 0]
    8e-19   8%  3ebhA  [x.x.x] M1 FAMILY AMINOPEPTIDASE
    2e-17   8%  3cmnA  [x.x.x] PUTATIVE HYDROLASE
    3e-17   8%  3c3lB  [x.x.x] VIRION RNA POLYMERASE
    5e-17   8%  3c46B  [x.x.x] VIRION RNA POLYMERASE
    6e-17   8%  3c2pB  [x.x.x] VIRION RNA POLYMERASE
    8e-17   9%  2dgjA  [x.x.x] HYPOTHETICAL PROTEIN EBHA
    1e-16   7%  3c3lA  [x.x.x] VIRION RNA POLYMERASE
    3e-16   8%  3c46A  [x.x.x] VIRION RNA POLYMERASE
    1e-14   7%  3dyjA  [x.x.x] TALIN-1
    2e-14   8%  3c9iD  [x.x.x] TAIL NEEDLE PROTEIN GP26
    8e-14   8%  1d6mA  [e.10.1] DNA TOPOISOMERASE III
    1e-13  12%  3by8A  [x.x.x] SENSOR PROTEIN DCUS
    1e-13   6%  3bjqD  [x.x.x] PHAGE-RELATED PROTEIN
    3e-13   7%  2c9eA  [x.x.x] PERIDININ-CHLOROPHYLL A PROTEIN
    2e-12   8%  3c2pA  [x.x.x] VIRION RNA POLYMERASE
    3e-12   7%  3c9iE  [x.x.x] TAIL NEEDLE PROTEIN GP26
    4e-11   5%  1e79D  [b.49.1 - c.37.1 - a.69.1] ATP SYNTHASE BETA CHAIN
    2e-10   8%  2d4yB  [x.x.x] FLAGELLAR HOOK-ASSOCIATED PROTEIN 1
    4e-10  12%  3cwfA  [x.x.x] ALKALINE PHOSPHATASE SYNTHESIS SENSOR PROTEIN
    5e-10   6%  2d4yA  [x.x.x] FLAGELLAR HOOK-ASSOCIATED PROTEIN 1
    7e-10   8%  1e6vB  [d.58.31 - a.89.1] METHYL-COENZYME M REDUCTASE I BETA SUBUNIT
    2e-09  10%  3c9iF  [x.x.x] TAIL NEEDLE PROTEIN GP26
    2e-09   9%  3bt5A  [x.x.x] UNCHARACTERIZED PROTEIN DUF305
    9e-09  11%  3cwfB  [x.x.x] ALKALINE PHOSPHATASE SYNTHESIS SENSOR PROTEIN
    1e-06  19%  2basB  [x.x.x] YKUI PROTEIN
    1e-05  37%  2aswA  [x.x.x] HYPOTHETICAL PROTEIN AF1503
    1e-05  16%  2basA  [x.x.x] YKUI PROTEIN
    8e-05   9%  3bp9Y  [x.x.x] GAG PROTEIN
    4e-04  15%  1cnt4  [a.26.1] CILIARY NEUROTROPHIC FACTOR
    3e-08   7%  3bt5A  [x.x.x] UNCHARACTERIZED PROTEIN DUF305(query 331->450)
:621

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMEKAINQKVKEGEMVASLIIREEIQHFLD
3c8cA           ------------------------------------------------------------VSKTTAEVIN
2ch7A           ----------------------------------------------------------------------
3by9B           ------------------------------------------------------------FSSHIVATLD
3e4pA           ------------------------------------------------------------KASLLRAVVE
2a0uB           ----------------------------------------------------------------------
3e4oA           ------------------------------------------------------------KASLLRAVVE
2ch7B           ----------------------------------------------------------------------
3e4pB           --------------------------------------------GLAGQSRIDASLKASLLRAVVERQRA
3by9A           -----------------------------------------QYQALLNEHQS----QLDRFSSHIVATLD
3c9iB           ----------------------------------------------------------------------
2dq6A           ----------------------------------------------------------------------
2dqmA           ----------------------------------------------------------------------
2dgjB           ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
3ebhA           ----------------------------------------------------------------------
3cmnA           ----------------------------------------------------------------------
3c3lB           ----------------------------------------------------------------------
3c46B           ----------------------------------------------------------------------
3c2pB           ----------------------------------------------------------------------
2dgjA           ----------------------------------------------------------------------
3c3lA           ----------------------------------------------------------------------
3c46A           ----------------------------------------------------------------------
3dyjA           ----------------------------------------------------------------------
3c9iD           ----------------------------------------------------------------------
1d6mA           ----------------------------------------------------------------------
3by8A           -----------------------------------------------------DMTRDGLANLAVARTLA
3bjqD           ----------------------------------------------------------------------
2c9eA           ----------------------------------------------------------------------
3c2pA           ----------------------------------------------------------------------
3c9iE           ----------------------------------------------------------------------
1e79D           ----------------------------------------------------------------------
2d4yB           ----------------------------------------------------------------------
3cwfA           -------------------------------------------------------------QRKAEEHIE
2d4yA           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------
3cwfB           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2aswA           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3bp9Y           ----------------------------------------------------------------------
1cnt4           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQSEFQNIYFVTGSGEITIAPVKQLPKDFDPRQRVWYQE
3c8cA           GRKSIAQ--YATSLIENNPEPDNVRTIISQPLIKFLLVGFGLEKDGSNINNDPSWNPGPWDPRVRPWYKD
2ch7A           ----------------------------------------------------------------------
3by9B           KYAHIPHLISLLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWNLDRSFNFAWRPYFYL
3e4pA           RQRALPLVLAALLSPDRPSLDRINRKLEALATSAEAAVIYLIDRSGVAVAASNWQEPTSFDYAFRDYFRL
2a0uB           ----------------------------------------------------------------------
3e4oA           RQRALPLVLAALLSPDRPSLDRINRKLEALATSAEAAVIYLIDRSGVAVAASNWQEPTSFDYAFRDYFRL
2ch7B           ----------------------------------------------------------------------
3e4pB           LPLVLADDAAIRGALLSPDLDRINRKLEALATSAEAAVIYLIDRSGVAVAASNWQEPTGNDYAFRDYFRL
3by9A           KYAHIPHLISLLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWNLDRGRNFAWRPYFYL
3c9iB           ----------------------------------------------------------------------
2dq6A           ----------------------------------------------------------------------
2dqmA           ----------------------------------------------------------------------
2dgjB           ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
3ebhA           ----------------------------------------------------------------------
3cmnA           ----------------------------------------------------------------------
3c3lB           ----------------------------------------------------------------------
3c46B           ----------------------------------------------------------------------
3c2pB           ----------------------------------------------------------------------
2dgjA           ----------------------------------------------------------------------
3c3lA           ----------------------------------------------------------------------
3c46A           ----------------------------------------------------------------------
3dyjA           ----------------------------------------------------------------------
3c9iD           ----------------------------------------------------------------------
1d6mA           ----------------------------------------------------------------------
3by8A           DSPEIRQGLQ-----KKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHP--EAQRIGQPFKGDDILK
3bjqD           ----------------------------------------------------------------------
2c9eA           ----------------------------------------------------------------------
3c2pA           ----------------------------------------------------------------------
3c9iE           ----------------------------------------------------------------------
1e79D           ----------------------------------------------------------------------
2d4yB           ----------------------------------------------------------------------
3cwfA           KEAKYLASLLDAGNLNNQANEKIIKDA----GGALDVSASVIDTDGKVL----------YGSNGRSADSQ
2d4yA           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------
3cwfB           -EEHIEKEAKYLASLLDAGNQANEKIIKDAGGALDV-SASVIDTDGKVL----------YGSNGRSADSQ
2basB           --------------------------------------------------------YAEKNWSWRPYFLE
2aswA           ----------------------------------------------------------------------
2basA           -------------------------IKKLAEELTDCSFRIYCDEEG-DQLTGNVFKQDGYQPEYRPYFLE
3bp9Y           ----------------------------------------------------------------------
1cnt4           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AVKKGTMVCTDPYIDQATGKPCMTVALAVKDSEGRFVGVLGADIKLETISSLAVKYKFGEEGYFYVCDKQ
3c8cA           AKNAGKLVITAPYADSASGEILVSVATPVKDATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSED
2ch7A           ----------------------------------------------------------------------
3by9B           SIAGQKSQ--YFALGSTSGQRGYYYAYPVIY-AAEILGVIVVKDLSAIEQ------GWQNKSSYFVATDD
3e4pA           AVRDGMA--EHFAMGTVSKRPGLYISRRVDG-PGGPLGVIVAKLEFDGVEA----DWQASGKPAYVTDRR
2a0uB           ----------------------------------------------------------------------
3e4oA           AVRDGA----EHFAGTVSKRPGLYISRRVDG-PGGPLGVIVAKLEFDGVEA----DWQASGKPAYVTDRR
2ch7B           ----------------------------------------------------------------------
3e4pB           AVRDGMA--EHFAMGTVSKRPGLYISRRVDG-PGGPLGVIVAKLEFDGVE----ADWQASGKPAYVTDRR
3by9A           SIAGQKSQYFALG--STSGQRGYYYAYPVIYA-AEILGVIVVKDLSAIEQ------GWQNKSSYFVATDD
3c9iB           ----------------------------------------------------------------------
2dq6A           ----------------------------------------------------------------------
2dqmA           ----------------------------------------------------------------------
2dgjB           ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
3ebhA           ----------------------------------------------------------------------
3cmnA           ----------------------------------------------------------------------
3c3lB           ----------------------------------------------------------------------
3c46B           ----------------------------------------------------------------------
3c2pB           ----------------------------------------------------------------------
2dgjA           ----------------------------------------------------------------------
3c3lA           ----------------------------------------------------------------------
3c46A           ----------------------------------------------------------------------
3dyjA           ----------------------------------------------------------------------
3c9iD           ----------------------------------------------------------------------
1d6mA           ----------------------------------------------------------------------
3by8A           ALNGEE----NVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQ------------------
3bjqD           ----------------------------------------------------------------------
2c9eA           ----------------------------------------------------------------------
3c2pA           ----------------------------------------------------------------------
3c9iE           ----------------------------------------------------------------------
1e79D           ----------------------------------------------------------------------
2d4yB           ----------------------------------------------------------------------
3cwfA           KVQALV----SGHEGILSTDNKLYYGLSLRS-EGEKTGYVLLSA--------------------------
2d4yA           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------
3cwfB           KVQAL----VSGHEGILSTTNKLYYGLSLRS-EGEKTGYVLLSA--------------------------
2basB           NIRRNKGFFSDLYSDLETGE---IRTFSYPDDQ-----YLFIDLPYS-----------------------
2aswA           ----------------------------------------------------------------------
2basA           NIRRNLRKGSDLYSDLETGE-IRTFSYPDD-------QYLFIDL--------------------------
3bp9Y           ----------------------------------------------------------------------
1cnt4           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GKVIGHPDAKAINGDIMNRAYVKAALAGKSGFDTYADNGVKKLVYYSEIPKTGWGLFVQQPEQEAYAELY
3c8cA           GTTIAHPKKEFNGKPSEFLG----ESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALD
2ch7A           ----------------------------------------------------------------------
3by9B           HQVVFSSQPAWLFHSVADWQGDLQAEQSEWRKPEKHWLQDDYIVSSRPLPELALTIRVLSPKIE------
3e4pA           GIVLITSLPSWRFMTTKSLQFGDAPLLPLPFRKIEARDGSSTLDALLPGDSTAAFLRVETMVPSTNWRL-
2a0uB           ----------------------------------------------------------------------
3e4oA           GIVLITSLPSWRLLPLPFRKIEARPDGSSTLDALLPGDSTAAFLRVETVPSTNWRLEQLSP---------
2ch7B           ----------------------------------------------------------------------
3e4pB           GIVLITSLPSWRFMTTKSLQFGDAPLLPLPFRKIEARDGSSTLDALLPGDSTAAFLRVETMVPST-----
3by9A           HQVVFSSQLDSPIPSLGWQG-DLQAEQSEWRKPEKHWLQDDYIVSSRPLPELALTIRVLSP---------
3c9iB           ----------------------------------------------------------------------
2dq6A           ----------------------------------------------------------------------
2dqmA           ----------------------------------------------------------------------
2dgjB           ----------------------------------------------------------------------
1a87A           ----------------------------------------------------------------------
3ebhA           ----------------------------------------------------------------------
3cmnA           ----------------------------------------------------------------------
3c3lB           ----------------------------------------------------------------------
3c46B           ----------------------------------------------------------------------
3c2pB           ----------------------------------------------------------------------
2dgjA           ----------------------------------------------------------------------
3c3lA           ----------------------------------------------------------------------
3c46A           ----------------------------------------------------------------------
3dyjA           ----------------------------------------------------------------------
3c9iD           ----------------------------------------------------------------------
1d6mA           ----------------------------------------------------------------------
3by8A           ----------------------------------------------------------------------
3bjqD           ----------------------------------------------------------------------
2c9eA           ----------------------------------------------------------------------
3c2pA           ----------------------------------------------------------------------
3c9iE           ----------------------------------------------------------------------
1e79D           ----------------------------------------------------------------------
2d4yB           ----------------------------------------------------------------------
3cwfA           ----------------------------------------------------------------------
2d4yA           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------
3cwfB           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2aswA           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3bp9Y           ----------------------------------------------------------------------
1cnt4           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RARNxxxxxxxxxxxxxxxxxxxxxxxxVNVIKMVGEGARAIAQGNLTYSLTIARKDELGILSDSINEMT
3c8cA           ELRR------------------------------------------------------------------
2ch7A           -----------------------------------------------------------GSHMKDVQTET
3by9B           ----------------------------------------------------------------------
3e4pA           ----------------------------------------------------------------------
2a0uB           -------------------------------IKYTPGSLRLLDQRKLPLETVFDDVLTVEDIWSAIKERV
3e4oA           ----------------------------------------------------------------------
2ch7B           ---------------------------------------------------------------KDVQTET
3e4pB           ----------------------------------------------------------------------
3by9A           ----------------------------------------------------------------------
3c9iB           -----------------------------------GALVPRGSHMADPSLNNPVQATRLDASILPRNVFS
2dq6A           --------------------------------------------------------VEHEDIAKRTLRNA
2dqmA           --------------------------------------------------LAIYNANYQSEYRVEHEDIA
2dgjB           --------------------------------------------------------QHGIDDENATKQTQ
1a87A           ----------------------------PEYSLLAKLIDAESIKGTEVYTFHTRKGQYVKVTVPDSNIDK
3ebhA           -------------------------------VSNLDTDVLADTKEYIYKQIGDKLNDVYYKMFKSLEAKA
3cmnA           ----------------------------------------------------------------------
3c3lB           -------------------------------------------------------------------AKD
3c46B           ----------------------------------------------------------------AEKAKD
3c2pB           -------------------------------------------------------------------AKD
2dgjA           ----------------------------------------------------------------------
3c3lA           ---------------------------------ALQENMLHFFVEPLRNGITQTVGESLVYSTEQLQKAT
3c46A           --------------------------------------------------------KQRVQEKLAEKAKD
3dyjA           ------------------------------------------TAGTLNREGAETFADHREGILKTAKVLV
3c9iD           ----------------------------------------------------------------------
1d6mA           ----------------------------------------------------------------------
3by8A           ----------------------------------------------------------------------
3bjqD           ----------------------------------------------------------------------
2c9eA           -------------------------------------------YDSFKALTSAVRDASINGAKAPVIAED
3c2pA           --------------------------------------------------------KQRVQEKLAEKAKD
3c9iE           -------------------------------------------------MADPSLNNPVVIQATRLDASI
1e79D           ----------------------------------------------------------------------
2d4yB           ----------------------------------------------------------------------
3cwfA           ----------------------------------------------------------------------
2d4yA           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
3bt5A           ----------------------------------------------------------------------
3cwfB           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2aswA           -------------------------------IIELSNTADKIAEGNLEAEVPQNRADEIGILAKSIERLR
2basA           ----------------------------------------------------------------------
3bp9Y           -------------------------------------GNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLT
1cnt4           ----------------------------------------------------------------------
3bt5A           --------------------------------------------------LERSQQRTVRSLLDIQLSQR


                         .         .         .         .         *         .         .:420
query           NHLKTIIGGVKDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSA
3c8cA           ----------------------------------------------------------------------
2ch7A           FSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASLA
3by9B           ----------------------------------------------------------------------
3e4pA           ----------------------------------------------------------------------
2a0uB           RGAPAIAVSAAVATQRKAANGELKSGREVQTFLLTSCDFVTSRPTAVNLFNCLRDLKAQVDKLDPTKAAA
3e4oA           ----------------------------------------------------------------------
2ch7B           FSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASLA
3e4pB           ----------------------------------------------------------------------
3by9A           ----------------------------------------------------------------------
3c9iB           KSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRSRITANTKAITALNVRV
2dq6A           CLRFLAFGETHLADVLVSKQFHEANNMTDALAALSAAVAAQLPDALMQEYDDKWHQNGLVMDKWFILQAT
2dqmA           KRTLRNACLRFLAFGETHLADVLVSKQFHEANNMTDALAALSAAVAAQLPCRDALMQEYDDKW-----HQ
2dgjB           KYRDAEQSKKTAYDQAVAAAKAILNKQTDKAAVDRALQQVTSTKDALNGDAKLAQNLGTLNHITNAQRTA
1a87A           MRVYVNWKGPKYNNKLVKRFVSQFLLFRKEEKEKNEKKASELVSDKLGEYLGVKYKNVAKEVAND---IK
3ebhA           DDLTYFNDESHVDFDQMNMRTNTLKAQYPNILNEIIEHSKSPYPSNWLTSLSVSAYFDKYFELYDKTYKL
3cmnA           ------------DWEQARQAALRLSQWEQAPVDNRAFRREQYARMVALSEPLIADYLGVRLPEPVSRIFV
3c3lB           PTWKKGDFLTQKELNDIQASLNNLAPMIETGSQTFYIAGSENAQVLATNLDDRMRVPMSIYAPAQAGVAG
3c46B           PTWKKGDFLTQKELNDIQASLNNLAPMIETGSQTFYIAGSENAEVANQVLATNLDDRMRVPMSIYAPAQA
3c2pB           PTWKKGDFLTQKELNDIQASLNNLAPMIETGSQTFYIAGSENAEVANQVLATNLDDRMRVPMSIYAPAQA
2dgjA           ---------GIDDENATKQTQKYRDAEQSKKTAYDQAVAAAKAILNKQDKAAVDRALQQVTSTKDALNGD
3c3lA           QIQSVVLEDMFKQRVQEKLAEKAKDPTWKKGDFLTQKELNDIQMIETGSQTFYIAGSENAEVANQVLATN
3c46A           PTWKKGDFLTQKELNDIQASLNNLAPMIETGSQTFYIAGSENAEVANQVLATNLDDRMRVPMSIYAPAQA
3dyjA           EDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKATKAAAGK
3c9iD           --------------------------LNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKA
1d6mA           -----------------------MRLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLE
3by8A           ----------------------------------------------------------------------
3bjqD           -----------------------------------YRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLY
2c9eA           GPVGRAAKKFSEATYPIMDKLD-WGKSPEISKYIETASAKNPKMMADGIDKTLEVALTMNQNAINDAVFA
3c2pA           PTWKKGDFLTQKELNDIQASLNNLAPMIETGSQTFYIAGSENAEVANQVLATNLDDRMRVPMSIYAPAQA
3c9iE           LPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRI
1e79D           ---KTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHMIESGVINLKDATSKVALVYGQMNEPPGAR
2d4yB           ----------------------------------------------------------------------
3cwfA           ----------------------------------------------------------------------
2d4yA           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
3c9iF           -----------SLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAI---AGKANEAGQGAYDAQ
3bt5A           ----------------------------------------------------------------------
3cwfB           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2aswA           RSLKVAM---------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3bp9Y           ALIESVLTTHQPTWDGTLLTGEEKQRVLLEARKAVTQLPNEVDAAYTTTEGRNHLVLYRQLLLAGLQNAG
1cnt4           ----------------------------------------------------------------------
3bt5A           EQMRQMEAMLGRWGQPPGEPISPEHARMMGMASEAEVAGLSTLPVEQAERQFLRLMIRHHQGAVAMTLPM


                         .         .         +         .         .         .         .:490
query           QHGQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKXXXXXXXXXXXXXXXNXXXXXXXXXXXXXGEHG
3c8cA           ----------------------------------------------------------------------
2ch7A           KEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARAGEAG
3by9B           ----------------------------------------------------------------------
3e4pA           ----------------------------------------------------------------------
2a0uB           EVAEAVYTNDVAFNEGIRHGAAHILAAAKAEGRDKV----SILTICNTGALATSRYGTALGVVRQLFYDG
3e4oA           ----------------------------------------------------------------------
2ch7B           KEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARAGEAG
3e4pB           ----------------------------------------------------------------------
3by9A           ----------------------------------------------------------------------
3c9iB           TTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVGGKKVVGARQTGWTAATG
2dq6A           SPAANVLETVRGLLQHRSFTMSNPNRIRSLIGAFAGSNPAAFH-----------------------AEDG
2dqmA           NGLVMDKWFILQATSPAANVLETVRGLLQHRSFTMSNPNRIRSLIGAFAGSN---------PAAFHAEDG
2dgjB           LEGQINQATTVDGVNTVKTNANTLDGANSLQGAINDKDATLRNQNYLDADESKRNAYTQAVTAAEGILNK
1a87A           NFHGRNIRSYNEAMASLNKVLANPKMKVNKSDKDAIV--------------NAWKQVNAKDMANKIGNLG
3ebhA           SKDDELLLQEWLKTVSRSDRKDIYEILKKLENEVLKDSKNPNDIR-------AVYLPFTNNLRRFHDISG
3cmnA           FDRREWLEANIVSFSQLFRPIEEMYEKSSKLLGVGLLGYLAQRVLGQYDLSLLSAGGSLYFVEPNIARVQ
3c3lB           IPFMTIGTGDGMMMQTLSTMKGAPKNTLKIFDGMNIGLNDITDASRK-------------------ANEA
3c46B           GVAGIPFMTIGTGDGMMMQTLSTMKGAPKNTLKIFDG---------------MNIGLNDITDASRKANEA
3c2pB           GVAGIPFMTIGTGDGMMMQTLSTMKGAPKNTLKIFDG---------------MNIGLNDITDASRKANEA
2dgjA           AKLAEAKAAARQNLGTLNHITNAQRTALEGQINQATTVDGVNTVKTNANTLDGANSLQGAINDKDATLRN
3c3lA           LDDRMRVPMSIYAPAQAGVAGIPFMTIGTGDGMMMQSTMKGAPKNTLKIFDGMNIGLNDITDASRKANEA
3c46A           GVAGIPFMTIGTGDGMMMQTLSTMKGAPKNTLKIFDG---------------MNIGLNDITDASRKANEA
3dyjA           VGDDPAVWQLKNSAKVVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDF
3c9iD           NEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDV-------------------------------DDHE
1d6mA           QAQPDAYDSRYARWNLADLPIVPEKWQLQPRPSVTKQLNVIKRFLHEASEIVHA------------GDPD
3by8A           ----------------------------------------------------------------------
3bjqD           NTKRT-KRIDFGYEGDPYSIVPSALEAKVPRELRDASQVPGIDLGARSVNTVLRIALAHEHECAQIALDP
2c9eA           HVRAIKGALNTPGLVAERDDFARVNLALAKMIATADPAKFKALLTAFPGNADLQMALFAANNPEQAKAAY
3c2pA           GVAGIPFMTIGTGDGMMMQTLSTMKGAPKNTLKIFDG---------------MNIGLNDITDASRKANEA
3c9iE           TANTKAITALNVRVTTAEGEIASLQTNVSALDGRV-------------------------------TTAE
1e79D           RVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTK
2d4yB           ----------------------------------------------------------------------
3cwfA           ----------------------------------------------------------------------
2d4yA           ----------------------------------------------------------------------
1e6vB           ------------------------------------------------------------------MRNE
3c9iF           VKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAE
3bt5A           ----------------------------------------------------------------------
3cwfB           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2aswA           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3bp9Y           R---------------------------------------------------------------------
1cnt4           ------------------------------------------------------------------GDFH
3bt5A           LDARPEVERLARQIVVTQRGEIRTMEGVLG----------------------------------------


                         *         .         .         .         .         +         .:560
query           KGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINI
3c8cA           ----------------------------------------------------------------------
2ch7A           RGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAV
3by9B           ----------------------------------------------------------------------
3e4pA           ----------------------------------------------------------------------
2a0uB           KLERVYACETRPWNQGARLTVYECVQEDIPCTLICDGAASSLNRKIDAVVVGADRICQNGDTANKIGTYN
3e4oA           ----------------------------------------------------------------------
2ch7B           RGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAV
3e4pB           ----------------------------------------------------------------------
3by9A           ----------------------------------------------------------------------
3c9iB           TANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKAMEDALRA-----------------------
2dq6A           SGYLFLVEMLTDLNSRNPQVASRLIEPLIRLKRYDAKRQEKMRAALEQLKGLENLSGDLYEKITKAL---
2dqmA           SGYLFLVEMLTDLNSRNPQVASRLIEPLIRLKRYDAKRQEKMRAALEQLKGLENLSGDLYEKITKAL---
2dgjB           QTGGNTSKADVDNALNAVTRAKAALNGAENLRNAKTSATNTINGLPNLTQLQKDNLKHQVE---------
1a87A           KAFKVAAIKVEKIREKSIEGYNTGNWGPLLL---------------------------------------
3ebhA           KGYKLIAEVITKTDKFNPMVATQLCEPFKLWNKLDTKRQELMLNEMNTMLQEPQISNNLKEYLLRLT---
3cmnA           QQLGLSDEDFRLWITLHEMTHAFEFEAYPWV----------RTYFRELLEQNFALTPEQRAVFDRIQALM
3c3lB           VYTSWQGNPIKNVYESYAKFMKNVDFSKLS-----------PEALEAIGKSALEYDQRENATVDDIANAA
3c46B           VYTSWQGNPIKNVYESYAKFMKNVDFSKLSPEALEAIGKS-----------ALEYDQRENATVDDIANAA
3c2pB           VYTSWQGNPIKNVYESYAKFMKNVDFSKLSPE-----------ALEAIGKSALEYDQRENATVDDIANAA
2dgjA           QNYLDADESKRNAYTQAVTAAEGI-----------LNKQTGGNTSKADVDNALNAVTRAKAALNGAENLR
3c3lA           VYTSWQGNPIKNVYESYAKFMKNVDFSKLSPEALEAIGKS-----------ALEYDQRENATVDDIANAA
3c46A           VYTSWQGNPIKNVYESYAKFMKNVDFSKLSPEALE-----------AIGKSALEYDQRENATVDDIANAA
3dyjA           IRTKGITATAKAVAAGNSCRQEDVIATANLSRRAIADLRACKEAAFHPEVAPDVRLRALHY----GRECA
3c9iD           SRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVT
1d6mA           REGQLLVDEVLDYLQLAPEKRQQVRCLINDLNPQAVERAIDRLRSNSEFVPLCVSALARARADWLYGINM
3by8A           ----------------------------------------------------------------------
3bjqD           AKYNADHKVKLVGSARWTSPDSDPTKDVETAKEAIADSIGEPNRLLSALSACKYHPKLIERVKYTRAESI
2c9eA           ETFVALTSAVA-----------------------------------------------------------
3c2pA           VYTSWQGNPIKNVYESYAKFMKNVDFSKLSPEALE-----------AIGKSALEYDQRENATVDDIANAA
3c9iE           NNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARTGWTAATGTANKGVFDADLTFAAIANAL
1e79D           KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAI------AELGIYPAVDPLDSTSRIMDPNIVG
2d4yB           --RQALIGKAEGLVNQFKTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMNDLLDQRDQLV
3cwfA           ----------------------------------------------------------------------
2d4yA           --RQALIGKAEGLVNQFKTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMTNLVSELNKIV
1e6vB           AIQSIVNDIKRTVAVDLEGIENALQNATVGGKGMKIPGREMDVDIVDNAEAIADEIEKMIRVYQDDDTNV
3c9iF           NNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDASEIQAIANAL
3bt5A           -------RTVRSLALDIQSQREQMRQMEAMLGRWGQPPGEPISPEHARMMGMASEAEVAGLSTLPVEQAE
3cwfB           ----------------------------------------------------------------------
2basB           ----------------------------------------------------------------------
2aswA           ----------------------------------------------------------------------
2basA           ----------------------------------------------------------------------
3bp9Y           ----------------------------------------------------------------------
1cnt4           QAIHTLLLQVAAFAYQIEELMILLEYKIPRNKKLWGLKVLQELS--------------------------
3bt5A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EELVEKMAQITRATITMSASIQNVXXXXXXXXXXXXXXNKMVEDLRQSAIVLDNMVQKFxx
3c8cA           -------------------------------------------------------------
2ch7A           ERINEMLQNIAAAIEEQTAAVDEITTAMTENAKNAEEITNSVKEVNARLQEISASTEEV--
3by9B           -------------------------------------------------------------
3e4pA           -------------------------------------------------------------
2a0uB           LAVSAKFHGVKLYVAAPTTTLDVK-------------------------------------
3e4oA           -------------------------------------------------------------
2ch7B           ERINEMLQNIAAAIEEQNAAVDEITTAMTENAKNAEEITNSVKEVNARL------------
3e4pB           -------------------------------------------------------------
3by9A           -------------------------------------------------------------
3c9iB           -------------------------------------------------------------
2dq6A           -------------------------------------------------------------
2dqmA           -------------------------------------------------------------
2dgjB           -------------------------------------------------------------
1a87A           -------------------------------------------------------------
3ebhA           -------------------------------------------------------------
3cmnA           SLIEGYGNHVMNAVGRRLLPSF---------------------------------------
3c3lB           SLIERNLRNIALGVDIRHKVLDKV--------------NLSIDQMAAVGAPYQNNGK----
3c46B           SLIERNLRNIALGVDIRHKVLDKV--------------NLSIDQMAAVGAPYQNNGK----
3c2pB           SLIERNLRNIALGVDIRHKVLDKV-------------------------------------
2dgjA           NAKTSATNTINGLPNLTQLQKDNL-------------------------------------
3c3lA           SLIERNLRNIALGVDIRHKVLDKV-------------------------------------
3c46A           SLIERNLRNIALGVDIRHKVLDKV--------------NLSIDQMAAVGAPYQNNGK----
3dyjA           NGYLELLDHVLLTLQKPNPDLKQQ-------------------------------------
3c9iD           TSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAIANALITERRRTKAMEDALRAH--
1d6mA           TRAYTILGGVLSVGRVQTPVLGLV-------------------------------------
3by8A           -------------------------------------------------------------
3bjqD           TIDLKALWEVEEIVVGTARVATG--------------------------------------
2c9eA           -------------------------------------------------------------
3c2pA           SLIERNLRNIALGVDIRHKVLDKV-------------------------------------
3c9iE           ITERRRTKAMEDALRAHGL------------------------------------------
1e79D           SEHYDVARGVQKILQDYKSLQDII-------------------------------------
2d4yB           SELNKIVGVEVSVQDGGTYNLTM--------------------------------------
3cwfA           -------------------------------------------------------------
2d4yA           GVEVSVQDGGTYNLTMANGYTLVQGSTARQLAAVPSSADPTRTTVAYVDEAAGNIEI----
1e6vB           EPMYDGKRLLVQLPSERVKVMAD--------------------------------------
3c9iF           ITERRRTKAMEDALRAHG-------------------------------------------
3bt5A           RQFLRLMIRHHQGAVAMTLPMLDA-------------------------------------
3cwfB           -------------------------------------------------------------
2basB           -------------------------------------------------------------
2aswA           -------------------------------------------------------------
2basA           -------------------------------------------------------------
3bp9Y           -------------------------------------------------------------
1cnt4           -------------------------------------------------------------
3bt5A           -------------------------------------------------------------