[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO49907.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3delB.bssp"
#ERROR : Can't open dsspfile "2a5sA.bssp"
#ERROR : Can't open dsspfile "2anjA.bssp"
#ERROR : Can't open dsspfile "3bbrA.bssp"
#ERROR : Can't open dsspfile "3bfuB.bssp"
#ERROR : Can't open dsspfile "2a5tA.bssp"
#ERROR : Can't open dsspfile "3dlnA.bssp"
#ERROR : Can't open dsspfile "2a5tB.bssp"
#ERROR : Can't open dsspfile "3b6wA.bssp"
#ERROR : Can't open dsspfile "3bfuC.bssp"
#ERROR : Can't open dsspfile "3c31A.bssp"
#ERROR : Can't open dsspfile "3b6qA.bssp"
#ERROR : Can't open dsspfile "2ceyA.bssp"
#ERROR : Can't open dsspfile "2cexB.bssp"
#ERROR : Can't open dsspfile "3e78A.bssp"
#ERROR : Can't open dsspfile "2cexA.bssp"
#ERROR : Can't open dsspfile "2de3A.bssp"
#ERROR : Can't open dsspfile "2cexC.bssp"
#ERROR : Can't open dsspfile "2cexD.bssp"
#ERROR : Can't open dsspfile "1dtzA.bssp"
#ERROR : Can't open dsspfile "3b50A.bssp"
#ERROR : Can't open dsspfile "2czlA.bssp"
#ERROR : Can't open dsspfile "1bkaA.bssp"
#ERROR : Can't open dsspfile "2dbpA.bssp"
#ERROR : Can't open dsspfile "1d4nA.bssp"
#ERROR : Can't open dsspfile "1ce2A.bssp"
#ERROR : Can't open dsspfile "2b65A.bssp"
#ERROR : Can't open dsspfile "1b1xA.bssp"
#ERROR : Can't open dsspfile "1blfA.bssp"
#ERROR : Can't open dsspfile "2b4lA.bssp"
#ERROR : Can't open dsspfile "2de3B.bssp"
#ERROR : Can't open dsspfile "2b4mA.bssp"
#ERROR : Can't open dsspfile "3chgA.bssp"
#ERROR : Can't open dsspfile "1biyA.bssp"
#ERROR : Can't open dsspfile "2de2A.bssp"
#ERROR : Can't open dsspfile "2dvzA.bssp"
#ERROR : Can't open dsspfile "3chgD.bssp"
#ERROR : Can't open dsspfile "2bjjX.bssp"
#ERROR : Can't open dsspfile "1dotA.bssp"

## Summary of PDB Search
:277
    8e-47  22%  3delB  [x.x.x] ARGININE BINDING PROTEIN
    2e-42  17%  2a5sA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    2e-39  20%  2anjA  [x.x.x] GLUTAMATE RECEPTOR 2
    3e-39  19%  3bbrA  [x.x.x] GLUTAMATE RECEPTOR 2
    4e-38  19%  3bfuB  [x.x.x] GLUTAMATE RECEPTOR 2
    8e-38  19%  2a5tA  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR1-4A SUBUNIT
    1e-37  21%  3dlnA  [x.x.x] GLUTAMATE RECEPTOR 3
    3e-37  18%  2a5tB  [x.x.x] N-METHYL-D-ASPARTATE RECEPTOR NMDAR2A SUBUNIT
    3e-36  19%  3b6wA  [x.x.x] GLUTAMATE RECEPTOR 2
    3e-36  20%  3bfuC  [x.x.x] GLUTAMATE RECEPTOR 2
    2e-34  19%  3c31A  [x.x.x] GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 1
    2e-33  21%  3b6qA  [x.x.x] GLUTAMATE RECEPTOR 2
    2e-31  11%  2ceyA  [x.x.x] PROTEIN HI0146
    3e-31  12%  2cexB  [x.x.x] PROTEIN HI0146
    4e-30   7%  3e78A  [x.x.x] HIGH AFFINITY TRANSPORT SYSTEM PROTEIN P37
    5e-30   9%  2cexA  [x.x.x] PROTEIN HI0146
    4e-29  11%  2de3A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    1e-28  11%  2cexC  [x.x.x] PROTEIN HI0146
    4e-28  12%  2cexD  [x.x.x] PROTEIN HI0146
    1e-26   6%  1dtzA  [c.94.1 - c.94.1] APO LACTOFERRIN
    4e-25  12%  3b50A  [x.x.x] SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
    2e-23   9%  2czlA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1568
    3e-22  11%  1bkaA  [x.x.x] LACTOFERRIN
    9e-21   9%  2dbpA  [x.x.x] TTHA1568
    3e-20   7%  1d4nA  [c.94.1] TRANSFERRIN
    4e-18  13%  1ce2A  [c.94.1 - c.94.1] PROTEIN (LACTOFERRIN)
    1e-17  12%  2b65A  [x.x.x] LACTOTRANSFERRIN
    2e-17   8%  1b1xA  [c.94.1 - c.94.1] LACTOFERRIN
    5e-16   9%  1blfA  [x.x.x] LACTOFERRIN
    2e-15  10%  2b4lA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    2e-14  10%  2de3B  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    3e-14  14%  2b4mA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    4e-14  15%  3chgA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    7e-14   9%  1biyA  [x.x.x] LACTOFERRIN
    1e-13  10%  2de2A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    8e-11  15%  2dvzA  [x.x.x] PUTATIVE EXPORTED PROTEIN
    2e-10  14%  3chgD  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    6e-06  13%  2bjjX  [x.x.x] LACTOTRANSFERRIN
    4e-05  14%  1dotA  [x.x.x] DUCK OVOTRANSFERRIN
:277

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPAKQTEKNTLDQIKEKGVIVAGLDDTFAPMGYRDE
3delB           -----------------------------------------------------FIVGTNATYPPFEFVDK
2a5sA           -----------------------------------------DPLETCVRNTVPCRKFVKINNSTNEGMNV
2anjA           --------------------------------------------------NKTVVVTTILESKNHEMLEG
3bbrA           ---------------------------------------------------KTVVVTTILESKNHEMLEG
3bfuB           ------------------------------------------------------------MKKNHEMLEG
2a5tA           --------------------------------------QEPFVYVKPTMSDGTCKEEFTVNGDPTGPNTV
3dlnA           -----------------------------------------------------IVVTTILESPYVMYKEG
2a5tB           -------------------------------------------TETCVRNTVPCRKFVKINNSTNEGMNV
3b6wA           -----------------------------------------------------------MMKKNHEMLEG
3bfuC           --------------------------------------------------NKTVVVTTILESKNHEMLEG
3c31A           -----------------------------------------------------------ILEEPYVMYRK
3b6qA           ------------------------------------------------------------MKKNHEMLEG
2ceyA           -------------------------------------------KEVKEKSQGKIEISLYPSSQLGDDRAM
2cexB           -------------------------------------------KEVKEKSQGKIEISLYPSSQLGDDRAM
3e78A           -----------------------------------PIQDFTVLLNNLSTDNPELDFGINASGKLVEFLKN
2cexA           -------------------------------------------KEVKEKSQGKIEISLYPSSQLGDDRAM
2de3A           ----------------------------------------------------------------LTYSN-
2cexC           -------------------------------------------EMFAKEVKEKIEISLYPSSQLGDDRAM
2cexD           -------------------------------------------KEVKEKSQGKIEISLYPSSQLGDDRAM
1dtzA           ----------------------------------------------------------------------
3b50A           ----------------------------------------------KEKSQGKIEISLYPSSQLGDDRAM
2czlA           ----------------------------------------------------------------------
1bkaA           ----------------------------------------------------------------------
2dbpA           ----------------------------------------------------------------------
1d4nA           --------------------------------------------------------------------EH
1ce2A           ----------------------------------------------------------AEEVQARRARVV
2b65A           ----------------------------------------------------------------------
1b1xA           ----------------------------------------------------------------------
1blfA           ----------------------------------------------------------------------
2b4lA           ----------------------------------------------------------------------
2de3B           ----------------------------------------------------------------------
2b4mA           ------------------------------------------------------------KGDKINLAYV
3chgA           ----------------------------------------------------------------INLAYV
1biyA           ----------------------------------------------------------------------
2de2A           ----------------------------------------------------------------------
2dvzA           ----------------------------------------------------------------------
3chgD           -------------------------------------------------------------GDKINLAYV
2bjjX           ----------------------------------------------------------------------
1dotA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQ
3delB           RGEVVGFDIDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEEIK
2a5sA           KKCCKGFCIDILKKLSRTVKFTYKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
2anjA           NERYEGYCVDLAAEIAKHCGFKYKLTTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3bbrA           NERYEGYCVDLAAEIAKHCGFKYKLTTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3bfuB           NERYEGYCVDLAAEIAKHCGFKYKLTTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2a5tA           PQCCYGFCIDLLIKLARTMNFTYEVHKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGL
3dlnA           NERYEGYCVDLAYEIAKHVRIKYKLSTKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGI
2a5tB           KKCCKGFCIDILKKLSRTVKFTYDLYNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGI
3b6wA           NERYEGYCVDLAAEIAKHCGFKYKLTTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3bfuC           NERYEGYCVDLAAEIAKHCGFKYKLTTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
3c31A           SDRFEGYCLDLLKELSNILGFLYDVKKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGI
3b6qA           NERYEGYCVDLAAEIAKHCGFKYKLTTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGI
2ceyA           LKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFFGKDLIKKMDKDLGVTLLS-QAYN
2cexB           LKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVINVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNG
3e78A           NPGIITPALETTTNSFVFDKEKDKFYVDGTDSDPLVDENHKWNGNVYQSVYDPTVQANFYRGMIWKGNDE
2cexA           LKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFFGKDLIKKMDKDLGVTLLSQAYNG
2de3A           SPVPNALLTASESGFLDAAGIELDVLSGQGTVHFTYDQPAYTRFGGEIPPLLRAPGRTRLLGITPLLGRQ
2cexC           LKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDGKDLIKKMDKDLGVTLLSQAYNG
2cexD           LKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFFGKDLIKKMDKDLGVTLLQAYNGT
1dtzA           SPAESKKCAQWQRRMKKVRGPSVTCVKKTRFECIQAISTEKADAVTLDGGLVYDAGLDYGTENQPQTHYY
3b50A           LKQLKDGSLDFTFAESARFQLFYAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNG
2czlA           --FSPPNDTFIFYALVHESPVPLEPVLEDVETLNRWALEGRLPLTKLSYAAYAQVRDRYVALRSGGALGR
1bkaA           -----EQELRKCNQWSGLSEGSVTCSSASTEDCIALVLKGEADAMSLDGGYVSSDPDPNCVDRPVEGYLA
2dbpA           -----PNDTFIFYALVHESPVPLEPVLEDVETLNRWALEGRLPLTKLSYAAYRDRYVALRSGGALGRGVG
1d4nA           EATKCQSFRDHMKSVIPSDGPSVACVKKAYLDCIRAIAANEADAVTLDAGLVYDAYEFYGSKEDPQTFYY
1ce2A           WCAVGPEEQKKCQQWSQQSGQIVTCATASTDDCIALVLKGEADALSLDGGYSSKHSSLDCVLRPTEGYLA
2b65A           ---VGPEEQKKCQQWSQQSGQNVTCATSTTDDCIVLVLKGEADALLAENRKSSKHSSLDCVLRPTEGYLA
1b1xA           ----AAKCAKFQRNMKKVRGPSVSCIRKTSFECIQAIAANKADAVTLDGGLVYEAGLVYQTRGKPQTRYY
1blfA           SQPEWFKCRRWQWRMKKLGAPSITCVRRAALECIRAIAEKKADAVTLDGGMVFEAGRIYGTKESPQTHYY
2b4lA           ----------------------------------------------------------------------
2de3B           -----ALLTASESGFLDAAGIELDVLSGQGTVHFTYDQPAYTRFGGEIPPLLRAPGRTRLLGITPLLGRQ
2b4mA           AWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAKYDDIGTSMTGVKM
3chgA           AWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAKYDDIGTSMTGVKM
1biyA           ----WLKCHRWQWRMKKLGAPSITCVRRAVLECIRAITEKKADAVTLDGGMVFEAGLIYGTKESPQTHYY
2de2A           -----ALLTASESGFLDAAGIELDVLSGQGTVHFTYDQPAYTRFGGEIPPLLRAPGRTRLLGITPLLGRQ
2dvzA           ----------------------------------------------------------------------
3chgD           AWDSEIASTNVIGKVLEDLGYEVTLTQVEAGPMWTAIATGSADASLSAWLPNTHKAKYDDIGTSMTGVKM
2bjjX           ------------NQWSGLSEGSVTCSSASTEDCIALVLKGEADAMSLDGGYVSSDPDPNCVDRPVEGYLA
1dotA           ------------DRWSVVSNGEVECILDDNKDCIVKITKGEADAISLDGGFVYTAGVCSKDEEQPAYYFA


                         +         .         .         .         .         *         .:210
query           IMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRIT
3delB           HLVLVFKGENKHPLPLTQYRSVAVQTGTYQEAYLQSLSEVH-IRSFDSTLEVLMEVMHGKSPVAVLEPSI
2a5sA           SVMVSRGTKFQRPHDYSPPFRFGTVPNGSTERNIRNNHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAV
2anjA           SIMIKKGIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3bbrA           SIMIKKGTPIESLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3bfuB           SIMIKKGTPIESLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
2a5tA           TILVKKTRITGINDPRLRNPSDKFIYATVKQSSVDTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAV
3dlnA           SIMIKKGIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVPSVFTKTTADGVARVRKSKGKFAFLLEST
2a5tB           SVMVSRGTKFQRPHDYSPPFRFGTVPNGSTERNIRYMHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAV
3b6wA           SIMIKKGTPIETLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTSAEGVARVRKSKGKYAYLLEST
3bfuC           SIMIKKGTPIESAESKQTEIAYGTLDSGSTKEFFRRSKIAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
3c31A           SILYRKGTPIDSALAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLT
3b6qA           SIMIKKGTESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVPSVFVRTAAEGVARVRKSKGKYAYLLEST
2ceyA           GTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPT---PMAFSEVYLALQTNAVDGQENPLAA
2cexB           TRQTTSNRA-INSIADMKGLKLRVPNAATNLAYAKYVGASPT---PMAFSEVYLALQTNAVDGQENPLAA
3e78A           TLAKIKKAWNDKDWNTFRNFGILHGKDNSSSFQNKFTTLNERSAHPNAYKQKSADTLGTLDDFHIAFSEE
2cexA           TRQTTSNRA-INSIADMKGLKLRVPNAATNLAYAKYVG---ASPTPMAFSEVYLALQTNAVDGQENPLAA
2de3A           GFFVRDDSP-ITAAADLAGRRIGVSASAIRILRGQLGLDPWRQTLVALGSWEARALLHTLEHGELGVDDV
2cexC           TRQTTS-NRAINSIADMKGLKLRVPNAATNLAYAKYVGASPT---PMAFSEVYLALQTNAVDGQENPLAA
2cexD           RQTTSN--RAINSIADMKGLKLRVPNAATNLAYAKYVG---ASPTPMAFSEVYLALQTNAVDGQENPLAA
1dtzA           AVAIAK-KGTNFQLNQLQGLKSCHTGLGRSAGWNIPMGLLRPTGPPEPLQKAVAKFFSASCVPCVDGKEY
3b50A           TRQTTSNRA-INSIADMKGLKLRVPNAATNLAYAKYVGASPT---PMAFSEVYLALQTNAVDGQENPLAA
2czlA           GVGPL--VVARGPLQALEGLRVAVPGRHTTAYFLLSLYAQGFVPVEVRYDRILPMVAQGEVEAGLIIHES
1bkaA           VAVVRRS-DTSLTWNSVKGKKSCHTAVDRTAMGLLFNQTGSCCAPGSDPRSNLCALCIGDEQGENKCVPN
2dbpA           PLVVA-----RGPLQALEGLRVAVPGRHTTAYFLLSLYAQGFVPVEVRYDRILPMVAQGEVEAGLIIHES
1d4nA           AVAVVK-KDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPRKPLEKAVANFFSGSCAPCADGTDF
1ce2A           VAVVKKA-NEGLTWNSLKGKKSCHTAVDRTAGWNIPMGLIANQTGGADPKSRLCALCAGDDQGLDKCVPN
2b65A           VAVVKKANE-GLTWNSLKDKKSCHTAVDRTAGMGLIVNQTGSCAPGADPKSRLCALCAGDDQGLDKCVPN
1b1xA           AVAVVKKGS-GFQLNQLQGVKSCHTGLGRSAIGTLRPYLNWTGP-PEPLQKAVANFFSASCVPCADGKQY
1blfA           AVAVVKK-GSNFQLDQLQGRKSCHTGLGRSAMGILRPYLSWTES-LEPLQGAVAKFFSASCVPCIDRQAY
2b4lA           ---------NASAAEQVNKTIIGIDPGSGIMSLTDKAYDLNDWTSAAMTATLKKSYDRKKPIIITGWTPH
2de3B           GFFVRDDS-PITAAADLAGRRIGVSASAIRILRGQLGDYLELDPWRQTLVALGSWEARALLHTLEHGELG
2b4mA           GLVVPQYMKNVNSIEDLK----------------------------------------------------
3chgA           GLVVPQYMKNVNSIEDLK----------------------------------------------------
1biyA           AVAVVKK-GSNFQLDQLQGRNSCHTGLGRSAGWNIPMGILRPYLSLEPLQGAVAKFFSASCVPCVDRQAY
2de2A           GFFVRDDS-PITAAADLAGRRIGVSASAIRILRGQLGDYLELDPWRQTLVALGSWEARALLHTLEHGELG
2dvzA           -------KDFKGFLEELKKNPGKYSYGSSGTGESFKATGTDVHVPYKGSGPAVADAVGGQIELIFDNLPS
3chgD           GLVVPQYMKNVNSIEDLK----------------------------------------------------
2bjjX           VAVVRRS-DTSLTWNSVKGKKSCHTAVDR-----------------------------------------
1dotA           VAVVKKS--SAITWNNLQGKKSCHTAVGR-----------------------------------------


                         .         .         .         +         .         .         .:280
query           ASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK
3delB           AQVVLKDFSTATIDLPEDQWVLGYGIGVASDRPALALKIEAAVQEIRKEGVLAELEQKWGLNNL---
2a5sA           LNYKAGRDCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWL-------
2anjA           MNEYIEQRKPCTMKVGGNLDSKGYGIATPK-GSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGE--
3bbrA           MNEYIEQRKPCTMKVGGNLDSKGYGIATPKGSSLGN-AVNLAVLKLSEQGLLDKLKNKWWY------
3bfuB           MNEYIEQRKPDTMKVGGNLDSKGYGIATPK-GSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGE--
2a5tA           LEFEASQKCD-LVTTGELFFRSGFGIGMRKDSPWKQ-NVSLSILKSHENGFMEDLDKTWV-------
3dlnA           MNEYIEQRKPCTMKVGGNLDSKGYGVATPKGSAL-GTPVNLAVLKLSEQGILDKLKNKWWYDK----
2a5tB           LNYKAGRDEGCLVTIGYIFATTGYGIALQK-GSPWKRQIDLALLQFVGDGEMEELETLWL-------
3b6wA           MNEYIEQRKPCTMKVGGNLDSKGYGIATPKGSSLGN-AVNLAVLKLNEQGLLDKLKNKWWYDKGE--
3bfuC           MNEYIEQRKPCTMKVGGNLDSKGYGIATPKGSSLGN-AVNLAVLKLNEQGLLDKLKNKWWYDKGE--
3c31A           TDYALLMRNCNLTQIGGLIDSKGYGVGTPI-GSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGC--
3b6qA           MNEYIEQRKPCTMKVGGNLDSKGYGIATPKGSSLGN-AVNLAVLKLNEQGLLDKLKNKWWYDKGE--
2ceyA           VQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDA-AENAAKYHTKLFVDGEKDLV
2cexB           VQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVT
3e78A           GSFAWTHANEKMEALIVTNPIPYDVGVFRKVNQLEQNLIVQTFINLAKNK--QDTYGPLLGYNGYKK
2cexA           VQAQK-FYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLV
2de3A           ELVPISSPGVDVPAEQLEEVARGQAAVLASGDVDALYSWLPWAGELQATGARPVVDLGLDERNAYAS
2cexC           VQAQKFYEVQKFLAMTNHILNDQSNETYKELPEDLQKVVKDAAENAAKYVDGEKDLVTFF-------
2cexD           VQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAK-YHTKLFVDGEKDLV
1dtzA           PNLCQLCAGTGKCACSSQEPYFGYSGAFKCLQDGAGDVAFVKDSTVFESLPAKADRDQYE-------
3b50A           VQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDA-AENAAKYHTKLFVDGE----
2czlA           RFTYPRYGLVQVVDLGAWWEERTAILARRDLGEGLIRALDEAVRRSVAEEALDYMRAHAQELSDEV-
1bkaA           SNERYYGYTGAFRCLAENAGDVAFV-----KDVTVLQNTDGNNNEAW--------------------
2dbpA           RFTYPRYGLVQVVDLGAWWEERTAILARRDLGEGLIRALDEAVRRSVAYLAHPEEALDYMRAHA---
1d4nA           PQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKESTIFENLANKADRDQYELLC-------
1ce2A           SKEKYYGYTGAFRCLAEDVGDVA--------------------------------------------
2b65A           SKEKYYGYTGAFRCLAEDVGDVA-FVKNDTVWENTNGESTADWAKNLKREDFRLLCLDGTRKPVT--
1b1xA           PNLCRLCAGTEADKCACSSQEPYFGYCLENGAGDVAFVKDSTVFENLPDEAERDKYELL--------
1blfA           PNLCQLCKGEGENQCACSSRE----------------------------------------------
2b4lA           WMFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFKWTQDEMGEIMIKVEEG----
2de3B           VDPGVDVPAEQLEESATVKGADLFPDVARGQAAVLASGWLPWAGELQATGARPVVDLGLDERNAY--
2b4mA           -------------------------------------------------------------------
3chgA           -------------------------------------------------------------------
1biyA           PN-LCQLCKGEGENQCACSPREPYSGAFKCLQDGAGDVAFVKETTVFENLPEKADRDQYE-------
2de2A           VDDVELVPISSPGDVPAEQLEESATVKGADLFPDVARGQAAVLASGDVDALYS--------------
2dvzA           SPQIQAGKLRDVPTFADAGFPVWYGLLAPKGTPDVVNKLRDAAVVALKDPKVIKALDDQGSAPS---
3chgD           -------------------------------------------------------------------
2bjjX           -------------------------------------------------------------------
1dotA           -------------------------------------------------------------------