[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO49801.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "2c13A.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "2dvyF.bssp"
#ERROR : Can't open dsspfile "2c13B.bssp"
#ERROR : Can't open dsspfile "2bu6A.bssp"
#ERROR : Can't open dsspfile "2c15A.bssp"
#ERROR : Can't open dsspfile "2bu2A.bssp"
#ERROR : Can't open dsspfile "3d2rB.bssp"
#ERROR : Can't open dsspfile "2bu7A.bssp"
#ERROR : Can't open dsspfile "1e51A.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "3d2rA.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "3dgeA.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"
#ERROR : Can't open dsspfile "1bknA.bssp"
#ERROR : Can't open dsspfile "1b62A.bssp"
#ERROR : Can't open dsspfile "2bu8A.bssp"
#ERROR : Can't open dsspfile "2btzA.bssp"
#ERROR : Can't open dsspfile "3crkA.bssp"
#ERROR : Can't open dsspfile "1bmtA.bssp"
#ERROR : Can't open dsspfile "2e0aB.bssp"
#ERROR : Can't open dsspfile "1b3qA.bssp"
#ERROR : Can't open dsspfile "1b3qB.bssp"
#ERROR : Can't open dsspfile "2e0aA.bssp"
#ERROR : Can't open dsspfile "2bu5A.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "3bjeA.bssp"
#ERROR : Can't open dsspfile "3clqB.bssp"
#ERROR : Can't open dsspfile "2c19B.bssp"
#ERROR : Can't open dsspfile "3clqA.bssp"
#ERROR : Can't open dsspfile "3clqD.bssp"
#ERROR : Can't open dsspfile "3crkB.bssp"
#ERROR : Can't open dsspfile "2dvyD.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "3crlB.bssp"
#ERROR : Can't open dsspfile "2avwB.bssp"
#ERROR : Can't open dsspfile "3bulA.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "1ah8A.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "2avwA.bssp"
#ERROR : Can't open dsspfile "3cgzA.bssp"
#ERROR : Can't open dsspfile "3c97A.bssp"
#ERROR : Can't open dsspfile "3cnbC.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "1e6mA.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "3cnbA.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "1e6lA.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "2akpB.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"
#ERROR : Can't open dsspfile "3ckeD.bssp"
#ERROR : Can't open dsspfile "3clmA.bssp"
#ERROR : Can't open dsspfile "1dcmA.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "6chyA.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"
#ERROR : Can't open dsspfile "2b4aA.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "1bqgA.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "2dvyC.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "2d00A.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "1ab6A.bssp"
#ERROR : Can't open dsspfile "1be1A.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "1aw5A.bssp"
#ERROR : Can't open dsspfile "1ea6B.bssp"
#ERROR : Can't open dsspfile "3cz5A.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "2byhA.bssp"
#ERROR : Can't open dsspfile "3ehjB.bssp"
#ERROR : Can't open dsspfile "3cgzB.bssp"
#ERROR : Can't open dsspfile "2a9qA.bssp"
#ERROR : Can't open dsspfile "3cz5C.bssp"
#ERROR : Can't open dsspfile "3b2mC.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "2crkA.bssp"
#ERROR : Can't open dsspfile "3b2mB.bssp"
#ERROR : Can't open dsspfile "3b2nA.bssp"
#ERROR : Can't open dsspfile "1ah8B.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3bmyA.bssp"
#ERROR : Can't open dsspfile "3ehgA.bssp"
#ERROR : Can't open dsspfile "3d36A.bssp"
#ERROR : Can't open dsspfile "2cgfA.bssp"
#ERROR : Can't open dsspfile "2cg9B.bssp"
#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "1ah6A.bssp"
#ERROR : Can't open dsspfile "1byqA.bssp"
#ERROR : Can't open dsspfile "2akpA.bssp"
#ERROR : Can't open dsspfile "2breA.bssp"
#ERROR : Can't open dsspfile "2dvyB.bssp"
#ERROR : Can't open dsspfile "1eh8A.bssp"
#ERROR : Can't open dsspfile "3ehhB.bssp"
#ERROR : Can't open dsspfile "3crnB.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "2chuA.bssp"
#ERROR : Can't open dsspfile "1ea6A.bssp"
#ERROR : Can't open dsspfile "3dqqB.bssp"
#ERROR : Can't open dsspfile "1e1cA.bssp"
#ERROR : Can't open dsspfile "1b1aA.bssp"
#ERROR : Can't open dsspfile "2ccsA.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "3cgzC.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "3c3mA.bssp"
#ERROR : Can't open dsspfile "1ec9D.bssp"
#ERROR : Can't open dsspfile "1ec7D.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "3ehfD.bssp"
#ERROR : Can't open dsspfile "3c11A.bssp"
#ERROR : Can't open dsspfile "2c14B.bssp"
#ERROR : Can't open dsspfile "2czdB.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "2dvpA.bssp"
#ERROR : Can't open dsspfile "3crnA.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1ec9A.bssp"
#ERROR : Can't open dsspfile "1ccwA.bssp"
#ERROR : Can't open dsspfile "1e32A.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "3c2wA.bssp"
#ERROR : Can't open dsspfile "3c0eA.bssp"
#ERROR : Can't open dsspfile "1bknB.bssp"
#ERROR : Can't open dsspfile "3b8mC.bssp"
#ERROR : Can't open dsspfile "3bnyC.bssp"
#ERROR : Can't open dsspfile "1dv7A.bssp"
#ERROR : Can't open dsspfile "3cgyB.bssp"
#ERROR : Can't open dsspfile "3cg4A.bssp"
#ERROR : Can't open dsspfile "3ckeB.bssp"
#ERROR : Can't open dsspfile "2cg9A.bssp"
#ERROR : Can't open dsspfile "2c18B.bssp"
#ERROR : Can't open dsspfile "3cwvA.bssp"
#ERROR : Can't open dsspfile "2bz5A.bssp"
#ERROR : Can't open dsspfile "3ehjA.bssp"
#ERROR : Can't open dsspfile "3cgyA.bssp"
#ERROR : Can't open dsspfile "3ehfA.bssp"
#ERROR : Can't open dsspfile "2cz5A.bssp"
#ERROR : Can't open dsspfile "1eb3A.bssp"
#ERROR : Can't open dsspfile "2c15B.bssp"
#ERROR : Can't open dsspfile "2czdA.bssp"
#ERROR : Can't open dsspfile "2a1tS.bssp"
#ERROR : Can't open dsspfile "3cgyC.bssp"
#ERROR : Can't open dsspfile "1ei1A.bssp"
#ERROR : Can't open dsspfile "2de0X.bssp"
#ERROR : Can't open dsspfile "3b8nA.bssp"
#ERROR : Can't open dsspfile "3bnxA.bssp"
#ERROR : Can't open dsspfile "3ehhA.bssp"
#ERROR : Can't open dsspfile "3bnyB.bssp"
#ERROR : Can't open dsspfile "2c16A.bssp"
#ERROR : Can't open dsspfile "3c2wB.bssp"
#ERROR : Can't open dsspfile "2cw9A.bssp"
#ERROR : Can't open dsspfile "2dvyA.bssp"
#ERROR : Can't open dsspfile "3b2mA.bssp"
#ERROR : Can't open dsspfile "1a5aA.bssp"
#ERROR : Can't open dsspfile "3c2wF.bssp"
#ERROR : Can't open dsspfile "3dzdA.bssp"
#ERROR : Can't open dsspfile "2brcA.bssp"
#ERROR : Can't open dsspfile "3e2iA.bssp"
#ERROR : Can't open dsspfile "1ec7A.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "1a2oA.bssp"
#ERROR : Can't open dsspfile "2cwoA.bssp"
#ERROR : Can't open dsspfile "1bdtA.bssp"
#ERROR : Can't open dsspfile "3c2wE.bssp"
#ERROR : Can't open dsspfile "2a1hA.bssp"
#ERROR : Can't open dsspfile "1csgA.bssp"
#ERROR : Can't open dsspfile "1cjbC.bssp"
#ERROR : Can't open dsspfile "2b18A.bssp"
#ERROR : Can't open dsspfile "1bdvB.bssp"
#ERROR : Can't open dsspfile "3bijA.bssp"

## Summary of PDB Search
:916
    2e-40  11%  1b63A  [d.122.1 - d.14.1] MUTL
    2e-39  11%  2c13A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    6e-39  13%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    9e-38  11%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    3e-37  12%  2dvyF  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    5e-36  14%  2c13B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    7e-36  13%  2bu6A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    1e-35  10%  2c15A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    1e-33  12%  2bu2A  [x.x.x] PYRUVATE DEHYDROGENSAE KINASE ISOENZYME 2
    1e-33  16%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    2e-33  12%  2bu7A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    3e-33   9%  1e51A  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-33   7%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    5e-33  15%  3d2rA  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
    5e-32   9%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    5e-32  23%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    2e-31  28%  3dgeA  [x.x.x] SENSOR PROTEIN
    4e-31  13%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    9e-31  13%  1bknA  [d.122.1 - d.14.1] MUTL
    1e-30  12%  1b62A  [d.122.1 - d.14.1] PROTEIN (MUTL)
    2e-30  16%  2bu8A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    5e-30  13%  2btzA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    9e-30  13%  3crkA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    1e-29   9%  1bmtA  [a.46.1 - c.23.6] METHIONINE SYNTHASE
    3e-29  16%  2e0aB  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    3e-29  16%  1b3qA  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    4e-29  16%  1b3qB  [a.30.2 - d.122.1 - b.40.7] PROTEIN (CHEMOTAXIS PROTEIN CHEA)
    7e-29  16%  2e0aA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    1e-28  15%  2bu5A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    7e-28  27%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    1e-27  11%  3bjeA  [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE
    2e-27  10%  3clqB  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-27  11%  2c19B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-27  11%  3clqA  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-27  11%  3clqD  [x.x.x] UNCHARACTERIZED PROTEIN
    5e-27  14%  3crkB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    2e-26  12%  2dvyD  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    3e-26  21%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    1e-25  16%  3crlB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    5e-25   6%  2avwB  [x.x.x] IGG-DEGRADING PROTEASE
    6e-25  12%  3bulA  [x.x.x] METHIONINE SYNTHASE
    7e-25  22%  3d36B  [x.x.x] SPORULATION KINASE B
    5e-24  20%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    5e-24  30%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    6e-24  16%  1ah8A  [d.122.1] HEAT SHOCK PROTEIN 90
    1e-23  34%  3dgeC  [x.x.x] RESPONSE REGULATOR
    2e-23  28%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    3e-23  30%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-23   7%  2avwA  [x.x.x] IGG-DEGRADING PROTEASE
    5e-23  21%  3cgzA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    5e-23  28%  3c97A  [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
    7e-23  25%  3cnbC  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    8e-23  31%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    9e-23  20%  1dcfA  [c.23.1] ETR1 PROTEIN
    1e-22  31%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    1e-22  30%  1e6mA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-22  30%  1chnA  [x.x.x] CHEY
    2e-22  22%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-22  26%  3cnbA  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    5e-22  22%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    5e-22  29%  1e6lA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    6e-22  34%  3dgfC  [x.x.x] RESPONSE REGULATOR
    6e-22  22%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    6e-22  28%  2cheA  [x.x.x] CHEY
    7e-22  16%  2akpB  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-21  30%  1cyeA  [x.x.x] CHEY
    1e-21  19%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    1e-21  27%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-21  10%  3ckeD  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-21  10%  3clmA  [x.x.x] TRANSALDOLASE
    2e-21  21%  1dcmA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-21  19%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    2e-21  29%  6chyA  [c.23.1] CHEY
    3e-21  30%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    3e-21  27%  1ehcA  [x.x.x] CHEY
    3e-21  17%  2b4aA  [x.x.x] BH3024
    3e-21  30%  3chyA  [c.23.1 (1a0oA)] CHEY
    4e-21  12%  1bqgA  [x.x.x] D-GLUCARATE DEHYDRATASE
    4e-21  27%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    5e-21  13%  2dvyC  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    5e-21  20%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    5e-21  30%  1ab5A  [c.23.1] CHEY
    7e-21  29%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    7e-21  17%  2d00A  [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT F
    7e-21  30%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    9e-21  30%  1ab6A  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-20   8%  1be1A  [c.23.6 (1fmfA)] GLUTAMATE MUTASE
    1e-20  28%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    2e-20  32%  2a9oA  [x.x.x] RESPONSE REGULATOR
    2e-20  10%  1aw5A  [x.x.x] 5-AMINOLEVULINATE DEHYDRATASE
    2e-20  11%  1ea6B  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    2e-20  26%  3cz5A  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-20  31%  5chyA  [x.x.x] CHEY
    3e-20  11%  2byhA  [x.x.x] HEAT SHOCK PROTEIN HSP90-ALPHA
    3e-20  15%  3ehjB  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    4e-20  18%  3cgzB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    6e-20  34%  2a9qA  [x.x.x] RESPONSE REGULATOR
    6e-20  27%  3cz5C  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    6e-20  12%  3b2mC  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN SPY0128
    8e-20  29%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    8e-20  11%  2crkA  [a.83.1 - d.128.1] PROTEIN (CREATINE KINASE)
    1e-19  11%  3b2mB  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN SPY0128
    1e-19  23%  3b2nA  [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
    2e-19  15%  1ah8B  [d.122.1] HEAT SHOCK PROTEIN 90
    2e-19  28%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    2e-19  10%  3bmyA  [x.x.x] HEAT SHOCK PROTEIN HSP 90-ALPHA
    3e-19  20%  3ehgA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    5e-19  20%  3d36A  [x.x.x] SPORULATION KINASE B
    6e-19  14%  2cgfA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    6e-19  16%  2cg9B  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    7e-19  22%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    7e-19  13%  1ah6A  [x.x.x] HEAT SHOCK PROTEIN 90
    7e-19  12%  1byqA  [d.122.1] PROTEIN (HEAT SHOCK PROTEIN 90)
    7e-19  17%  2akpA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    9e-19  13%  2breA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-18  11%  2dvyB  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    2e-18  12%  1eh8A  [c.55.7 - a.4.2] O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
    2e-18  15%  3ehhB  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    3e-18  25%  3crnB  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    3e-18  21%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    4e-18   7%  2chuA  [x.x.x] ENTEROCHELIN UPTAKE PERIPLASMIC BINDING PROTEIN
    5e-18  10%  1ea6A  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    6e-18   9%  3dqqB  [x.x.x] PUTATIVE TRNA SYNTHASE
    7e-18  13%  1e1cA  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE ALPHA CHAIN
    7e-18  10%  1b1aA  [x.x.x] GLUTAMATE MUTASE
    8e-18  12%  2ccsA  [x.x.x] HEAT SHOCK PROTEIN HSP-90 ALPHA
    9e-18  19%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    2e-17  19%  3cgzC  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    3e-17   7%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    3e-17  30%  3c3mA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    4e-17   8%  1ec9D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    4e-17  10%  1ec7D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    5e-17  22%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    6e-17  14%  3ehfD  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    6e-17  12%  3c11A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    7e-17  10%  2c14B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    7e-17  15%  2czdB  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    1e-16   7%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    1e-16  18%  2dvpA  [x.x.x] HYPOTHETICAL PROTEIN PH1917
    1e-16  27%  3crnA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    3e-16  13%  1aj6A  [x.x.x] GYRASE
    6e-16  11%  1ec9A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    7e-16   9%  1ccwA  [c.23.6] PROTEIN (GLUTAMATE MUTASE)
    7e-16   9%  1e32A  [b.52.2 - d.31.1 - c.37.1] P97
    7e-16  28%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    9e-16   9%  3c2wA  [x.x.x] BACTERIOPHYTOCHROME
    9e-16  15%  3c0eA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    9e-16  16%  1bknB  [d.122.1 - d.14.1] MUTL
    1e-15   9%  3b8mC  [x.x.x] FERRIC ENTEROBACTIN (ENTEROCHELIN) TRANSPORT
    1e-15   9%  3bnyC  [x.x.x] ARISTOLOCHENE SYNTHASE
    2e-15  13%  1dv7A  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-15  19%  3cgyB  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    3e-15  22%  3cg4A  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
    4e-15   8%  3ckeB  [x.x.x] ARISTOLOCHENE SYNTHASE
    6e-15  16%  2cg9A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-14   9%  2c18B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    1e-14  10%  3cwvA  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    2e-14  10%  2bz5A  [x.x.x] HEAT SHOCK PROTEIN HSP90-ALPHA
    3e-14  18%  3ehjA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    4e-14  18%  3cgyA  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    4e-14  13%  3ehfA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    5e-14  15%  2cz5A  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    6e-14  20%  1eb3A  [c.1.10] 5-AMINOLAEVULINIC ACID DEHYDRATASE
    7e-14   9%  2c15B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    1e-13  13%  2czdA  [x.x.x] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-13  14%  2a1tS  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    2e-13  20%  3cgyC  [x.x.x] VIRULENCE SENSOR HISTIDINE KINASE PHOQ
    2e-13  17%  1ei1A  [d.122.1 - d.14.1] DNA GYRASE B
    4e-13  10%  2de0X  [x.x.x] ALPHA-(1,6)-FUCOSYLTRANSFERASE
    4e-13   4%  3b8nA  [x.x.x] FERRIC ENTEROBACTIN (ENTEROCHELIN) TRANSPORT
    1e-12   8%  3bnxA  [x.x.x] ARISTOLOCHENE SYNTHASE
    1e-12  13%  3ehhA  [x.x.x] SENSOR KINASE (YOCF PROTEIN)
    3e-12  10%  3bnyB  [x.x.x] ARISTOLOCHENE SYNTHASE
    5e-12  12%  2c16A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-11   8%  3c2wB  [x.x.x] BACTERIOPHYTOCHROME
    1e-10   7%  2cw9A  [x.x.x] TRANSLOCASE OF INNER MITOCHONDRIAL MEMBRANE
    3e-10  14%  2dvyA  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    5e-10  11%  3b2mA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN SPY0128
    6e-10   9%  1a5aA  [c.1.2] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    2e-09   7%  3c2wF  [x.x.x] BACTERIOPHYTOCHROME
    6e-09  22%  3dzdA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    2e-08  16%  2brcA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    3e-07  19%  3e2iA  [x.x.x] THYMIDINE KINASE
    3e-07  12%  1ec7A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    5e-06  24%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    6e-06  23%  1a2oA  [c.23.1 - c.40.1] CHEB METHYLESTERASE
    3e-05   6%  2cwoA  [x.x.x] RNA SILENCING SUPPRESSOR
    4e-05  18%  1bdtA  [a.43.1] PROTEIN (GENE-REGULATING PROTEIN ARC)
    7e-05   8%  3c2wE  [x.x.x] BACTERIOPHYTOCHROME
    1e-04  11%  2a1hA  [x.x.x] BRANCHED CHAIN AMINOTRANSFERASE
    2e-04  11%  1csgA  [a.26.1] GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR
    3e-04  21%  1cjbC  [c.61.1] PROTEIN (HYPOXANTHINE-GUANINE
    3e-04  11%  2b18A  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    3e-04  14%  1bdvB  [a.43.1] PROTEIN (ARC FV10 REPRESSOR)
    4e-04  11%  3bijA  [x.x.x] UNCHARACTERIZED PROTEIN GSU0716
:916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKSK
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           ------------------------------------------------------------------LLQK
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VAEIMTLFQGVLDVKTFAQLLITRIPPIVGGCYGVFYVSVTEGEEQRLIKMASYASGGQDVGTSSFRPGE
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           TRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVV-----SRRGKLLGYSINQQIENDRMKKMDRQFPE
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLVGQCLLENKVIYLTNIPNQYIHITSGLGTAPAKCITVLPVEFEGKVVAVIELASxxxxxxxxxxxxxx
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2e0aB           ----------------------------------------------------------------------
1b3qA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2e0aA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3clqA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
3bulA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           EYTKNLFNVPETSSNLDINSEYTAFPVERDLFQAGLTTIVPIIGGGERLGTLILSR--------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKTFNEKLENQYKESEQKTIELQKA
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           -----------------------------------------------------------------QSLLD
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------------------------------------------------------------
3d2rB           -----------------------------------------------------------------WYIQS
2bu7A           ----------------------------------------------------------LVQSWYVQSLLD
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           ----------------------------------------------------------------------
3crlA           -----------------------------------------------------------------QSLLD
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           ----------------------------------------------------------------VLEYKD
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
2e0aB           -----------------------------------------------------------------WYIQS
1b3qA           ----------------------------------------------------------------------
1b3qB           ----------------------------------------------------------------------
2e0aA           -----------------------------------------------------------------WYIQS
2bu5A           ----------------------------------------------------------------------
2c2aA           --------------------------------------------------------------ENVTESKE
3bjeA           ----------------------------------------------------------------------
3clqB           ----------------------------------------------------------GAVQGALVFEGL
2c19B           ----------------------------------------------------------------------
3clqA           -----------------------------------------------------------------LVFEG
3clqD           ------------------------------------------------------------------VFEG
3crkB           -----------------------------------------------------------------DIMEF
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ---------------------------------------------------------------VWTKGVT
3bulA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           -----------------------------------------------------------------GVTPP
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           -------------------------------------------------------------ADEILEPVF
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           -----------------------------------------------------------------ERERL
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           -----------------------------------------------LWES-MRAHDREMADEILEPVFL
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------IPVEYIIYDLWESMRA---HDREM
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------DREMAD
3ehhA           ----------------------------------------------------------------------
3bnyB           -----------------------------------------------LWES-MRAHDREMADEILEPVFL
2c16A           ----------------------------------------------------------------------
3c2wB           ---------------------------------------------------------RLEQGRIAELLRV
2cw9A           ----------------------------------------------------------KVTDLLGGLFSK
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           -------------------------------------------------------------------GRI
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------NETVEV
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KTALEEQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGNLSPKQVEYAETXXXXXXXXX
1b63A           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
2dvyF           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
2bu6A           IMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYTYGDDPVSNQNIQYFLDRFYLSRISIR
2c15A           ----------------------------------------------------------------------
2bu2A           ----------------QFTDALVTIRNRHNDVVPTMAQGVLEYKDTDDPVSNQNIQYFLDRFYLSRISIR
3d2rB           LMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAEYKACTVDPVTNQNLQYFLDRFYMNRISTR
2bu7A           IMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDGDDPVSNQNIQYFLDRFYLSRISIR
1e51A           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3d2rA           ---------------KALSDFVDTLIKVRNRHHNVVPTMAQGYKDACDPVTNQNLQYFLDRFYMNRISTR
1e51B           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
3dgeA           -------------IDRMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLE
3crlA           IMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTDDPVSNQNIQYFLDRFYLSRISIR
1bknA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2bu8A           TYGDDP-------VSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST----NPAHPKHIGSIDPNCNVS
2btzA           -----------------------TIRNRHNDVVPTMAQGVLEYKDGDDPVSNQNIQYFLDRFYLSRISIR
3crkA           ---FLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTDDPVSNQNIQYFLDRFYLSRISIR
1bmtA           ----------------------------------------------------------------------
2e0aB           LMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDPVTNQNLQYFLDRFYMNRISTR
1b3qA           -------------------------SQTVRVDIEKLDNLMDL-----MGELVIARSRILETLKKYNIKEL
1b3qB           -------------------------SQTVRVDIEKLDNLMDL-----MGELVIARSRILETLKKYNIKEL
2e0aA           LMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDPVTNQNLQYFLDRFYMNRISTR
2bu5A           -----DKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTDDPVSNQNIQYFLDRFYLSRISIR
2c2aA           LERLKRID-------RMKTEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQSNHLE
3bjeA           ----------------------------------------------------------------------
3clqB           AKDLADADRVARSG-----AITFSPCHEHDAVGSAGVYVHIIKNETYGNTAFTNLSEQLAKVLRFGANDQ
2c19B           ----------------------------------------------------------------------
3clqA           LAKDLADADRVAR----SGAITFSPCHEHDAVGSAGVYVHIIKNETYGNTAFTNLSEQLAKVLRFGANDQ
3clqD           LAKDLADADRVA----RSGAITFSPCHEHDAVGSAGVTSPNYVHIIKNNTAFTNLSEQLAKVLRFGANDQ
3crkB           LDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTY--GDDPVSNQNIQYFLDRFYLSRISIR
2dvyD           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           PPANFTQGEDVFHAPYVQGWYDITKTFNGKDDLLAGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINF
3bulA           ----------------------------------------------------------------------
3d36B           ----------PHMVIRAEKHLAASISHEIRNPLTAARGFIQLIEEQPLAA--DKRRQYARIAIEELDRAE
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           ANFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLAGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINF
3cgzA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           LFMRAQ-------TDRTRRPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHL
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------------------------------------
3ehjB           EEKLEDANERIAELVKLEERQRARDLVDTLGQKLSLGLKSDLARKLIY-KDPEQAARELKS---------
3cgzB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2crkA           -----------TVGCVAGDEESYTVFKDLFDPIIQDKPTDKHKTDLNHENLKGGDDLDPHYVLSSRVRTG
3b2mB           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ---------------HMVIRLAASISHEIRNPLTA--ARGFIQLIEEQPLAADKRRQYARIAIEELDRAE
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           ----------------------------------------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------IAELVKLEERQRARDLVDTLGQKLSLGLKSDLARKLIY-----KDPEQAARELKSVQQT-
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           ---------------EERQRIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQT------
3c11A           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
2czdB           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           ------------------FGALAHPDDGIAALIPCDGALVMLG---GRTLSIRGDFER-QAGNVLQRLQR
3c0eA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
3bnyC           FMRAQTDRTRARPMG--LGGYLEY--RERDVGKELLAALMRFS---MGLKLSPSELQRVREIDANCSKHL
1dv7A           ----------------------------------------------------------------------
3cgyB           ----------------------------------------------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ADEILEPVLFMRAQTDRTRARPMGLGGEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHL
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           --------------------IARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSV---------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ---------------KDHEILRRRIENGAKELWFFLQSELKKL-KNLEGN--ELQRHADEFLLDLGHHER
3b8nA           ----------------------------------------------------------------------
3bnxA           EILEPVFLFMRAQTDRTRARPMGLGGYLYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHL
3ehhA           ---------RIAELVKLEERQRARDLVDTLGQKLSLGLKSDLARKLIYKD-PEQAARELKSVQQT-----
3bnyB           --FMRAQTDR---TRARPMGLGGYLEYRERDGKELLAALMRFSMGLK---LSPSELQRVREIDANCSKHL
2c16A           ----------------------------------------------------------------------
3c2wB           STERRLALARRARDADDLFGALAHPDDGIAALIPCDGALVMLGGRTLSI-RGDFERQAGNV---LQRLQR
2cw9A           TESEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAISGELDILK--DWCYEATYSQLAHPIQQAKALGL
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           AELLRVSTRRLALARRARDGALAHPDDGIAALIPCDGALVMLGGRTLSRGDFERQAGNVLQRLQRDPERD
3dzdA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ---------ASFNHLLVTVEHREWMEQRIGEMLKEIRAFLKVRVVTPMHKETASDTLNAFLEEYCRITGL
1bdtA           ----------------------------------------------------------------------
3c2wE           -------------------GALAHPDDGIAALIPCDGALVMLG----GRTLSIRGDFERQAGNVLQRLQR
2a1hA           ----------------------------------------------------------------------
1csgA           ISEMFDLQEPTCLRLELYKQGLRGSLTKLKGPLTMMASHYKQH---CPPTPETSCATQIIT---------
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXAKIEAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQI
1b63A           ------------------------------------------HMPIQVLPPQLANQI-AAGEVVERPASV
2c13A           ----------------------------------------------------GVNQRESIPSMPGVERLS
2ch4B           ---------------------HMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEP
2ch4A           --------------------SHMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEP
2dvyF           ----------------------------------------------------------------------
2c13B           -----------------LVRENVLTVDDLIL-------PVF--------VLDGVNQRESIPSMPGVERLS
2bu6A           MLINQHTLIFDKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPQEINAANSKQPIHMVYVPSHLYHM
2c15A           -----------------LVRENVLTVDDLILPVVNQRESIPSMPGV-ERLSIDQLLIEAEEWVALGIPAL
2bu2A           MLINQHTLIFDPIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHM
3d2rB           MLMNQHILIFSDSQTGNPSHIGSIDPNCDSRMLCDQYYLSSPELKLTQVNGKFPDQPIHIVYVPSHLHHM
2bu7A           MLINQHTLIFDSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHM
1e51A           ---------RAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLE-EMLRPLVEEGLRCV
3c2eA           ----------------------------------------------------------------------
3d2rA           MLMNQHILIFSDSHISIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKNGKFPDQPIHIVYVPSHLHHM
1e51B           -------------------------------------------------MQPQSVLHSGYFHPLLRAWQT
2ayxA           ----------------------------------------------------------------------
3dgeA           NLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQV
3crlA           MLINQHTLIFDGSTNPCSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVYVPSHLYHM
1bknA           -----------------------------------------------------------------RPASV
1b62A           ------------------------------------------HMPIQVLPPQLANQI-AAGEVVERPASV
2bu8A           EVVKDAYDMAKLLCDKYYMASPDLEIQEIN--------------------AANSKQPIHMVYVPSHLYHM
2btzA           MLINQHTLIFDKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPQEINAANSKQPIHMVYVPSHLYHM
3crkA           MLINQHTLIFDPKHIGSSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVYVPSHLYHM
1bmtA           ----------------------------------------------------------------------
2e0aB           MLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFECSPELKLTQVNGKFPDQPIHIVYVPSHLHHM
1b3qA           DESLSHLSRITLDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEP
1b3qB           DESLSHLSRITLDLQNVVMKIRMVPISFVFNRFPRMVRDLAKKMNKEVNFIMRGEDTELDRTFVEEIGEP
2e0aA           MLMNQHILIFSDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLKLTQVNGKFPDQPIHIVYVPSHLHHM
2bu5A           MLINQHTLIFDKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAAPIHMVYVPSHLYHM
2c2aA           NLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQV
3bjeA           ---------------------------------------PIGKDGTTLHLKCKDELADRFVGDPGRVDVI
3clqB           SVVDRLIWRDVLGPLDATFCPEGIDLRLLSQALHGDECHNRNVA-GSTLLVQALTPYVQTDFSREQLKEV
2c19B           ----------------------------------------VDDLILPVFVLDGVNQRESIPSMPGVERLS
3clqA           SVVDRLIWRDVLGLHDATFCPEGIDLRLLSQALHGDECHNRNVAG-STLLVQALTPYVQTDFSREQLKEV
3clqD           SVVDRLIWRDVLGLHDATFCPEGIDLRLLSQALHGDECHNRNVAG-STLLVQALTPYVQTDFSREQLKEV
3crkB           MLINQHTLIFDHICSVSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNATQ---PIHMVYVPSHLYHM
2dvyD           ----------------------------------------------------------------------
1bxdA           ------------------MPMEMADLNAVLGEVIAAESGYEREI----ETALYPGSI-EVKMHPLSIKRA
3crlB           ------------------VSDVVKDAYDMAKLLCDKYYMASPDLEIQEVNATNATQPIHMVYVPSHLYHM
2avwB           NGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAF---------PYLSTKHLGVFPDHVIDMFINGYRLSLTN
3bulA           ----------------------------------------------------------------------
3d36B           AIITDYLTFAKPA----PETPEKLNVKLEIERVIDILRPLANMSCVDIQATLA---PFSVIGEREKFRQC
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           ------------------------------------------SETFEFQAEITQLMSLIINTVYSNKEIF
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           NGEQMFDV-KEAIDTKNHQLDSKLFEYFKEKAFPYLSTKHLGVF--------PDHVIDMFINGYRLSLTN
3cgzA           ------------------LSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEIS--FVGEQNDFVEV
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           --------------------------------------------------------------ASDALDKI
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           SVVNDIYSYEKELYLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLAEGLETPGLAAYVEG
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           -------------------------------------------------------------QVVLSLSTA
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           ----------------------------------------EEVETFAFQAEIAQLMSLIINTFYSNKEIF
3ehjB           -----VQQTARTSLNEV----RKIVSSKGIRLKDELINIKQILEAADIFIYEEEKWPENISLLNENILSC
3cgzB           ---------------------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEIS--FVGEQNDFVEV
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ----------VVNGAKLTVT-KNLDL----------VNSNALIPNTDFTFKIEPDT--TVNEDGNKFKGV
1dc8A           ----------------------------------------------------------------------
2crkA           RSIKGYTLPPHCS------RGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQ-QLIDDHFLFDKP
3b2mB           ------------------VNGAKLTVTKNL----DLVNSNALIPNTDFTFKIEPDT--TVNEDGNKFKGV
3b2nA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------SETF--EFQAEITQLMSLIINTVYSNKEIF
3breB           ----------------------------------------------------------------------
3bmyA           ----------------------------------QPMEEEVETF--AFQAEIAQLMSLIINTFYSNKEIF
3ehgA           -----------------------IRLKDEL----INIKQILEAADIMFIYEEEKWPENISLLNENILSMC
3d36A           AIITDYLTFAKPAPETPEKLNVKLEIERVIDILRPLANMSCVDIQAT-------LAPFSVIGEREKFRQC
2cgfA           ------------------------------------------SETFEFQAEITQLMSLIINTVYSNKEIF
2cg9B           ------------------------------------------SETFEFQAEITQLMSLIINTVYSNKEIF
3c3wB           ----------------------------------------------------------------------
1ah6A           ------------------------------------------SETFEFQAEITQLMSLIINTVYSNKEIF
1byqA           ----------------------------------------EEVETFAFQAEIAQLMSLIINTFYSNKEIF
2akpA           --------------------------------------------------------------ASDALDKI
2breA           ------------------------------------------SETFEFQAEITQLMSLIINTVYSNKEIF
2dvyB           ----------------------------------------------------------------------
1eh8A           ---------------------AVLGGPEPLMQCTAWLNAYFHQPEAIEEFP-----VPALHHPVFQQESF
3ehhB           ---------ARTSLNEV--RKIVSSKGIRLKDELINIKQILEAA--DIFIYEEEKWPENISLLNENILSC
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
1ea6A           -------------------------------------------------------------QVVLSLSTA
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------VETF--AFQAEIAQLMSLIINTFYSNKEIF
3cg0B           ----------------------------------------------------------------------
3cgzC           ---------------------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEIS--FVGEQNDFVEV
3bh1A           ---------RVLPGFPDNKIAMLDRIKDEVEILVCINAKDLERHKIRADLGISYEEDVLVDVFRDRGFLV
3c3mA           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3ehfD           -----------ARTSLNEVRKIVSSKGIRLKDELINIKQILEAADIFIYEEWPENISL----LNENILSC
3c11A           -----------------------------------------ASETFEFQAEITQLMSLIINTVYSNKEIF
2c14B           -----------------LVRENVLTVDDLILPV-----FVLDGVNQRESIPSMPGVERLSIDQLLIEAEE
2czdB           ----------------------------------------------------------------------
3bh1D           ---------RVLPGFPDNKIAMLDRIKDEVEILVCINAKDLERHKIRADLGISYEEDVLVDVFRDRGFLV
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           -------------------------------------------KGLDAVRKRPGMYI-GDTDDGTGLHHM
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           DPERDIYHTDNWCCGVLAIRFHRQESGWIFWFRHEEVHRIRWGG--------KPEKLLTIGPSGPRLTP-
3c0eA           ------------------------------------------SETFEFQAEITQLMSLIINTVYSNKEIF
1bknB           -----------------------------------------------------------------RPASV
3b8mC           ----------------------------------------------------------------------
3bnyC           SVVNDIYSYEKELYTLCTSVQILAQEADVTAAAKRVLFVMCREWELRHQLLVA-RLSAEGTPGLAAYVEG
1dv7A           ----------------------------------------------------------------------
3cgyB           ---------------------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEIS--FVGEQNDFVEV
3cg4A           ----------------------------------------------------------------------
3ckeB           SVVNDIYSYEKSILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEG
2cg9A           ------------------------------------------SETFEFQAEITQLMSLIINTVYSNKEIF
2c18B           ----------------------------------------------------------------------
3cwvA           -------------------------------------------------VRKRPGMY-CGDVGEYGLHHL
2bz5A           ----------------------------------------VETFAFQAEIAQLMSLI--INTFYSNKEIF
3ehjA           ----------------------KIVSSKGIRLKDELINIKQILEAADIFIYEEEKWPENISLLNENILSC
3cgyA           ------------------LSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEIS--FVGEQNDFVEV
3ehfA           --------QQTARTSLNEVRKIVSSKGIRLKDELINIKQILEAA--DIFIYEEEKWPENISLLNENILSC
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           ---------------------ELHPVAPLLDNLISALNKVYQRKGVNISMDISPEIS--FVGEQNDFVEV
1ei1A           -----------------------------------DSSSIKVLKGLDAVRKRPGMYI-GDTDDGTGLHHM
2de0X           SIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCF
3b8nA           ----------------------------------------------------------------------
3bnxA           SVVNDIYSYEKCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLV---ARLSAEGLETPGLAAYVEG
3ehhA           -----------ARTSLNEVRKIVSSKGIRLKDELINIKQILEAA--DIFIYEEEKWPENISLLNENILSC
3bnyB           SVVNDIYSYEKELYTQILAQEADVTAEAAKRVLFVMCREWELRHQL---LVARLSAEGLETPGLAAYVEG
2c16A           ----------------------------------------------------------------------
3c2wB           DPERDIYHTDNWCCGVLAIRFHRQESGWIFWFRHEEVTIGPSGPRLSFEAWEEVVRGHSTPWSETAIAEK
2cw9A           QFHSRILDIDNVDL----------------AGKVEQGPVLIITFQAQLVVV-RNPKGEVVEGDPDKVLRL
2dvyA           ----------------------------------------------------------------------
3b2mA           ------------SATTVHGETVVNGAKLTVTKNLDLVNSNALIPNTDFTFKIEPDT--TVNEDGNKFKGV
1a5aA           ----------------------------------------------------------------------
3c2wF           IYHTDNWDCCGVLAIRFHRQESGWIFWFRHEEVLPSGPRLTPRGSFEAWEEVVRGHSTPWSETDLAIAEK
3dzdA           ----------------------------------------------------------------------
2brcA           --------------------SETFEFQAEITQLMSLIINTVY-------SNKEIFLRELISNASDALDKI
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           AREDALREKMRKVKSVVLFHHSELLKFEVTENMFSYTELLKLNLSLRVISSQI-----------------
1bdtA           ----------------------------------------------------------------------
3c2wE           DPERDIYHTDNWCCGVLAIRFHRQESGWIF----------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGG
1b63A           VKELVENSLDAGATRIDIDIERGG--------AKLIRIRDNGCGIKKDELALALARHATSDLEAIISLGF
2c13A           IDQLLIEAEEWVALGIPALALFPVTPVEKKSLD--AAEAYNPEGIAQRATRALRERFPELGI--------
2ch4B           LLHLLRNAIDHGIEPKEERIAKGKPSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDQEILNFLFV
2ch4A           LLHLLRNAIDHGIEPKEERIAKGKPPIGKAIEKGLIDESKAATLSDQEILNFLFVPGFSTKEKVSEVSG-
2dvyF           ------ASVSFENGKVVRLPITR------PTSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYYIERDGK
2c13B           IDQLLIEAEEWVALGIPALALFPVTPVEKK--SLDAAEAYNPEGIAQRATRALRERFPELGIITDVALGQ
2bu6A           LFELFKNAMRATVESHESSLILPPIKVMLGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTA---------
2c15A           ALFPVTPVEKKSLDAAEAYNPEG--IAQRATRALRERFPELGIITDVALDPFTTHGQDGIDDDGYVLNDV
2bu2A           LFELFKNAMRATVESHESSLI-----LPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTLAG
3d2rB           LFELFKNAMRATVEHQENQPSLTPIEVILGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPPL--AG
2bu7A           LFELFKNAMRATVESHESSLILPPIKVMLGEEDLSIKMSDRGGGVPLRKIERLFSYMY---------STA
1e51A           LIFGVPSRVPKDERGS---AADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSGAFRAEE
3c2eA           -----------------------------------WLSEDVPSFDF----GGYVVGSDLKEANLYCKQDG
3d2rA           LFELFKNAMRATVEHQENQPSLTPIEVILGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTAPLA--G
1e51B           ATTTLNASNLIYPIFVTDVPDDIQPARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDADSEESPAIA
2ayxA           ---MGGSGVEGLSGKRCWLAVRNA----SLCQFLETSLQRSGIVVTTEGQEPTPEDVLITDEVVSKKWQG
3dgeA           LLNLLNNGVKYSKKDAP--DKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPG
3crlA           LFELFKNAMRATVESHESSLTLPPIKIMLGEEDLSIKMSDRGGGVPLRKIERLFSYMYS-----TAPLAG
1bknA           VKELVENSLDAGATRIDIDIERGGA--------KLIRIRDNGCGIKKDELALALAIASLDDLEAIISLGF
1b62A           VKELVENSLDAGATRIDIDIERGG--------AKLIRIRDNGCGIKKDELALALARHATDDLEAIISLGF
2bu8A           LFELFKNAMRATVESHESSLIPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYS------TPLAG
2btzA           LFELFKNAMRATVESSSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP--------
3crkA           LFELFKNAMRATVESHESSLTLPPIKIALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP--------
1bmtA           -----------------------------------------AEWRSWEVNKRLEYSLVKGITEFIEQDTE
2e0aB           LFELFKNAMRATVEHQENQPSLTPIEVIVVKEDLTIKISDRGGGVPLRIIDRLFSYTYS-----TAPLAG
1b3qA           LLHLLRNAIDHGIEPKEERIAKGKPSARHEGNNVVIEVEDDGRGIDKEKIIRKAIEKGLIDESKAFVPGF
1b3qB           LLHLLRNAIDHGIEPKEERIAKGKPPIGHEGNNVVIEVEDDGRGIDQEILNFLFVPGFSTKE-KVSEVSG
2e0aA           LFELFKNAMRATVEHQENQPSLTPIEVILGKEDLTIKISDRGGGVPLRIIDRLFSYTYSTAPTPNAPLAG
2bu5A           LFELFKNAMRATVESHESSLILPPIKVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAP--------
2c2aA           LLNLLNNGVKYSKKDAP--DKYVKVILDEKDGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDTG-------
3bjeA           SGYFDKDSIRASRDHR-EIRFATGTYKGTPVTVISTGMGVDNIEIVLNEIHALKEYDMERGQWRHRKGDA
3clqB           FEFLGSSDYFSGPTW--GAAKCALDAGHNVENSTIVTTCRNGVEFGIRVSGIGGNHWFTGPAQRVIG---
2c19B           IDQLLIEAEEWVALGLALFPVTPVEKKSLDAAEAQRATRALRERFPELGIITDVALDPFTTHGQDGILDD
3clqA           FEFLGSSDYFSGPTW--GAAKCALDAGHNVENSTIVTTCRNGVEFGIRVSGIGGNHWFTGPAQRVIG---
3clqD           FEFLGSSDYFSGPTW--GAAKCALDAGHNVENSTIVTTCRNGVEFGIRVSGIGGNHWFTGPAQRVIG---
3crkB           LFELFKNAMRATVESHELTLPPIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYS---------TA
2dvyD           ------ASVSFENGK-IVVRL----PITRPTSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYYIARDGK
1bxdA           VANMVVNAARYGNGWIKV-------SSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGD--SARTISG
3crlB           LFELFKNAMRATVESHELTLPPIKIMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYS-----TAPLAG
2avwB           HGPTPVKEGSKDPRGGI-FDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELEGKALGLSHTYANVRI
3bulA           ---------------------------------------------AEWRSWEVNKRLEYSLVKGITEFIE
3d36B           LLNVMKNAIEAMPNGGTLQV-----YVSIDNGRVLIRIADTGVGMTKEQLERLGEPYFTTKGV-----KG
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           LRELISNASDALDKIRYKSLSDPKIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAK----SGTKAFM
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           HGPTPVKEGSKDPRGGIFDAVFT-RGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKLGLSHTYANVRI
3cgzA           MGNVLDNACKYCLEFV-------------------------EISARQTDDHLHIFVEDDGPGIPHTLRPG
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           RYKSLSDPKQLETEPDLFIRITP------KPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALS
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           LEYQMSGNELWSQTT-------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           MIHLTSVEASVSFENGK---IVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSD------------E
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           VKELVENSLDAGATNIDLKLKDYG--------VDLIEVSDNGCGVEEENFEGLTLEALSSLCALSDTIST
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           LRELISNSSDALDKIRYESLTDPSKLDSGKKQDRTLTIVDTGIGMTKADLINNLGTIAKSG----TKAFM
3ehjB           LKEAVTNVVKHSQAKTCRVDIQQ------LWKEVVITVSDDGTFKGEE---------------------N
3cgzB           MGNVLDNACKYCLEFVEI---------------------SARQTDDHLHIFVEDDGPGIPHSKRSTLRPG
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           ALNTPMTKVTYTNSDKG--GSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVLWN
1dc8A           ----------------------------------------------------------------------
2crkA           VSPLLLASGMARDWPDARGIWHND----NKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFC-VGLQKIEE
3b2mB           ALNTPMTKVTYTNSDKG--GSNTKTAEFDFSEVTFEKPGVYYYKVTEEKIDKVPGVSYDTTSYTVQVLWN
3b2nA           ----------------------------------------------------------------------
1ah8B           LRELISNASDALDKIRYKSLSDPKQLITPKPEQKVLEIRDSGIGMTKAELINNLGTIAK----SGTKAFM
3breB           ----------------------------------------------------------------------
3bmyA           LRELISNSSDALDKIRYESLTDPSKLLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ
3ehgA           LKEAVTNVVKHSQAKTCRVDIQQ------LWKEVVITVSDDGTFKGEENSFSKG----------------
3d36A           LLNVMKNAIEAMPNGGTLQVY-----VSIDNGRVLIRIADTGVGMTKEQLERLGEPY-----FTTKGVKG
2cgfA           LRELISNASDALDKIRYKSLSDPKQRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAK----SGTKAFM
2cg9B           LRELISNASDALDKIRYKSLSDPKQLITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSG----TKAFM
3c3wB           ----------------------------------------------------------------------
1ah6A           LRELISNASDALDKIRYKSLSDPKQLITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALS
1byqA           LRELISNSSDALDKIRYETLTDPSKNLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSG---TKAFME
2akpA           RYKSLSDPKQLETEPDLFIRITP------KPEQKVLEIRDSGIGMTKAELINNLGTIAKSG----TKAFM
2breA           LRELISNASDALDKIRLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSG----TKAFM
2dvyB           ----VEASVSFENGIVVRLPITR------PTSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYYIEWQIS
1eh8A           TRQVLWKLLKVVKFGEVISYQQLAA-------LAGNPKAARAVGGAMRGNPVPILIPHRVVCSS-GAVGN
3ehhB           LKEAVTNVVKHSQAKTCRVDIQQLWKE------VVITVSDDGTFKGEENSHGLL----------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           ---------------KIPKNPSKVVILDLGILDTFDALNDKVVGVPAKNLPKYLQQFKNKPSVGGVQQVD
1ea6A           VKELVENSLDAGATNIDLKL--------KDYGVDLIEVSDNGCGVEEENFEGLTLEALSSLCALSVTIST
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           LRELISNSSDALDKIRYETLTDPSKLLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSG---TKAFME
3cg0B           ----------------------------------------------------------------------
3cgzC           MGNVLDNACKYCLEFVE-------ISARQTDDHLHIFVEDDGPGIPHTLRPGQGVGLAV-----------
3bh1A           EHVVLTQLENDNRLALAFIERLQRLGI-------KVSRHRVIPGYPTDMDRIVSDEGFGLNEYAETTRDV
3c3mA           ----------------------------------------------------------------------
1ec9D           ---------------------------------TLEDAIPLVVGKTLGEYKNVLTLVRNTFADRDAGGRG
1ec7D           ---------------------------------IRKTLEDAIPLVVGKTLGEYKNVLTLVRNTFADRRTT
3c3wA           ----------------------------------------------------------------------
3ehfD           LKEAVTNVVKHSQAKTCRVDIQQ------LWKEVVITVSDDGTFKGEH----------------------
3c11A           LRELISNASDALDKIRYKSLSDPKQRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAAAGTKAFM----
2c14B           WVALGIPALALFPVTPVEKKSLDAAEAYNPEGIAQRATRALRERFPELGIITDVALDPFTTHGQDGILDD
2czdB           ----------------------------------------------------------------------
3bh1D           EHVVLTQLENDNRLAL-------AFIERLQRLGIKVSRHRVIPGYPTDMDRIVSDEGFGLNEYAETTRTA
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           VFEVVDNAIDEALAGHCKEIIVTIHA------DNSVSVQDDGRGIPTGIVSAAEVIMTVLHAGGKFSGGL
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3c2wA           --RGSFEAWEEVVRGHS-----------------------------------------------------
3c0eA           LRELISNASDALDKIRYKSLSDPKIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAA---AGTKAFME
1bknB           VKELVENSLDAGATRIDIDI--------ERGGAKLIRIRDNGCGIKKDELALAL-----AEAIISLGFRG
3b8mC           ----------------------------------------------------------------------
3bnyC           LEYQMSGNELWSQTT-------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           MGNVLDNACKYCLEFVEISARQT---------------------------------DDHLHIFVEDDGPG
3cg4A           ----------------------------------------------------------------------
3ckeB           LEYQMSGNELWSQTT-------------------------------------------------------
2cg9A           LRELISNASDALDKIRYKSLSDPKIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSG----TKAFM
2c18B           -----------------------------------AAEAYNPEGIAQRATRALRERFP----ELGIITDV
3cwvA           VYFLLDVAYEEARRGECRDVVLEVGG------DGSIALFCTSRTVTAENLVRVATGAGFLGRPPGDGWGW
2bz5A           LRELISNSSDALDKIKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAK---SGTKAFME
3ehjA           LKEAVTNVVKHSQAKTCRVDIQQ------LWKEVVITVSDDGTFKGEE---------------------N
3cgyA           MGNVLDNACKYCLEFVEISARQT---------------------------------DDHLHIFVEDDGPG
3ehfA           LKEAVTNVVKHSQAKTCRVDIQQ------LWKEVVITVSDDGTFKGEHGLL-GRERLEFANGSLHID-TE
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3cgyC           MGNVLDNACKYCLEFVEISARQTDDHL-------HIFVEDDGPGIPGLAVAREITEQYAGIIASDSLLGG
1ei1A           VFEVVDNAIDEALAGHCKEIIVT------IHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGK
2de0X           MIAYGTQRTLILESQ-------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           LEYQMSGNELWSQTT-------------------------------------------------------
3ehhA           LKEAVTNVVKHSQAKTCRVDIQQL------WKEVVIT--------------------------VSDDGTF
3bnyB           LEYQMSGNELWSQTT-------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           LRLDLMELCL------------------------------------------------------------
2cw9A           YVWALCRDQDELNPY-------------------------------------------------------
2dvyA           MIHLTSVEASVSFENGK---IVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSD------------E
3b2mA           ALNTPMTKVTYTNSDKGGSNTKTA--EFDFSEVTFEKPGVYYYKVTEEKIDKVPGYDTTSYTVQVHVLWN
1a5aA           ----------------------------------------------------------------------
3c2wF           LRLDLMELCL------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           RYKSLSDPKQLETEPDLFIR------ITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSG----TKAFM
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ---------KGMSKPQFNLRWPR-----EVLDLVRKVAEENGRSVNSEIYQRVMESF-----KKEGRIG-
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------EVLDLVRKVAEENGRSVNSEIYQRVMESF-------------
3bijA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           TGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIPTYDVETEFIEPARTEVAPGDDNSPIERDEIGKTE
1b63A           RGEALASISSVSRLTGRDMNVTVKPAAHPVGTTLEVLD-------------------LFYNTPARRKFLR
2c13A           -ITDVALDPFTTHGQDGILDDDGYVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREA----L
2ch4B           PGFSMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTL-------------------------------
2ch4A           RGVGMDVVKNVVESLNGSISIESEKDKGTKVTIRLPLTLAIIQALLVKVNNLVYAIPIANI---------
2dvyF           YDYELSRMVRLAHEHGILTYNDIYELLKFADDVKSYLEDKGIRRESTNEELYGFNIYEDVYPV-------
2c13B           DGILDDDGYVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHTNVRV---------
2bu6A           PGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLK--------ALSTDSVERLPVYNKS----------
2c15A           SIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREA---------------------------------L
2bu2A           FGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLK--------ALSTDSVERLPVYNKS----------
3d2rB           FGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAF----------------
2bu7A           PGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLK--------ALSTDSVERLPVYNKS----------
1e51A           SRQRLAEVALAYAKAGCQV----------------VAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAK
3c2eA           MLCGVPFAQEVFNQCELQVE-----------------WLFKEGSFLEPSKNDSGKIVVAKITGPAKNILL
3d2rA           FGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLK------------ALSSESIEKLPV----------
1e51B           IHLLRKTFPNLLVACDVCLCPYAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNR
2ayxA           RAVVTFCRRH---------------------------IGIPLEKAPGEWVHSVAAPHELPALLARIYLIE
3dgeA           TGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP----------------------------------
3crlA           FGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLK--------ALSTDSVERLPVYNKSAW--------
1bknA           RGEALASISSVSRLTLTSRTAEQQEAWQAYAVTVKPAAHPVGTTLEVLDTEKTEFNHIDEIIRRIA----
1b62A           RGEALASISSVSRLTGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALA
2bu8A           FGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAW----------------
2btzA           -GYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLK--------ALSTDSVERLPVYNKS----------
3crkA           -GYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLK--------ALSTDSVERLPVYNKS----------
1bmtA           EARQQATRPIE----------------------VIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQA
2e0aB           FGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAF----------------
1b3qA           SGVGMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP-------LTLAIICALLVKVNNLVYAIPIANIDT
1b3qB           RGVGMDVVKNVVESLNGSMGIESEKDKGTKVTIRLP---LTLAIICALLVKVNNLVYAIPIANI------
2e0aA           FGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAF----------------
2bu5A           -GYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLK-------ALSTDSVERLPVYNKSA----------
2c2aA           --LGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP----------------------------------
3bjeA           DAPSAGPFFDPSIRLGTCGSPAESVPPLALAVTRHAIGMDNTSLYYSAGTRETSKDQ-------------
3clqB           PFAGYTQEDAGLDGDSAITETYGVGGFAAAAPAIVPLVGGTVAEALNYELEITTKENPN-----------
2c19B           DGYVLNDVSIDV------LVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHTNVRV---------
3clqA           PFAGYTQEDAGLDGDSAITETYGVGGFAAAAPAIVPLVGGTVAEALNYELEITTKENPN-----------
3clqD           PFAGYTQEDAGLDGDSAITETYGVGGFAAAAPAIVPGGTVAEALNYSKELEITTKENPN-----------
3crkB           PGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAW----------------
2dvyD           YDYELSRMVRLAHEHGILTYNDIYELLKFADDVKSYLEDKGIRRESTNEELYGFNIYEDVYPVAKKELPS
1bxdA           TGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQ---------------------------
3crlB           FGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAW----------------
2avwB           NHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVG-------------------------------
3bulA           QDTEEARQQATRPLMDGMNVVGDLFGEGKMFLPQVVK-------------------------SARVMKQA
3d36B           TGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP----------------------------------
1dbwA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
1ah8A           EALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWE---------SNAGGSFTVTLDEVNER
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2avwA           NHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNS---AGKVAISAKEIKEDNIGA-------
3cgzA           QGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFG----------------------------------
3c97A           ----------------------------------------------------------------------
3cnbC           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
2akpB           AGA---DVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGR-------
1cyeA           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
3ckeD           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
2dvyC           NLRDYYIEWQISYARDGMVRLAHEHGILTYN-----DIYELLKFADDVKSYLED-----KGIRRESTNEE
1dbwB           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
1ab6A           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
1ea6B           CHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFS-------------------TLPVRHKEFQR
3cz5A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
2byhA           EALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTK----
3ehjB           SFHGL-LGRERLEFANGSLHIDTENGTKLTA---------------------------------------
3cgzB           QGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFG----------------------------------
2a9qA           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
3b2mC           EEQQKPVATYIVGYKEGSKVPIQFKNSLDSTTLTV-KKKVSGTGGDRS-KDFNFGLTLKANQYYKASEKV
1dc8A           ----------------------------------------------------------------------
2crkA           IFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSK---HPKFEEILT----------------
3b2mB           EEQQKPVATYIVGYKEGSKVPIQFKNSLDSTTLTVKKKVSGTGGDR--SKDFNFGLTLKANQYYKASEKV
3b2nA           ----------------------------------------------------------------------
1ah8B           EALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWE--------SNAGGSFTVTLDEVNER-
3breB           ----------------------------------------------------------------------
3bmyA           AGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDE-----------------------------------
3ehgA           --HGLLGMRERLEFANGSLHIDT--ENGTKLTMAIP----------------------------------
3d36A           TGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP----------------------------------
2cgfA           EALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVT----------------
2cg9B           EALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDEQYIWESNAGGSFTVTLDEVNERIGRGTI----
3c3wB           ----------------------------------------------------------------------
1ah6A           AGADVSMIGQFGVGFYSLFLVAD----RVQVISKSNDDEQYIWESNAGGSFTVTLD---------EVNER
1byqA           ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDE--------------------------------
2akpA           EALSAGADVSIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTI----
2breA           EALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVT-----LDEVNERIGRG
2dvyB           ------YARDGKYDYELSRMVRLAHEHGILTYNDIYELLKFADDVKSYLEDKGIRRESTNEELYGFNIYE
1eh8A           YSGGLAVKEWLLAHEGH-----------------------------------------------------
3ehhB           -------GRERLEFANGSLHIDTENGTKLTA---------------------------------------
3crnB           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2chuA           FEAINALKPDLIISGRQSKFYDKLKEIAPTLFVGLDNANFLSSFENNVLSVAKLYG--------LEKEAL
1ea6A           CHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQV-------
3dqqB           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2ccsA           ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRT----------------
3cg0B           ----------------------------------------------------------------------
3cgzC           -------AREITEQYAGQIIASDSLLGGARMEVVFG----------------------------------
3bh1A           TAPGPGTCLSQVYHEHKRGVAAGYAKFETFPIWNLPLEHPVNLAYEAATVDLNDANVIDHFHLAAYGEQT
3c3mA           ----------------------------------------------------------------------
1ec9D           LQTFDLRTTIHV-VTGIEAAMLDLLGQHLGVNVAFFVGNRKATPLPYQSQPDDSCDWYRLRHEEAMTPDA
1ec7D           IHVVTGIEAAMLDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKQSQPDDSCDWYRLRHEEAMTP
3c3wA           ----------------------------------------------------------------------
3ehfD           -GL---LGRERLEFANGSLHIDTENGTKLTA---------------------------------------
3c11A           EALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLD--------------
2c14B           DGYVLNDVS----IDVLVRQALSHAEAGAQVVAPSDMMDGR-----------------IGAIREALESAG
2czdB           ----------------------------------------------------------------------
3bh1D           PGPGSGKCLSQVYHEHKRGVAAGYAKFETFPIWNLPLEHPVNL---------------------------
2dvpA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
1aj6A           HGVGVSVVN----ALSQKLELVIQHEGKIHRQIYEHGVPQAPLAVTG------ETEKTGTMVRFWPSLET
1ec9A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
1e32A           ------------------------------------------------IVDEAINEDNSVVSQPKMDELQ
3breA           ----------------------------------------------------------------------
3c2wA           ----------------------------------------------------------------------
3c0eA           ALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTL----------------
1bknB           EALATAEQQEAWQAYMNVTVKPAAHPVGTTLEVLDLLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGK
3b8mC           ----------------------------------------------------------------------
3bnyC           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
3cgyB           IPHGLAVAREITEQYAGQIIASDSLLGGARMEVVFG----------------------------------
3cg4A           ----------------------------------------------------------------------
3ckeB           ----------------------------------------------------------------------
2cg9A           EALSAGADVSMIGQFGVGFYSLFLVADRVQV---------------------------------------
2c18B           ALDPFTTHGQDGILDGYVLNDVSIDVLVRQALSHAEAGAQVVAPSDMMDGRIGAIREALESAGHT-----
3cwvA           DSMLVVSLALSS--RYQVDIWADGRQWRVMGEHGHPGEGAAVTPMEPMPVSAERGVRVHFVPDATIFEVL
2bz5A           ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTK-----
3ehjA           SFHGLLG-RERLEFANGSLHIDTENGTKLT----------------------------------------
3cgyA           IPVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQHPTQK---------------------------
3ehfA           NGTKLTAIP-------------------------------------------------------------
2cz5A           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2czdA           ----------------------------------------------------------------------
2a1tS           -------------------------------------------------------DYAVKIRVKPDRTGV
3cgyC           ARMEVVFGRQ------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
3bnxA           ----------------------------------------------------------------------
3ehhA           KGHGL-LGRERLEFANGSLHIDTENGTKLTA---------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ----------------------------------------------------------------------
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           NLRDYYIEWQISYARDGKYDYELSR---------------------------------------------
3b2mA           EEQQKPVAT-------------------------------------------------------------
1a5aA           ----------------------------------------------------------------------
3c2wF           ----------------------------------------------------------------------
3dzdA           ----------------------------------------------------------------------
2brcA           EALSAGADVSMIGQFGVGFYSLFLVADRVQV--------ISKSNDDEQYIWESNAGGSFTVTLDEVNER-
3e2iA           ----------------------------------------------------------------------
1ec7A           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           ----------------------------------------------------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EWSGDKVSLSQIYSQGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL
1b63A           TEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAI---EW
2c13A           ESAGHTNVRVMAYSAYASAY-----YGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAAD---LAE
2ch4B           -AIIQALLVKVNNLVYAIPIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHEELEEME
2ch4A           -----------------------DTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIHKEELEEME
2dvyF           -----------------------AKKELPSGEFIGIVLKVGYQSMVYVCIPLTNVEPSLAGRVARRNKYE
2c13B           ----------MAYS-------AYASAYYGPFRDAV--GSASGNKATYQMDPANSDEALHEVAAD----LA
2bu6A           ------------------AWRHYQTIQEAGD---------------------------------------
2c15A           ESAGHTNVRVMAYSA--KYASAY--YGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAAD---LAE
2bu2A           ------------------AWRHYQTIQEAGD---------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ------------------AWRHYQTIQEAGD---------------------------------------
1e51A           FASCF-----------------------YGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDV-REG
3c2eA           AERTALNILSRSSGIATASHKIISLARSTGYKGTIAGTRKTTPGLRRLEKYSMLVGGCDTHRYDLS-SMV
3d2rA           -------------------FNKSAFKHYDDW---------------------------------------
1e51B           VS------------------------VMSYSAKFASCFYGPFRDARCYQLPPGARGLALR-AVDRDVREG
2ayxA           MESDDPANALPSTDKAVSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNH-IDI
3dgeA           ----------------------------------------------------------------------
3crlA           -------------------RHYQTIQEAGDWCVP------------------------------------
1bknA           -----------------LARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEW-QH
1b62A           RF-------------------DVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQ-H
2bu8A           ----------------------------------------------------------------------
2btzA           ------------------AWRHYQTIQEAGD---------------------------------------
3crkA           -----------------AWRHYQTIQEAGDWCVP------------------------------------
1bmtA           VAYLEPFIEASKEQGKTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILAKEVNADL
2e0aB           ----------------------------------------------------------------------
1b3qA           ILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVDDLLGQDDI
1b3qB           ----------------------DTILSISKEDIQR-VQDRDVIVIRGEVIPVYRLWEVLQIVRVGNRKYG
2e0aA           ----------------------------------------------------------------------
2bu5A           -------------------WRHYQTIQEAGD---------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           --------------------QEIRRIVREQTGLRAIDIYTSMAHPNITKSICAACDAHNAATGSEA-DKQ
3clqB           ---------VTIPVLDFGIPTGIDVLKVLETGLPVIN-TAIAHKEPGIGIGAGLTNPP------------
2c19B           ----------MAYSAYASAY--YGP--------FRDAVGSAGNKATYQMDPANSDEALHEVAADLA--EG
3clqA           ---------VTIPVLDFGIPTGIDVLKVLETGLPVIN-TAIAHKEPGIGIGAGLTNPP------------
3clqD           ---------VTIPVLDFGIPTGIDVLKVLETGLPVIN-TAIAHKEPGIGIGAGLTNPP------------
3crkB           -------------------RHYQTIQEAGDWCVPSTEPKNTS----------------------------
2dvyD           GEFIGIVLKHKQRAVGSMVYVCIPLTNVEPSLAGRVARRNEVVKYEVPVDLMKELLKAFIIASETH-KND
1bxdA           ----------------------------------------------------------------------
3crlB           -------------------RHYQTIQEAGDWCVPSTEPKNTS----------------------------
2avwB           ----------------------------------------------------------------------
3bulA           VAYLEPFIEASKEQCKTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILREVNADLI
3d36B           ----------------------------------------------------------------------
1dbwA           -------------------MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVR-NGV
1dc7A           -------------------MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKT-PDV
1ah8A           IGRGTILRL----------FLKDDQLEYLEEKRIKEVIKRHSE-------FVA------------YPIQL
3dgeC           -----------------------KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFT-PDL
1b00A           ---------------------ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPW-PDL
1d4zA           --------------------KELKFLVVDDFSTMRRIVRNLLKELFNNVEEAEDGVDALNKLQAGG-YGF
2avwA           -----------------------QVLGLFTLSTG------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           -----------------------SVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNRQ-FDV
3cnbC           ----------------------FSILIIEDDKEFADMLTQFLENLFAKIKIAYNPFDAGDLLHTVK-PDV
2a9rA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQ--PD
1dcfA           -------------------FTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEH--KV
3cwoX           -------------------------------------------KRVLIVDDATNGREAVEKYKELK-PDI
1e6mA           ------------------SDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEAEDGVDALNKL-QAGGYGF
1chnA           --------------------KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGG-YGF
1d5wA           -------------------MQDYTVHIVDDEEPVRKSLAFMLTMNGF-AVKMHQSAEAFLAFAPDV-RNG
3cnbA           ----------------------FSILIIEDDKEFADMLTQFLENLFAKIKIAYNPFDAGDLLHTVK-PDV
3cfyA           -----------------------RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSK-PQL
1e6lA           --------------------KELKFLVVDAFSTMRRIVRNLLKLGFNNVEEAEDGVDALN-KLQAGGYGF
3dgfC           -----------------------KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFT-PDL
1d5wB           -------------------MQDYTVHIVDDEEPVRKSLAFMLTMNGFAV-KMHQSAEAFLAFAPDV-RNG
2cheA           --------------------KELKFLVVDDFSTMRRIVRNLLKELGFNNVEAEDGVDALNKLQAGG-FGF
2akpB           -------------GTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPI---------------------
1cyeA           -----------------RSDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEAEDGVDALNKL-QAGGYGF
3cu5A           -----------------------RILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIALKHPPNV
1c4wA           --------------------KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGF
3ckeD           ----------------------------------------------------------------------
3clmA           -------AVADVRAACDVCLAEHESTGGKTGFVS------LEVSPELAKDAQGTVEEARRLHAAI---AR
1dcmA           ----------------------YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLA-FAPDVRNGV
3cu5B           -----------------------RILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQLKHPPNV
6chyA           --------------------KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALN-KLQAGGYGF
1e6kA           ------------------SDKELKFLVVADFSTMRRIVRNLLKELGFNVEEAEDGVDALN-KLQAGGYGF
1ehcA           --------------------KELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGF
2b4aA           --------------------QPFRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQLSTCDL
3chyA           --------------------KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGG-YGF
1bqgA           ----------------KDFKLKGGVLRGEDEIAAVTALSERFPDARLDPNGAWSLKEAVALCRDQH-HVL
3cz5B           ----------------------ARIMLVDDHPIVREGYRRLIERRPAVVAEAADAGEAYRLYRETT-PDI
2dvyC           L-------------YGFNIYEDVYPVAKKELPSGEF-IGIVLKHGYQSMVYVCIPLTNVELAGRVARNEV
1dbwB           -------------------MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVR-NGV
1ab5A           -----------------------KFLVVDDNSTMRRITRNLLKELGFNVEEAEDGVDALNKLQAGG-YGF
1dz3A           -----------------------KVCIADDNRELVSLLDEYISSQPDMIGTAYNGQDCLQMLEEKR-PDI
2d00A           ----------------------VRMAVIADPETAQGFRLAGLEG--YGASSAEEAQSLLETLVERGGYAL
1djmA           ------------------ADKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGG-YGF
1ab6A           -----------------------KFLVVDDNSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGG-YGF
1be1A           -----------------------GVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFAIETKADLI
2ayzA           ------------------DNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNH-IDI
2a9oA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAL-EQFEAEQPDI
1aw5A           ---------------------GAHCVAPSDIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPSEG
1ea6B           NIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENQKQLQSLIPFVQLPP-SDS
3cz5A           ----------------------ARIMLVDDHPIVREGYRRLIERRPGYAVVAADAGEAYRLYRETT-PDI
5chyA           --------------------KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKL-QAGGYGF
2byhA           ----------------VILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEK---------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           -----------------------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-----
3cz5C           ----------------------ARIMLVDDHPIVREGYRRLIERRPAVVAEAADAGEAYRLYRETT-PDI
3b2mC           MIEKTTKGGQAPV-QTEASIDQLYHFTLKDGE--SIKVTNLPVGVDYVVTEDDYKSEK------------
1dc8A           -------------------MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKT--PD
2crkA           --------------RLRLQKRGTSVFDISNADRLGSSEVEQVQL--------------------------
3b2mB           MIEKTTKGGQA-PVQTEASIDQLYHFTLKDGE--SIKVTNLPVGVDYVVTEDDYKSEK------------
3b2nA           -----------------------SLIIAEDQNMLRQAMVQLIKLHGDFLADTDNGLDAMK-LIEEYNPNV
1ah8B           -------------------------------IGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEAYPIQL
3breB           --------------------GAVMVLLVDDQAMIGEAVRRSLASEGIDFHFCSDPQQAVAVANQIKPTV-
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------LRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPI---------------------
3c3wB           -----------------------KVFLVDDHEVVRRGLVDLLGADLDVVGEAGSVAEA---MARVPAADV
1ah6A           IGRGTILRL----------FLKDDQLEYLEEKRIKEVIKRHSEFVAYPILVVTKEVE-------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------LRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLV------------------
2breA           TILRLF--------------LKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVTK---------------
2dvyB           DVYPVAKKELPSGEFIGIVLKHVGYQSMVYVC-------------------IPLTNVEPSLAGRVARNEV
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ----------------------KRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEF-FNL
3cg0A           -----------------------GVLIVEDGRLAAATLRIQLESLGYDVGVFDNGEEAVRCAPDLR-PDI
2chuA           EKISDIKNEIEKAKSIVDEDKKALIILTNSNKISAFGPQSRFGILGINAVDENIKGKSINSEILEKNPDY
1ea6A           ------------LHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENQKQLQSLIPFVQLPP-SDS
3dqqB           -----------------------KIGVIADDFTGATDIASFLVENGMPTVQINDVPTGTQPEGCDA-VVI
1e1cA           -----------------------RILLADGHDRGQKVIATAYADLGFDVDVGPLFQTPEETQAVEADVHV
1b1aA           -----------------------GVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKETKADAI
2ccsA           -------------DTGEPMGRGTKVILHLKEDQTEYLEERRIKE--------------------------
3cg0B           -----------------------GVLIVEDGRLAAATLRIQLESLGYDVLGVFDNGEEAVRCAPDLRPDI
3cgzC           ----------------------------------------------------------------------
3bh1A           VN--------------------------------------------------------------------
3c3mA           ----------------------YTILVVDDS--PIVDVFVTLERGGYRPITAFSGEECLEALNATP-PDL
1ec9D           VVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARITLDPNGAWSLNEAIKIGKYLK-GSL
1ec7D           DAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARIDPNGAWSLNEAIK-IGKYLKGSL
3c3wA           -----------------------KVFLVDDHEVVRRGLVDLLGADLDVVGEAGSVAEA---MARVPAADV
3ehfD           ----------------------------------------------------------------------
3c11A           -------------EVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVT--------
2c14B           HTNVRVMAYSAYAS-------AYYGPFRDAVGSANKATYQMDPANSDEALH----------EVAADLAEG
2czdB           ----------------------------------------------VLALDVYEGERAIKIAKSVK-DYI
3bh1D           ----------------------------------------------------------------------
2dvpA           -------------------------------MKIFFITSNP-----------GKVREVANFLGTFG-IEI
3crnA           -----------------------RILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAK-IENEFFNL
1aj6A           FTNVTEFEYEIL---------AKRL------------RELSFLNSGVSIRLRDKRDGKEDHF--------
1ec9A           ----------------------------EEEAESIVALAQRFPQARLDPNGAWSLNEAIKIGKYLKGS-L
1ccwA           -----------------------GVIGSDCHAVGNKILDHAFTNAGFNVVNIGPQELFIKAAIETKADAI
1e32A           LFRGDTVLLKGKKRREAVCIVSDEKIRMNRVVRNNLRVRLGDVIS-IQPCPDVKYGKRIHVLPIDDTVE-
3breA           ---------------------AVMVLLVDDQAMIGEAVRRSLASEAIDFHFCSDPQQAVAVANQIK-PTV
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           IV-------RQYRAVPEGGQKERRLGAICGTA----FLEQALAIEWQHGDLTLRGWVADPNHTTPALAEI
3b8mC           -----------------------EIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKK-PVY
3bnyC           ----------------------------------------------------------------------
1dv7A           -------------------------------------RVDVMDVMLILAMDLMNRDDALRVTGEV-REYI
3cgyB           ----------------------------------------------------------------------
3cg4A           -----------------------GDVIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGV-
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           ----------------NVRVMAYSAKYASAYYGPFRDAVGSANKATYQMDPANSDEALHEVAAD---LAE
3cwvA           AFDRAR--LSRRCNELAALAPGLRVSFADRGERTLWHLPGGVAQ-WAHVLTEARPQLHPEPVVFDFTWDG
2bz5A           ----------------VILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEK---------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           -----------------------------------------------LALDVYEGERAIKIAKSVK-DYI
1eb3A           ---------------------------------------------------AGRGRRALE-RDMSEGADG
2c15B           -----------------------------------FRDAVGSNKATYQMDPANSDEAL---HEVAADLAE
2czdA           ----------------------------------------------VLALDVYEGERAIKIAKSVDYISM
2a1tS           VTDGCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALPAEAERLGPLQVARVLAKLAEKEK-VDL
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ----------------------LEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVY-
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           -----------------------------------------GSNKATYQMDPANSDEALHEVAAD-LAEG
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           ---------------------------AQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ-
3c2wF           ----------------------------------------------------------------------
3dzdA           -----------------------RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKELF-FPV
2brcA           IGRGTILRL----------FLKDDQLEYLEEKRIKEVIKRHSE-------FVA------------YPIQL
3e2iA           ---------------------------------------------------ASHNGNAIEAINISK-ASE
1ec7A           ----------------------------EEEAESIVALAQRFPQARITLDPNGSLNEAIKIGKYLK-GSL
1a04A           --------------------EPATILLIDDHPMLRTGVKQLISMAITVVGEASNGEQGIELAESLD-PDL
1a2oA           -------------------MSKIRVLSVDDSALMRQIMTEIINSHMEMVATAPDPLVARDLIKKFN-PDV
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ----------------------------------------------------------------------
1csgA           ----------------------------------------------------------------------
1cjbC           -----------IVSEDLSCLKGKHVLIVEDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADF
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           ------------------------------------------------------------------GFAT


                         +         .         .         .         .         *         .:910
query           VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVW
1b63A           QHGDLTLRGWVADPNHTTPALAEIQ---YCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDP
2c13A           GADMVMVPGMPYLDIVRRVKDEFRA---PTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAF-------
2ch4B           AVIVRVGNRKYGIVVDDLLGQD----DIVIKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV------
2ch4A           AVIVRVGNRKYGIVVDDLLGQDDIV----IKSLGKVFSEVKEFSGAAILGDGSIALIINVSGIV------
2dvyF           VPVDLMKELLKAFIIASETH------KNDIVKFLRSII--------------------------------
2c13B           EGADMVMVPGMPYLDIV--RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADG
2bu6A           ----------------------------------------------------------------------
2c15A           GADMVMVPGMPYLDIV---RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADG
2bu2A           ----------------------------------------------------------------------
3d2rB           ----------------------------------------------------------------------
2bu7A           ----------------------------------------------------------------------
1e51A           ADMLMVKPGMPYLDIVREV--KDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGAD
3c2eA           MLKDNHIWATGSITNAVKNARAVCG--FAVKIEVECLSEDEATEAIEAGADVIMLDNHFLLECSGGLNLL
3d2rA           ----------------------------------------------------------------------
1e51B           ADMLMVKPGMPYLDIVREVKDKHPD--LPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGAD
2ayxA           VLSDVNMPNMDGYRLTQRIRQLGLT--LPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLY
3dgeA           ----------------------------------------------------------------------
3crlA           ----------------------------------------------------------------------
1bknA           GDLTLRGWVADPNHTTPAL-----AEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDP
1b62A           GDLTLRGWVADPNHTTPALAEIQYCYVNGRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNV-
2bu8A           ----------------------------------------------------------------------
2btzA           ----------------------------------------------------------------------
3crkA           ----------------------------------------------------------------------
1bmtA           IGLSGLITPSLDEMVNVAKRQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSD
2e0aB           ----------------------------------------------------------------------
1b3qA           VIKSLGKV--------------------------------------------------------------
1b3qB           IVVDDLLGQDDI--VIKSLGKV--FSEVKEFSGA--AILGD-----------------------------
2e0aA           ----------------------------------------------------------------------
2bu5A           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3bjeA           QYVIGTTATASGFYGCQGRRVGRFM--KHLTVPNMVEELGSLKFNLSNGVEVVTNIEMETSAICYLSDML
3clqB           ----------------------------------------------------------------------
2c19B           ADMVMVKPGMPYLDI---VRRVKDEFRAPTFVYQV---SGEYAMHMGAIQNGWLAESVILESLTAFKRAG
3clqA           ----------------------------------------------------------------------
3clqD           ----------------------------------------------------------------------
3crkB           ----------------------------------------------------------------------
2dvyD           IVKFL-----------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
3crlB           ----------------------------------------------------------------------
2avwB           ----------------------------------------------------------------------
3bulA           GLSGLITPSLDEMVNVAKERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSD
3d36B           ----------------------------------------------------------------------
1dbwA           LVTDLRMPDMSGVELLRNLGDLKIN--IPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
1dc7A           LLSDIRMPGMDGLALLKQI--KQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERA
1ah8A           VVTKEVEKE-------------------------------------------------------------
3dgeC           IVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHL
1b00A           ILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAV
1d4zA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKI
2avwA           ----------------------------------------------------------------------
3cgzA           ----------------------------------------------------------------------
3c97A           IIMDIQMPVMDGLEAVSEIRNYERTHNTKRASIIAITADTIDDDRPGAELDEYVSKPLNPNQLRDVVLTC
3cnbC           VMLDLMMVGMDGFSICHRIKSTPATANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQL
2a9rA           IIILLMLPEIDGLEVA---KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
1dcfA           VFMDVCMPGVENYQIALRIHEKFTQRHQLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDL
3cwoX           VTMDITMPEMNGIDAIKEIMKI--DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVNTAAVENPSLITQIA
1e6mA           VISAWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1chnA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1d5wA           VLVTLRMPDMSGVELLRNLGDL--KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
3cnbA           VMLDLMMVGMDGFSICHRIKSTPATANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQL
3cfyA           IILDLKLPDMSGEDVLDWINQNDI--PTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALH
1e6lA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
3dgfC           IVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHL
1d5wB           VLVTLRMPDMSGVELLRNLGDLKIN--IPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
2cheA           IISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
2akpB           ----------------------------------------------------------------------
1cyeA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
3cu5A           LLTDVRMPRMDGIELVDNILKLYPDCSVIFM--------SGYSDKEYLRAIRYVEKPIDPSEIMDALKQS
1c4wA           V-ISWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
3ckeD           ----------------------------------------------------------------------
3clmA           KNAIKVPATDAGIDALETLVSD--GISVNLTLLFSRAQTLKAYAAYARGIAKRLAAGQSVAHIQVVASFF
1dcmA           LVTDLRMPDMSGVELLRNLGDLKIN--IPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
3cu5B           LLTDVRMPRMDGIELVDNILKLYPD--CSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPSEIMDALKQS
6chyA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKI
1e6kA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1ehcA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
2b4aA           LIVSDQLVDLSIFSLLDIVKEQTKQPSVLI-------LTTGRLIESSEHNLSYLQKPFAISELRAAIDYH
3chyA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1bqgA           AYAEDPCGAENGYSGREVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVA
3cz5B           VVMDLTLPGPGGIEATRHIRQWDGA--ARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAI
2dvyC           VKYEVMKELLKAFIIASETHKNDIVKFLRSI---------------------------------------
1dbwB           LVTDLRMPDMSGVELLRNLGDLKI--NIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERA
1ab5A           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1dz3A           LLLDIIMPHLDGLAVLERIRAGFEHQPNVIM-LTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQV
2d00A           VAVDEALLPDPERAVERLMRGR----DLPVLLPIAGLKEAFQGHDVEGYMRELVRKTIGFDIKL------
1djmA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1ab6A           VISDWNMPNMDGLELLKTIRADGAMSALPVLMTTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKI
1be1A           CVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEV
2ayzA           VLSDVNMPNMDGYRLTQRIRQLGLTLPVIGV--TANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLY
2a9oA           IILDLMLPEIDGLEVAKTIRKTSSVPILMLSA---KDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
1aw5A           ADGIIVKPSTFYLDIVRDASEICKD--LPICAYHVS----GEYALHAAAEKGVVDLKTIAFESHQGFLRA
1ea6B           VCEEYGLSCSDALHNLFYISGFISQ-----------CTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEV
3cz5A           VVMDLTLPGPGGIEATRHIRQWDGA--ARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAI
5chyA           VISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKI
2byhA           ----------------------------------------------------------------------
3ehjB           ----------------------------------------------------------------------
3cgzB           ----------------------------------------------------------------------
2a9qA           -QPDIIILDLDGLEVAKTIRKTSSV---PILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKAL
3cz5C           VVMDLTLPGPGGIEATRHIRQW--DGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAI
3b2mC           ----------------------------------------------------------------------
1dc8A           VLLSIRMPGMDGLALLKQIKQR--HPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERA
2crkA           ----------------------------------------------------------------------
3b2mB           ----------------------------------------------------------------------
3b2nA           VILDIEMPGMTGLEVLAEIRKK--HLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETIN--
1ah8B           VVTKEVEKEVP-----------------------------------------------------------
3breB           ILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYH
3bmyA           ----------------------------------------------------------------------
3ehgA           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
3c3wB           AVLDVRLPDGNGIELCRDLLSRMP--DLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDV
1ah6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2akpA           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
2dvyB           VKYEVPVDLMKELLKASETHKNDIVKFLRSIIGT------------------------------------
1eh8A           ----------------------------------------------------------------------
3ehhB           ----------------------------------------------------------------------
3crnB           ALFIKLPD-EGTELLEKAHKLRP-----GKKIVTGYASLENSVFSLNAGADAYI-KPVNPRDLLEKIKEK
3cg0A           ALVDIMLCGALDGVETAARLAA--GCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMA
2chuA           IFVVDRNVILGNKERAQGILDNALVAKTKAAQIYLDPEYWYLASGNGLESLKTMILEIK-----------
1ea6A           VCEEYGLSCSDALHNLFYISGFISQCTHGVGR-----------SSTDRQFFFINRRPCDPAKVCRLVNEV
3dqqB           SLKTRSCPAQEAIKQSLAALVWLKKQGCQQVYFKYCSTFDSTAEG-------------------------
1e1cA           VGVSSLAGGHLTLVPALRKELDKLGRPDILITVGGVIPEQDFDELRKDGAVEIYTPGTVIPESAISLVKK
1b1aA           LLSSLYGQGEIDCKGLRQKCDEAGLEGILLIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKD
2ccsA           ----------------------------------------------------------------------
3cg0B           ALVDIMLCGALDGVETAARLAA--GCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMA
3cgzC           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c3mA           VLLDIEPDGWETLERIKTDPATRDIPVL----LTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHV
1ec9D           AYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVA
1ec7D           AYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVA
3c3wA           AVLDVRLPDGNGIELCR--DLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDV
3ehfD           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
2c14B           ADMVMVKPGMPYLDIVRRVKDEFRAPTFV------YQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAG
2czdB           SMIKVNWPLILGSGVDIIRRLKEETGVEIIADDIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKEL
3bh1D           ----------------------------------------------------------------------
2dvpA           VQLKHEYPEIQAEKLEDVVDFGISWLKGKVFMIEDSGLFIESLKGFPGVYSSYVYRTIGLEGILKLMEGA
3crnA           ALFIKLP--DEGTELLEKAHKLR----PGKKIVTGYASLENSVFSLNAGADAYI-KPVNPRDLLEKIKEK
1aj6A           ----------------------------------------------------------------------
1ec9A           AYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVA
1ccwA           LVSSLYGQGEIDCKGLRQKCDEAGLEGILLIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKD
1e32A           GITGNLFEVYLKPYFLEAYRPI--RKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE
3breA           ILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYH
3c2wA           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1bknB           QYCYVNGRMMRDRLINHAIRQKLGADQQPAFVLYLE----------------------------------
3b8mC           DDPDFSSLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNYQLSPSL-----------
3bnyC           ----------------------------------------------------------------------
1dv7A           DTVKIGYPLVEGMDIIAEFRKRFGCRIIADVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNV
3cgyB           ----------------------------------------------------------------------
3cg4A           VLLDIPGDGWDTIRAILDNSLEQGI-----AIVLTAKNAPDAKIGLQEYVVDYITKPFDNEDLIEKTTFF
3ckeB           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
2c18B           GADMVMVPGMPYLDIV---RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADG
3cwvA           LRVQCALQWCEDEDSTL-----------------------------------------------------
2bz5A           ----------------------------------------------------------------------
3ehjA           ----------------------------------------------------------------------
3cgyA           ----------------------------------------------------------------------
3ehfA           ----------------------------------------------------------------------
2cz5A           SMIKVNWPLILGSGVDIIRRLKEETGVEIKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKEL
1eb3A           IIVK---PSTFYLDIMRDASEICK--DLPICAYHVSGEYAMLHAAAEKGVVDL--KTIAFESHQGFLRAG
2c15B           GADMVMVPGMPYLDIV---RRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADG
2czdA           IKVNWPLILGSGVDIIRRLKEETGIIADLKLADIPNTNRLIARKVFGAGADYVIVHTFVGRDSVMAVKEL
2a1tS           VLLGKQAIDDDCNQTGQMT--AGFLDWPQGTFASQVTLEGDKLKVERADGGLETLRLKLPAVVTADLRLN
3cgyC           ----------------------------------------------------------------------
1ei1A           ----------------------------------------------------------------------
2de0X           ----------------------------------------------------------------------
3b8nA           ---DPDFSISLGADGIERKLEIEKAVTDVAELNGERQYLVEQLTKANINDVNYQLSPSL-----------
3bnxA           ----------------------------------------------------------------------
3ehhA           ----------------------------------------------------------------------
3bnyB           ----------------------------------------------------------------------
2c16A           ADMVMVKPGMPYLDIVRRVK---DEFRAPTFVYQVSGEYAMHMGAIQNG---WLAESVILESLTAFKRAG
3c2wB           ----------------------------------------------------------------------
2cw9A           ----------------------------------------------------------------------
2dvyA           ----------------------------------------------------------------------
3b2mA           ----------------------------------------------------------------------
1a5aA           VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLALPLHHLIEKLKEY
3c2wF           ----------------------------------------------------------------------
3dzdA           IVLDVWPDGDGVNFID---FIKENSPDSVVIVITGHGSVDTAVKA-------------------------
2brcA           VVTK------------------------------------------------------------------
3e2iA           ITHDLTNVDVIGIDEVQFFDDEI---VSIVEKLSA-----DGHRVIVAGLDDFRGEPFEPPKLA------
1ec7A           AYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRV-
1a04A           ILLDLNMPGMNGLETLDKLREKSLSGRIVV----------------------------------------
1a2oA           LTLDVEMPRMDGLDFLEKLMRLRPM---------------------------------------------
2cwoA           ----------------------------------------------------------------------
1bdtA           ----------------------------------------------------------------------
3c2wE           ----------------------------------------------------------------------
2a1hA           ---KLGGNYGPTVLVQ---QEALKRGCEQVLWLYGPTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
1csgA           ----------------------------------------------------------------------
1cjbC           VGFSI----PDHFVVGYSLDYNEIFRDLDHCCLVNDE--GKK----------------------------
2b18A           ----------------------------------------------------------------------
1bdvB           ----------------------------------------------------------------------
3bijA           TLTKAATRAKV-IDAIGKAAKALGKGDI-FLSYSGHGGQVPDTSNDEPDGVDETWCLFDGELIDDELYAL


                         .         .         .         +         .         .         .:980
query           LYRKVN
1b63A           HQVDVN
2c13A           ------
2ch4B           ------
2ch4A           ------
2dvyF           ------
2c13B           ILTY--
2bu6A           ------
2c15A           ILTY--
2bu2A           ------
3d2rB           ------
2bu7A           ------
1e51A           IIIT--
3c2eA           CDDI--
3d2rA           ------
1e51B           IIIT--
2ayxA           AERV--
3dgeA           ------
3crlA           ------
1bknA           HQVSRL
1b62A           ------
2bu8A           ------
2btzA           ------
3crkA           ------
1bmtA           TQRD--
2e0aB           ------
1b3qA           ------
1b3qB           ------
2e0aA           ------
2bu5A           ------
2c2aA           ------
3bjeA           ------
3clqB           ------
2c19B           ADGI--
3clqA           ------
3clqD           ------
3crkB           ------
2dvyD           ------
1bxdA           ------
3crlB           ------
2avwB           ------
3bulA           ------
3d36B           ------
1dbwA           SEHLV-
1dc7A           ISHY--
1ah8A           ------
3dgeC           L-----
1b00A           MRR---
1d4zA           FEKL--
2avwA           ------
3cgzA           ------
3c97A           H-----
3cnbC           VEQ---
2a9rA           LRR---
1dcfA           LEPR--
3cwoX           Q-----
1e6mA           FEKL--
1chnA           FEKL--
1d5wA           SEHLV-
3cnbA           VEQK--
3cfyA           LKRA--
1e6lA           FEKL--
3dgfC           L-----
1d5wB           SEH---
2cheA           FEKL--
2akpB           ------
1cyeA           FEKL--
3cu5A           IQTV--
1c4wA           FEK---
3ckeD           ------
3clmA           ISR---
1dcmA           SEHLV-
3cu5B           IQTV--
6chyA           FEKL--
1e6kA           FEKL--
1ehcA           FEKL--
2b4aA           K-----
3chyA           FEKL--
1bqgA           Q-----
3cz5B           LAGR--
2dvyC           ------
1dbwB           SEHL--
1ab5A           FEKL--
1dz3A           YGK---
2d00A           ------
1djmA           FEKL--
1ab6A           FEKL--
1be1A           L-----
2ayzA           AERV--
2a9oA           LRR---
1aw5A           GARLI-
1ea6B           YHM---
3cz5A           LAGR--
5chyA           FEKL--
2byhA           ------
3ehjB           ------
3cgzB           ------
2a9qA           LRR---
3cz5C           LAGR--
3b2mC           ------
1dc8A           ISHY--
2crkA           ------
3b2mB           ------
3b2nA           ------
1ah8B           ------
3breB           SRSY--
3bmyA           ------
3ehgA           ------
3d36A           ------
2cgfA           ------
2cg9B           ------
3c3wB           GAGR--
1ah6A           ------
1byqA           ------
2akpA           ------
2breA           ------
2dvyB           ------
1eh8A           ------
3ehhB           ------
3crnB           LDEQ--
3cg0A           IHKK--
2chuA           ------
1ea6A           YHMY--
3dqqB           ------
1e1cA           LRAS--
1b1aA           LNIE--
2ccsA           ------
3cg0B           IHKK--
3cgzC           ------
3bh1A           ------
3c3mA           LARR--
1ec9D           QMCH--
1ec7D           QMCH--
3c3wA           GAGR--
3ehfD           ------
3c11A           ------
2c14B           ADG---
2czdB           GEI---
3bh1D           ------
2dvpA           EDRR--
3crnA           LDEQ--
1aj6A           ------
1ec9A           QMCH--
1ccwA           LNIE--
1e32A           D-----
3breA           SRSY--
3c2wA           ------
3c0eA           ------
1bknB           ------
3b8mC           ------
3bnyC           ------
1dv7A           AEE---
3cgyB           ------
3cg4A           GFVR--
3ckeB           ------
2cg9A           ------
2c18B           ILTY--
3cwvA           ------
2bz5A           ------
3ehjA           ------
3cgyA           ------
3ehfA           ------
2cz5A           GEII--
1eb3A           ARLI--
2c15B           ILTY--
2czdA           ------
2a1tS           EPR---
3cgyC           ------
1ei1A           ------
2de0X           ------
3b8nA           ------
3bnxA           ------
3ehhA           ------
3bnyB           ------
2c16A           ADG---
3c2wB           ------
2cw9A           ------
2dvyA           ------
3b2mA           ------
1a5aA           HAAPA-
3c2wF           ------
3dzdA           ------
2brcA           ------
3e2iA           ------
1ec7A           ------
1a04A           ------
1a2oA           ------
2cwoA           ------
1bdtA           ------
3c2wE           ------
2a1hA           ------
1csgA           ------
1cjbC           ------
2b18A           ------
1bdvB           ------
3bijA           LGK---