[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO49938.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "2cfuA.bssp"
#ERROR : Can't open dsspfile "2bedA.bssp"
#ERROR : Can't open dsspfile "1dceA.bssp"
#ERROR : Can't open dsspfile "2cfzA.bssp"
#ERROR : Can't open dsspfile "3ckqA.bssp"
#ERROR : Can't open dsspfile "2cg2A.bssp"
#ERROR : Can't open dsspfile "3cv0A.bssp"
#ERROR : Can't open dsspfile "3ck7D.bssp"
#ERROR : Can't open dsspfile "3bcvA.bssp"
#ERROR : Can't open dsspfile "2d0jA.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "2ae7A.bssp"
#ERROR : Can't open dsspfile "2bo7A.bssp"
#ERROR : Can't open dsspfile "3e26A.bssp"
#ERROR : Can't open dsspfile "2d7iA.bssp"
#ERROR : Can't open dsspfile "3draA.bssp"
#ERROR : Can't open dsspfile "2c0nA.bssp"
#ERROR : Can't open dsspfile "2dm9A.bssp"
#ERROR : Can't open dsspfile "3c3oA.bssp"
#ERROR : Can't open dsspfile "3ckjA.bssp"
#ERROR : Can't open dsspfile "3e25A.bssp"
#ERROR : Can't open dsspfile "3cvlA.bssp"
#ERROR : Can't open dsspfile "3ckbB.bssp"
#ERROR : Can't open dsspfile "2bo4A.bssp"
#ERROR : Can't open dsspfile "2dl1A.bssp"
#ERROR : Can't open dsspfile "2agdA.bssp"
#ERROR : Can't open dsspfile "2d0jD.bssp"
#ERROR : Can't open dsspfile "3dstA.bssp"
#ERROR : Can't open dsspfile "3e4bA.bssp"
#ERROR : Can't open dsspfile "3e33A.bssp"
#ERROR : Can't open dsspfile "3cvqA.bssp"
#ERROR : Can't open dsspfile "2c2lA.bssp"
#ERROR : Can't open dsspfile "3cvpA.bssp"
#ERROR : Can't open dsspfile "3cvnA.bssp"
#ERROR : Can't open dsspfile "3dsuA.bssp"
#ERROR : Can't open dsspfile "3dswA.bssp"
#ERROR : Can't open dsspfile "3dsvA.bssp"
#ERROR : Can't open dsspfile "3beeB.bssp"
#ERROR : Can't open dsspfile "3beeA.bssp"
#ERROR : Can't open dsspfile "2c63A.bssp"
#ERROR : Can't open dsspfile "3ck7A.bssp"
#ERROR : Can't open dsspfile "3c72A.bssp"
#ERROR : Can't open dsspfile "2dbaA.bssp"
#ERROR : Can't open dsspfile "2b05A.bssp"
#ERROR : Can't open dsspfile "1a37A.bssp"
#ERROR : Can't open dsspfile "1a38A.bssp"
#ERROR : Can't open dsspfile "2btpA.bssp"
#ERROR : Can't open dsspfile "2e2eA.bssp"
#ERROR : Can't open dsspfile "2b05F.bssp"
#ERROR : Can't open dsspfile "3dssA.bssp"
#ERROR : Can't open dsspfile "2bugA.bssp"
#ERROR : Can't open dsspfile "3ck7B.bssp"
#ERROR : Can't open dsspfile "3ceqA.bssp"
#ERROR : Can't open dsspfile "2avpA.bssp"
#ERROR : Can't open dsspfile "2d4cD.bssp"
#ERROR : Can't open dsspfile "3edtH.bssp"
#ERROR : Can't open dsspfile "2axvA.bssp"
#ERROR : Can't open dsspfile "3dsxA.bssp"
#ERROR : Can't open dsspfile "1e96B.bssp"
#ERROR : Can't open dsspfile "2c08A.bssp"
#ERROR : Can't open dsspfile "2axuL.bssp"
#ERROR : Can't open dsspfile "3e6yB.bssp"
#ERROR : Can't open dsspfile "2crbA.bssp"
#ERROR : Can't open dsspfile "2axuE.bssp"
#ERROR : Can't open dsspfile "2e0zC.bssp"
#ERROR : Can't open dsspfile "2c23A.bssp"
#ERROR : Can't open dsspfile "3efzD.bssp"
#ERROR : Can't open dsspfile "2c0lA.bssp"
#ERROR : Can't open dsspfile "2bq0B.bssp"
#ERROR : Can't open dsspfile "2axzB.bssp"
#ERROR : Can't open dsspfile "2b05E.bssp"
#ERROR : Can't open dsspfile "2aw6B.bssp"
#ERROR : Can't open dsspfile "2bq0A.bssp"
#ERROR : Can't open dsspfile "2axuB.bssp"
#ERROR : Can't open dsspfile "3efzC.bssp"
#ERROR : Can't open dsspfile "2c1nA.bssp"
#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "2cfuA.bssp"
#ERROR : Can't open dsspfile "1dceA.bssp"
#ERROR : Can't open dsspfile "2cfzA.bssp"
#ERROR : Can't open dsspfile "2cg2A.bssp"
#ERROR : Can't open dsspfile "3cv0A.bssp"
#ERROR : Can't open dsspfile "3ck7D.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "3cvlA.bssp"
#ERROR : Can't open dsspfile "2dl1A.bssp"
#ERROR : Can't open dsspfile "2c2lA.bssp"
#ERROR : Can't open dsspfile "3cvpA.bssp"
#ERROR : Can't open dsspfile "3dswA.bssp"
#ERROR : Can't open dsspfile "3dsvA.bssp"
#ERROR : Can't open dsspfile "3beeB.bssp"
#ERROR : Can't open dsspfile "3beeA.bssp"
#ERROR : Can't open dsspfile "2c63A.bssp"
#ERROR : Can't open dsspfile "1a37A.bssp"
#ERROR : Can't open dsspfile "2e2eA.bssp"
#ERROR : Can't open dsspfile "3dssA.bssp"
#ERROR : Can't open dsspfile "2avpA.bssp"
#ERROR : Can't open dsspfile "2d4cD.bssp"
#ERROR : Can't open dsspfile "3edtH.bssp"
#ERROR : Can't open dsspfile "3dsxA.bssp"
#ERROR : Can't open dsspfile "2c08A.bssp"
#ERROR : Can't open dsspfile "2crbA.bssp"
#ERROR : Can't open dsspfile "2c0lA.bssp"
#ERROR : Can't open dsspfile "2aw6B.bssp"

## Summary of PDB Search
:640
    1e-15  11%  2cg3A  [x.x.x] SDSA1
    2e-14  10%  2cfuA  [x.x.x] SDSA1
    5e-13  10%  2bedA  [x.x.x] PROTEIN
    2e-12  11%  1dceA  [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB
    3e-12  10%  2cfzA  [x.x.x] SDSA1
    5e-12  28%  3ckqA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-12   8%  2cg2A  [x.x.x] SDSA1
    6e-12   8%  3cv0A  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    7e-12   6%  3ck7D  [x.x.x] SUSD
    9e-12  19%  3bcvA  [x.x.x] PUTATIVE GLYCOSYLTRANSFERASE PROTEIN
    2e-11   9%  2d0jA  [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
    3e-11  12%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    8e-11  10%  2ae7A  [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
    1e-10  13%  2bo7A  [x.x.x] MANNOSYLGLYCERATE SYNTHASE
    2e-10  30%  3e26A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-10  21%  2d7iA  [x.x.x] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 10
    2e-10   8%  3draA  [x.x.x] PROTEIN
    3e-10  11%  2c0nA  [x.x.x] A197
    4e-10  12%  2dm9A  [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT E
    4e-10  10%  3c3oA  [x.x.x] PROGRAMMED CELL DEATH 6-INTERACTING PROTEIN
    8e-10  36%  3ckjA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    8e-10  35%  3e25A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-09  12%  3cvlA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    4e-09   6%  3ckbB  [x.x.x] SUSD
    8e-09  14%  2bo4A  [x.x.x] MANNOSYLGLYCERATE SYNTHASE
    8e-09  15%  2dl1A  [x.x.x] SPARTIN
    9e-09   8%  2agdA  [x.x.x] BETA-1,4-GALACTOSYLTRANSFERASE 1
    1e-08   9%  2d0jD  [x.x.x] GALACTOSYLGALACTOSYLXYLOSYLPROTEIN 3-BETA-
    1e-08  14%  3dstA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    1e-08  10%  3e4bA  [x.x.x] ALGK
    1e-08   9%  3e33A  [a.118.6 (1d8dA)] PROTEIN
    1e-08  11%  3cvqA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    2e-08  20%  2c2lA  [x.x.x] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
    2e-08  12%  3cvpA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    4e-08  16%  3cvnA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR
    6e-08  12%  3dsuA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    7e-08  13%  3dswA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    1e-07  16%  3dsvA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    4e-07  15%  3beeB  [x.x.x] PUTATIVE YFRE PROTEIN
    5e-07  15%  3beeA  [x.x.x] PUTATIVE YFRE PROTEIN
    8e-07  10%  2c63A  [x.x.x] 14-3-3 PROTEIN ETA
    8e-07   6%  3ck7A  [x.x.x] SUSD
    1e-06  17%  3c72A  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    1e-06  17%  2dbaA  [x.x.x] SMOOTH MUSCLE CELL ASSOCIATED PROTEIN-1, ISOFORM
    1e-06   9%  2b05A  [x.x.x] 14-3-3 PROTEIN GAMMA
    1e-06   9%  1a37A  [a.118.7] 14-3-3 PROTEIN ZETA
    2e-06  13%  1a38A  [a.118.7] 14-3-3 PROTEIN ZETA
    2e-06  11%  2btpA  [x.x.x] 14-3-3 PROTEIN TAU
    3e-06  14%  2e2eA  [x.x.x] FORMATE-DEPENDENT NITRITE REDUCTASE COMPLEX NRFG
    6e-06  11%  2b05F  [x.x.x] 14-3-3 PROTEIN GAMMA
    6e-06  13%  3dssA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    9e-06  12%  2bugA  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    1e-05   6%  3ck7B  [x.x.x] SUSD
    1e-05  11%  3ceqA  [x.x.x] KINESIN LIGHT CHAIN 2
    2e-05  24%  2avpA  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    2e-05   8%  2d4cD  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    2e-05  14%  3edtH  [x.x.x] KINESIN LIGHT CHAIN 2
    2e-05   6%  2axvA  [x.x.x] PRGX
    2e-05  16%  3dsxA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA
    3e-05  14%  1e96B  [a.118.8] NEUTROPHIL CYTOSOL FACTOR 2 (NCF-2) TPR DOMAIN,
    3e-05  11%  2c08A  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    5e-05   7%  2axuL  [x.x.x] PRGX
    5e-05  10%  3e6yB  [x.x.x] 14-3-3-LIKE PROTEIN C
    6e-05  13%  2crbA  [x.x.x] NUCLEAR RECEPTOR BINDING FACTOR 2
    6e-05   7%  2axuE  [x.x.x] PRGX
    8e-05  10%  2e0zC  [x.x.x] VIRUS-LIKE PARTICLE
    9e-05   5%  2c23A  [x.x.x] 14-3-3 BETA/ALPHA
    1e-04  10%  3efzD  [x.x.x] 14-3-3 PROTEIN
    2e-04  12%  2c0lA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    2e-04  11%  2bq0B  [x.x.x] 14-3-3 BETA/ALPHA
    2e-04   4%  2axzB  [x.x.x] PRGX
    3e-04  11%  2b05E  [x.x.x] 14-3-3 PROTEIN GAMMA
    3e-04  10%  2aw6B  [x.x.x] PRGX
    5e-04  10%  2bq0A  [x.x.x] 14-3-3 BETA/ALPHA
    5e-04   4%  2axuB  [x.x.x] PRGX
    6e-04  10%  3efzC  [x.x.x] 14-3-3 PROTEIN
    8e-04  13%  2c1nA  [x.x.x] 14-3-3 PROTEIN ZETA/DELTA
    2e-10  17%  2cg3A  [x.x.x] SDSA1(query 558->627)
    5e-09  10%  2cfuA  [x.x.x] SDSA1(query 552->632)
    9e-05  11%  1dceA  [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB(query 558->619)
    7e-06   6%  2cfzA  [x.x.x] SDSA1(query 559->626)
    4e-09  17%  2cg2A  [x.x.x] SDSA1(query 558->627)
    1e-04  16%  3cv0A  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5(query 172->279)
    6e-05  16%  3ck7D  [x.x.x] SUSD(query 559->627)
    3e-09  16%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR(query 154->365)
    2e-04  21%  3cvlA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5(query 580->626)
    2e-05  14%  2dl1A  [x.x.x] SPARTIN(query 565->634)
    2e-05  10%  2c2lA  [x.x.x] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN(query 558->619)
    1e-04  21%  3cvpA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5(query 558->619)
    9e-06  15%  3dswA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA(query 548->627)
    3e-06   8%  3dsvA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA(query 208->295)
    1e-05  14%  3beeB  [x.x.x] PUTATIVE YFRE PROTEIN(query 250->305)
    6e-05  14%  3beeA  [x.x.x] PUTATIVE YFRE PROTEIN(query 250->305)
    8e-04  13%  2c63A  [x.x.x] 14-3-3 PROTEIN ETA(query 421->623)
    4e-06  14%  1a37A  [a.118.7] 14-3-3 PROTEIN ZETA(query 556->631)
    1e-04  10%  2e2eA  [x.x.x] FORMATE-DEPENDENT NITRITE REDUCTASE COMPLEX NRFG(query 559->627)
    4e-05  18%  3dssA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA(query 564->636)
    4e-05  34%  2avpA  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN(query 558->613)
    1e-04  11%  2d4cD  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2(query 558->627)
    3e-04  12%  3edtH  [x.x.x] KINESIN LIGHT CHAIN 2(query 434->632)
    3e-04  12%  3dsxA  [x.x.x] GERANYLGERANYL TRANSFERASE TYPE-2 SUBUNIT ALPHA(query 247->440)
    4e-04   6%  2c08A  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2(query 395->619)
    1e-04   9%  2crbA  [x.x.x] NUCLEAR RECEPTOR BINDING FACTOR 2(query 558->627)
    3e-04  14%  2c0lA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR(query 182->302)
    6e-04  10%  2aw6B  [x.x.x] PRGX(query 552->611)
:640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGNRISLCMIVKNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWNNNFSDARNFS
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
3ckqA           ---TISVVLPALDEEDTIGSVIDSISPLVDELIVLDSGSTDDTEIRAVAAGARVVSVPIRPGKGEALWRS
2cg2A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
3bcvA           LIPKVSVIVPIYNVEKYLDQCVQALTLSDIEIILIDDESPDNCPKICDDYAANIKVIHKKNAGLGACNSG
2d0jA           ---TIYAITPTYSRPVQKAELTRLANTFRQHWILVEDAAARSELVSRFLARAPRATEQRNAGLAWLRQRH
2c0mA           ----------------------------------------------------------------------
2ae7A           ---KVAIIIPFRNRQEHLKYWLYYLQQLDYGIYVINQAGDTIFN--------------RAKLLNVGFQEA
2bo7A           -----LVVFPFKHEHPEVLLHNVRVAHPRVHEVLCIGYERDQTYEAVERAAPGTLRPGKGDGMNTALRYF
3e26A           ---TISVVLPALNEEATIESVIDSISPLVDELIVLDSGSTDDTEIRAIASGARLPEVPVRPGKGEALWRS
2d7iA           ---NTSIIIPFHNEGWSSLLRTVHSPELVAEIVLVDDFSDREHLKKPLEDYMAILRTKKREGLIRTRMLG
3draA           ----------------------------------------------------------------------
2c0nA           ------------------------------TLFFIPSGSVRLPLIDFLVKNDVILSRRNHVAVQREIALD
2dm9A           --------------------IISSVVKRRLETMSEDEYFESVKALLKEAIKELVMSNEKTLGLIASRIEE
3c3oA           ----------------------------------------------------------------------
3ckjA           ---TISVVLPALDEEDTIGSVIDSISGLVDELIVLDSGSTDDTEIRAVAAGARVVSVPIRPGKGEALWRS
3e25A           ---TISVVLPALNEEATIESVIDSISPLVDELIVLDSGSTDDTEIRAIASGARLPEVPVRPGKGEALWRS
3cvlA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2bo4A           -----LVVFPFKHEHPEVLLHNVRVAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGGDGMNTALRYF
2dl1A           ----------------------------------------------------------------------
2agdA           ---KVAIIIPFRNRQEHLKYWLYYLQQLDYGIYVINQAGDTIFNRAKLLNVGF--------------QEA
2d0jD           ---TIYAITPTYSRPVQKAELTRLANTFRQHWILVEDAAARSELVSRFLARAPRATEQRNAGLAWLRQRH
3dstA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
3c72A           ----------------------------------------------------------------------
2dbaA           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
2b05F           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2bugA           ----------------------------------------------------------------------
3ck7B           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2e0zC           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2axzB           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3efzC           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYR
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2bedA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
3ckqA           LAASRGDIVVFVDSDLINPHPMFPWLVGPLLTGDGVHLVKSFYRRPLGGRVTE-----------------
2cg2A           -------------------------------------ALGWSKYINQALHRFGRQAEVMFAVHNWPRWGN
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
3bcvA           LDVATGEYVAFCDSDDYVDSDYTYNVAQKYTCDAVFTFKLYKNKNEIHTLLKDLIADPYAREERAIQVSA
2d0jA           QHQRAQPGVLFFADDDNTYSLELFQEMRTTRKVSVWPVGL------------------------------
2c0mA           ----------------------------------------------------------------------
2ae7A           LKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYW
2bo7A           LEETQWERIHFYDADITSFGPDWITKAEEAADFGYGLVRHYFPRASTDAMITWMITRTGFALLWPHTELS
3e26A           LAATSGDIVVFIDSDLIPHPLFVPWLVGPLLTGEGIQLV-------------------------------
2d7iA           ASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFR-------------------
3draA           ----------------------------------------------------------------------
2c0nA           FLEKDYDTLAFLDEDVVPIEIDFQKVEAKFNEGYDVVCG-------------------------------
2dm9A           IKSELGDVSIELGETVDTMGGVIVETEDGR--IRIDNTFEARMERFEG----------------------
3c3oA           ----------------------------------------------------------------------
3ckjA           LAASRGDIVVFVDSDLIN----------------------------------------------------
3e25A           LAATSGDIVVFIDSDLIN----------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2bo4A           LEETQWERIHFYDADITSFGPDWITKAEEAADFGYGLVRHYFPRASTDAMITWMITRTGFALLWPHTELS
2dl1A           ----------------------------------------------------------------------
2agdA           LKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPN
2d0jD           QHQRAQPGVLFFADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRR-------------------------
3dstA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
3c72A           ----------------------------------------------------------------------
2dbaA           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
2b05F           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2bugA           ----------------------------------------------------------------------
3ck7B           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2e0zC           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2axzB           -------------------------------------------------------------------TIT
2b05E           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3efzC           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHY
2cg3A           -------------------------------IGQVHNRLRLPPSLDQEWYDRGYHGSVSHNARAVLNRYL
2cfuA           -----------------------------------------PATLDPLSPEDSAGRYVEYMGGAERLLEQ
2bedA           ----------------------------------------------------------------------
1dceA           -------------------------------------------------------------------HGR
2cfzA           -------------------------------NRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQ
3ckqA           ----------------------------------------------------------------------
2cg2A           AEIVEVLEKQRDLYGYLHDQTLHLANQGVTIGQVHNRLRLPPSLDQEWYDRGYHGSVSHNARAVLNRYLG
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
3bcvA           KVVLYRRNLIEKKHLRFVSERILPSEDLIF----------------------------------------
2d0jA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2ae7A           GWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQV
2bo7A           ELLMRREVAAMLYEDERVRRRSDWGIDTLYTF--------------------------------------
3e26A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
2c0nA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3c3oA           --------------------------------------------------EQNLDNDEGLKIAAKHYQFA
3ckjA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ckbB           ----------------------------------------------------------------------
2bo4A           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2agdA           NYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLT
2d0jD           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
3e33A           ----------------------------------------------------------------------
3cvqA           ----------------------------------------------------------------------
2c2lA           -------------------------------------------------------------------KEQ
3cvpA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3dsuA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
3ck7A           ----------------------------------------------------------------------
3c72A           ----------------------------------------------------------------------
2dbaA           ----------------------------------------------------------PGASSVEQLRKE
2b05A           -------------------------DDMAAAMKNVTELNEPLSNEERNLLSVAYKNV----VGARRSSWR
1a37A           ----------------------------------------------------------------------
1a38A           -------------------------------------------------------------------VQK
2btpA           ----------------------------------------------------------ERNLLSVAYKNV
2e2eA           ----------------------------------------------------------------------
2b05F           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2bugA           ----------------------------------------------------------------------
3ck7B           ----------------------------------------------------------------------
3ceqA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------DHPDVATMLNIL
2axvA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
1e96B           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
3e6yB           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2e0zC           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2axzB           SDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNL
2b05E           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3efzC           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           -------------------------------LWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNM
3ck7D           ----------------------------------------------------------------------
2c0mA           -------------ESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGL
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           -------------------------------------------------------------------GRC
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2c0lA           -----------------------------------------LSGEYDKAVDCFTAALSVRPNDYLLWNKL
2aw6B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHY
2cg3A           GYYDGNPATL-DPLSPEDSAGRYVEYG---GAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARE
2cfuA           ARASYARGEYRWVVEVVNRLVFAEPD----NRAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVP
2bedA           ----------------------------------------------------------LSLDSPTYVLYR
1dceA           LKVKTSEEQAEAKRLEREQKLK-------LYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWN
2cfzA           ARASYARGEYRWVVEVVNRLVFAEPDNRAARRHGVPRDQGSADALAAMDTGLLFDYLGVRLDAGAAEGKA
3ckqA           ----------------------------------------------------------------------
2cg2A           YYDGNPATLDPLSPEDSAGRYVEYMG----GAERLLEQARASYARGEYRWVVEVVNRLVFAEPDNRAARE
3cv0A           ----------------------------------------------------------------------
3ck7D           ---FDQQGVFVKGYAMLGVTDEESGFYRTTF--NCNELPTDECLWAWQKNQDIPQLTSISWSPSSQRTEW
3bcvA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2ae7A           L-DVQRYPLY------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
3draA           ----------------------------------------------------------------------
2c0nA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3c3oA           SGAFLHIKETVLSALSREPTVDISPDT----VGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAAD
3ckjA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3cvlA           ------HENPMEEGLSMLKLANLAEAALAFREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHA
3ckbB           -----------------------------------------VKGYAMLGVTGDGQDEGESGFYRTTFNCN
2bo4A           ----------------------------------------------------------------------
2dl1A           --------------------------------------------GSSGSSGEPAEIKIIREAYKKAFLFV
2agdA           YQVLDV----------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
3dstA           -------------------------------QSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWN
3e4bA           ANEALKRGDTVTAQQNYQQLAELGYSEAQVGQARLGRLLAAKATEAEHHEAESLLKKAFA--NGEGNTLI
3e33A           ----------------------------------------------------------LSLDSPTYVLYR
3cvqA           ------------------------------------------------------YPFEANNPYMYHENPM
2c2lA           GNRLFVGRKYPEAAACYGRAITRNPL----VAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHF
3cvpA           DYPFEANNPYMYHEN--------------PMEEGLSMLKLA--NLAEAALAFEAV---CQAAPEREEAWR
3cvnA           ------------------------------DAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMY
3dsuA           -----------------------------LYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWN
3dswA           ------------------------------YQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWN
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------EKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYGDYYRYLA
3ck7A           ------------------------------------------------YAMLGVTDEGESGFYRTTFNCN
3c72A           ------------------------------------------------AKRL----EREQKLKLYQSATQ
2dbaA           GNELFKCGDYGGALAAY-TQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALY
2b05A           VISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYGDYYRYLA
1a37A           -----------------------------TELRDICNDVLSLLEKFLIPNAAESKVFYLKMKGDYYRYLA
1a38A           AKLAEQAERYDDMAACMKSVTEQGAE---LSNEERNLLSVAYKNVVGARRSSWRVVSSIEQEKKQQMARE
2btpA           VGGRRSAWRVISSIEQKTKKQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYGDYFRYLA
2e2eA           ---------------------------------------------------------------WQAVRAE
2b05F           -------------------------------------------------------------KGDYYRYLA
3dssA           -------EQAEAKRLEREQKLKLY-------QSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWN
2bugA           ----------------------------------------------------------ADGALKRAEELK
3ck7B           -------------------------------------------------VFVKGYAMLGVTDEGESG--F
3ceqA           ----------------------------------LNNLAVLYGKRGKYKEAEPLCKRALEIREDVAKQLS
2avpA           --------------------------------EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWY
2d4cD           -----------------------------------DFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRA
3edtH           ALVYRDQNKYKEAAHLLNDREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFH
2axvA           ------------------------------VLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYY
3dsxA           ----------------------------------------------------------------------
1e96B           --------------------------------------------------------------LVEAISLW
2c08A           GTKLDDDFKEERKVDVTSRAVEITKTIEYLQ---PNPASRAKPQAEALLAEALKFGRELGDDCNFGPALG
2axuL           ------------------------------------------------------IKNISINGYYDLEINY
3e6yB           ----------------------------------------------------------------------
2crbA           -------------------------------------------------------SSGMEGPLNLAHQQS
2axuE           ------------------------------------------------------IKNISINGYYDLEINY
2e0zC           ------------------------------------------------LDGVNKGRSLLKHLPVTRIEGQ
2c23A           ----------------------------------LVQKAKLAEQAERYDDMAAAMKAVTEQGHELSEERN
3efzD           ------------------------------------------------------RAFCIKLKGDLMRYKA
2c0lA           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2axzB           KEAQYYINQFEHLKTIKNISINGY-----YDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDI
2b05E           -----------------------------------------------------------KMKGDYYRYLA
2aw6B           ----------------------------------------------------------DLTIQTVLKNAL
2bq0A           -----------------------------------DVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLS
2axuB           ------------------------------------LTISINRNLKEAQYYINQFEHLKTIKYYDLEINY
3efzC           -------RKEKSLNNEFIQVIEDIEESILLESEDVIRIIDDNLLMYSEEGARAFCIKLKRYKAEILKDEE
2c1nA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           AVSYSNMSQYDLAAKQLVRAQVGGTTSREATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQ-
3ck7D           ----------------------------------------------------------------------
2c0mA           GVLFNLSGEYDKAVDCFTAALSVRPN----DYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRY
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ELSVEKSTVLQSELE-SCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLD
3beeB           ---------------------------------------LYYLHKQATDEVSLLLEQALQLEPYNEAALS
3beeA           ---------------------------------------LYYLHKQATDEVSLLLEQALQLEPYNEAALS
2c63A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
3dsxA           ------------------------------------CWLLSRLPEPNWARELELCARFLEADERNFHCWD
2c08A           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2c0lA           GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGI----SCINLGAHREAVEHFLEALNMQRKSRGPRG
2aw6B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD
2cg3A           LQADALEQLGYQAENAGWRNSYLSAYELRHGV------------PRDQGSADALAADTGLLFDYLGVRLD
2cfuA           RDQGSADALAAMDTGLLFDYLGVRLDAGAAEGKALSIN--LRLPDIGENYLLELKNSHLNNLRGVQSEDA
2bedA           DRAEWADIDPVPQNDGPSPVVQIIYSEKFRDV-----------YDYFRAVLQRDERSERAFKLTRDAIEL
1dceA           CRREVLQHLETEKSPEESAALVKELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEA
2cfzA           LSINLRLPDIGENYLLELKNSHLNN--LRGVQSEDAGQTVSIDRADLNRLLLKEVSAVRLVFEGKLKSSG
3ckqA           ----------------------------------------------------------------------
2cg2A           LQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDG----SADALAAMDTGLLFDYLGVRL--------
3cv0A           -------------------------------------------------------HMLQNNTDYPFEANN
3ck7D           VYVRLGYDITQYNFFLDQTEGMTDAETLRQRA---------EIRFLRALHYWYFLDLFGKAPFKEHFSND
3bcvA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
2ae7A           ----------------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
3draA           -----------------------------------------------YDYSDITPVDINTEEPQICQILY
2c0nA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3c3oA           YFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQA---------NAEYHQSILAKQQKKFGEEIARLQHAAEL
3ckjA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3cvlA           ALAVSHTNEHNAN-------------------AALASLRAWQPQYEQLFFFAAPNEYRECRTLLHAALEM
3ckbB           ELPTDECLWAWQKNQDIPQLTSISWSPSSQRT-----------EWVYVRLGYDITQYNFFLDQTEGMTDA
2bo4A           ----------------------------------------------------------------------
2dl1A           NKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKES-------EHTGPGWESARQMQQKMKETLQNVRT
2agdA           ----------------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
3dstA           CRREVLQHLETEKSPEESAALVKAELGFLES-CLRVNPKSYGTWHHRCWLLSRLPNWARELELCARFLEA
3e4bA           PLAMLYLQYPHSFPNVNAQQQISQWQAAGYPEAGLA-------QVLLYRTQGTYDQHLDDVERICKA--A
3e33A           DRAEWADIDPVPQNDGPSPVVQI---IYSEKFR--------DVYDYFRAVLQRDERSERAFKLTRDAIEL
3cvqA           EEGLSMLKLANLAEAALAFEAVCQKEPEREEA-----------WRSLGLTQAENEKDGLAIIALNHARAL
2c2lA           FLGQCQLEMESYDEAIANLQRAYSLAKEQRLN-----------FGDDIPSALRIAKKKRWNSIEERRIHQ
3cvpA           SLGLTQAENEKDGLAIIALNHARMLPKDIAVHAALASLRAWSQPQYEQFFFAAPNEYRECRTLLHAALEM
3cvnA           NMAVSYSNMSQYDLAAKQLVRAIYMQVGGEASREATR----SMWDFFRMLLNVMNRPDLVELTYAQNVEP
3dsuA           CRREVLQHLETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPWARELELCARFLEA
3dswA           CRREVLQHLETEKSPEESAALVKAELGFLESLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEA
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           EVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRL--GLALNFSVFYYEIQNAPEQACLLAKQAFDD
3ck7A           ELPTDECLWAWQKNQDIPQLTSISWSPSSQRT-----------EWVYVRLGYDITQYNFFLDQTEGMTDA
3c72A           AVFQKRQAGELDESVLELTSQILGANPDFATLWNCRR-EVLQHLETEKSPEESAALVKAELGFLESCLRV
2dbaA           RRSQALEKLGRLDQAVLDLQRCVSLPKNKVFQEALR----------------------------------
2b05A           EVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRL--GLALNYSVFYYEIQNAPEQACHLAKTAFDD
1a37A           EVAAGDDKKGIVDQSQQAYQEAFEIKIRLGLALNFS-----VFYYACSLAKTAF--DEAIADDSTLIMQL
1a38A           YREKIETELRDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEH
2btpA           EVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLG--LALNFSVFYYEILNNPELACTLAKTAFDE
2e2eA           YQRQRDPLHQFAEAQLQALQDKIRANPQNSEQ--------WALLGEYYLWQNDYSNSLLAYRQALQLRGE
2b05F           EVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRL--GLALNYSVFYYEIQNAPEQACHLAKTAFDD
3dssA           CRREVLQHLETEKSPEESAALVKAELGFLEARFLEADERNFHCWDYRRFVAQAAVAPAEELAFTDSLITR
2bugA           TQANDYFKAKDYENAIKFYSQAIELNPSNAIY-----------YGNRSLAYLRTECYGYALNDATRAIEL
3ck7B           YRTTFNCNELPTDECLWAWQKNQDIP---QLTSISWSPSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDA
3ceqA           NLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDP---NVAKTKNNLASCYLKQGKYQDAETLYKEILTR
2avpA           NLGNAYYKQGDYDEAIEYYQKALEL---------------------------------------------
2d4cD           KLSMYPQAEALLAEAMLKFGRELGDDCNFGPA-----------LGEVGEAMRELSEVKDSLDIEVKQNFI
3edtH           PDVAKQLNQGKAEEVEYYYRRALEIYATRLGPDDPNVA---KTKNNLASCYLKQGKYQDAETLYKEILTR
2axvA           LKQIYQFLTDKNIDSYLNAVNIINIFKIKEDIH--------RSLVEELTKISAKEKFTPPKEVTMYYEN-
3dsxA           ----------------------------------------------------------------------
1e96B           NEGVLAADKKDWKGALDAFSAVQDPMTEAEKAFTRSINRDKHLAFQRGMLYYQTEKYDLAIKDLKEALIQ
2c08A           EVGEARELSEVKDSLDEVKQNFIDP---------------------------------------------
2axuL           LKQIYQFLTDKNIDSYLNAVNIINIFKIIEDIH--------RSLVEELTKISAKEKFTPPKEVTMYYE--
3e6yB           ----------------------------------------------------------------------
2crbA           RRADRLLAAGKYEEAISCHRKATTYLSEAMKL------------TESEQAHLSLELQRDSHMKQLLLIQE
2axuE           LKQIYQFLTDKNIDSYLNAVNIINIFKIKEDIH--------RSLVEELTKISAKEKFTPPKEVTMYYE--
2e0zC           SFRVDIIFEDGVRVVKQEYKPIPLLKKKFYVGIRELNDGTYDVSGIKKMKLSSWDNPEEALNDLMNALQE
2c23A           LLSVAYKNVVGARRSSWRVISSIEQKKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVF
3efzD           EILKDEEKNQCIKQAVEFYEDALQRERSFLEKYPSDPLYLATILNYTILKYDLLGNPEGAMKFANRAIQA
2c0lA           ----------------------------------------------------------------------
2bq0B           ----------------------------------------------------------------------
2axzB           HRTKISAKEKFTPPKEVTYYENYV----------------------------------------------
2b05E           EVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPI--RLGLALNYSVFYYEIQNAPEQACHLAKTAFDD
2aw6B           TISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDL-----EINYLKQIYQFLTDKNIDSYLNAVNII--
2bq0A           EVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLG--LALNFSVFYYEILNSPEKACSLAKTAFDE
2axuB           LKQIYQFLTDKNIDSYLNAVNIINIFKIIEDIH--------RSLVEELTKISAKEKFTPPKEVTMYYE--
3efzC           KNQCIKQAVEFYEDALQRERSFLEKYPSDPLYLATI-------LNYTILKYDLLGNPEGAMKFANRAIQA
2c1nA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2c0mA           NLGISCINLGAHREAVEHFLEALNMRKSRGPRGEGG-----AMSENIWS------TLRLALSMLGQSDAY
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           DLRSKFLLENSVLKM-------------------------------------------------------
3beeB           LIANDHFISFRFQEAIDTWVLLLDS---------------------------------------------
3beeA           LIANDHFISFRFQEAIDTWVLLLDS---------------------------------------------
2c63A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
3dsxA           YRRFVAAQLAFTDSLITRHYRSCLLPQLHPQLVQNAFFTDPNDQSAWFYHRWLLGAGSGRCELSVEKSTV
2c08A           ----------------------------------------------------------------------
2crbA           ----------------------------------------------------------------------
2c0lA           EGGAMSENIWSTLRLALSMLGQ------------------------------------------------
2aw6B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSS
2cg3A           AG--------------------------------------------------------------------
2cfuA           GQTVSIDRADLNRLLLKEVSAVRLVFEGKLKSS-GNPLLLGQLFGML---GDFDFWFDIVTPA-------
2bedA           NAANYTVWHFRRVLLRSLQKDLQEEMNYITAIQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKN
1dceA           DERNFHCWDYRQAAVAPAEELAFTDSLIT--RNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKE
2cfzA           NPLLLGQLFGMLG------DFDFWFDIVTP----------------------------------------
3ckqA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           PYMYHENPMEEGLSMLKLANLAEAALAFEAVCQAAREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKD
3ck7D           LPVEKKGTELYTYIQNELNEIEADMYEPRQAPFGRADKAANWLSAYKLCTNYSELFMADNDENENAMQEI
3bcvA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2c0mA           -------------------------------NPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKH
2ae7A           ----------------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
3draA           DEDYKQIMGLLLALMKAEEYSERALHITELGINELASHYTIWNILKNLPNRNLYDELDWCEEIALDNEKN
2c0nA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3c3oA           IKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLPIGKATLVKSTPVNVPISQKFTDL
3ckjA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3cvlA           NPNDAQLHASLGVLYNLSNNYDSAAANLRRALRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY
3ckbB           LRQRAEIRFLRALHYWYFLDLFGKAPFKEHFSNDLPVEKK-----GTELYTYIQNELNEIEADMYEPRQA
2bo4A           ----------------------------------------------------------------------
2dl1A           RLEILEKGLATSLQNDLQEVP-------------------------------------------------
2agdA           ----------------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
3dstA           DERNFHCWDYRRFVVAPAEELAFTDSLIT--RNFSNYSSWHYRSCLLPQENVLLKELELVQNAFFTDPND
3e4bA           LNTTDICYVELATVYQKKQQPEQQAELLKQMEAGVSRSVARVLGDATLGTPDEKTAQALLEKIAPGYPAS
3e33A           NAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHLVEWLKDPSQELEFIADILNQDAKN
3cvqA           DPADIAVHAA--------------------------------LAVSHTNEHNANAALASLRALLSQPQYE
2c2lA           ESELHSYLTRLIAAERERELEECQR---------------------------------------------
3cvpA           NPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY
3cvnA           FAKEFGLQSMLL----------------------------------------------------------
3dsuA           DERNFHCWDYRRFVVAPAEELAFTDSLITRYSSWHYRSCLLPQLHPRLPENVLLKELELVQNAFFTDPND
3dswA           DERNFHCWDYRRFVVAPAEELAFTDSLIT--RNFSNYSSWHYRSCLLPQENVLLKELELVQNAFFTDPND
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           AIAELDTL--------------------------------------------------------------
3ck7A           LRQRAEIRFLRALHYWYFLDLFGKAPFKEHFSNDLPVEKKG-----TELYTYIQNELNEIEADMYEPRQA
3c72A           NPKSYGTWHHRCWLLSRLPEPNWARELCARFLDERNFHCWDYRRFVAAQAAAPAEELAFTDSLITRNFSN
2dbaA           ----------------------------------------------------------------------
2b05A           AIAELDTL--------------------------------------------------------------
1a37A           LR--------------------------------------------------------------------
1a38A           PIRLGLALNFSVFYYEILNSPEKACSLAKTAFAESYKDSTLIMQLL------------------------
2btpA           AIAELDTL--------------------------------------------------------------
2e2eA           NAELYAALATVLYYQASQHMTAQTRAMIDKALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPR
2b05F           AIAELDTL--------------------------------------------------------------
3dssA           NFSNYSSWHYRSCLLPPENVLLKELELVQNAFFTDPNDQSGAGSGRCELSVEKSTVLQSLQELEPENKWC
2bugA           DKKYIKGYYRRAASNMALGKFRAALRDYETVVKPHDKDAKMKYQECNKIVKQK-----------------
3ck7B           ETLRQRAEIRFLRHYWYFLDLFGKAPFKEHFSNDLPVEKK-----GTELYTYIQNELNEIEADMYEPRQA
3ceqA           AHEKEFGSVNGDNKPIWMHAEEREESKAC--KSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASR-----
2avpA           ----------------------------------------------------------------------
2d4cD           DPLQNLHDKDLREIQSALQHHLKKLEGRRLDFDIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQ
3edtH           AHEKEFGSGDNKPIAEEREESKDKRRDACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASR-----
2axvA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
1e96B           LRGNQLDYKILGLQFKLFACEVLYNIAFMKKEEWKKAEEQLALATSEPRHSKIDKAMECVWKQKLYVVIP
2c08A           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
3e6yB           --------------------------------------------------------------------TA
2crbA           RWKRAKREERL-----------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2e0zC           ASNASAGPFGLIINPKRYAKLLKIVEVLKEIFIVTLNIDENKVIIFANTPAVLDVVVGQDVTLQELGGDD
2c23A           YLKMKGYLSEVASGDNKQTTVSNSQQAYQEAFEISLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAE
3efzD           AE--------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2bq0B           ---------------------------------------------------------------------D
2axzB           ----------------------------------------------------------------------
2b05E           AIAELDTL--------------------------------------------------------------
2aw6B           ---------NIFKIIGKEDIHRSLVEELTKIS--------------------------------------
2bq0A           AIAELDTL--------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3efzC           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2c0mA           GAADARDLSTLLTMF-------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
3dsxA           LQSELESCKELQELEP---------------ENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMR
2c08A           --------------------------------------------TKLDDDFKEERKVDVTSRAVEITKTI
2crbA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDT
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2bedA           YHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREV---------
1dceA           LELVQNAFFTDPNDQSAWFYHRWLLGRAEPHDVLCCVHVSREEACL------------------------
2cfzA           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           IAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLFFFAAPNEYRECRTLLHAALEMNPNDAQLHASL
3ck7D           ILPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVEIPTK
3bcvA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2c0mA           MEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAH
2ae7A           ----------------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
3draA           YQIWNYRQLIIGQIMELNNNDFDPYREFDILEAMLSSDPKNHHVWSYRKWLVDTFDLHNDAKELSFVDKV
2c0nA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3c3oA           FEKM------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3cvlA           VRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPASFFRMLLNVMNRPDLVELTYAQNVEPFA----
3ckbB           PFGRADKAANWLLRARLYLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEII
2bo4A           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2agdA           ----------------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
3dstA           QSAWFYHRWLLGAGSGRCEL--------------------------------------------------
3e4bA           WVSLAQLLYDFPELGDVEQMMKYLDNGRAADQPRAELLLGKLYYEGKWVPADAKAAEAHFEKAVGRVAAD
3e33A           YHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEM---
3cvqA           QLGSVNEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRP----
2c2lA           ----------------------------------------------------------------------
3cvpA           VRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVTRS-MWDFFRMLLNVMNRPDLVELTYAQNVEPFA----
3cvnA           ----------------------------------------------------------------------
3dsuA           QSAWFYHRWLLGA---------------------------------------------------------
3dswA           QSAWFYHVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPAAYL
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           ----------------------------------------------------------------------
3ck7A           PFGRADKAANWLLRARLYLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEII
3c72A           YSSWHYRSCLLPQ---------------------------------------------------------
2dbaA           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
2btpA           ----------------------------------------------------------------------
2e2eA           INRTQLVESINMAKLLQRRSD-------------------------------------------------
2b05F           ----------------------------------------------------------------------
3dssA           LLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLK-----------------
2bugA           ----------------------------------------------------------------------
3ck7B           PFGRADKAANWLLRARLYLNAGVYTGQTDYAKAEEYASKVIGSAYKLCTNYSELFMADNDENENAMQEII
3ceqA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           LSALVQAQLEYHKQQILQQVTVRLEERIRQA---------------------------------------
3edtH           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
3dsxA           ----------------------------------------------------------------------
1e96B           VGKLFRP---------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
3e6yB           REENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEE
2crbA           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2e0zC           VAFLVSEAI-------------------------------------------------------------
2c23A           LDTLN-----------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2bq0B           KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERN
2axzB           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3efzC           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           ----------------------------------------------------------------------
3ck7D           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3dswA           ----------------------------------------------------------------------
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNGARRSSWRVISSIEQKTMADGN
1a37A           ----------------------------------------------------------------------
2e2eA           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           -------------VPLCKQALEDLEKSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIRE----
3dsxA           AAYLDDLRSKFLLENSVLKM--------------------------------------------------
2c08A           EYLQPNPASRAKPQAEALAEALKFGRELGDDCNFGPALGEVGEARELSEVKDSLDEVKQNFIDPLQ----
2crbA           ----------------------------------------------------------------------
2c0lA           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYH
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2bedA           -------QYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSP-YLIAFLVDIYEDM
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           GVLYNLSNNYDSAAANLRRVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINMAVSYSNMSQYDL
3ck7D           GLDTDEQIDAFDAE--------------------------------------------------------
3bcvA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2c0mA           LVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGYDKAVDCFTAARPNDY-LLWNKLGATLA
2ae7A           ----------------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
3draA           IDTDL--KNNSAWSHRFFLLFSKK-----HLATDNTIDEELNYVKDKIVKCPQNPSTWNYLLGIHERFDR
2c0nA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ckbB           LPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFAR-------------------------AA
2bo4A           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2agdA           ----------------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e4bA           YYLGQIYRRGYLGKV----------------YPQKALDHLLTAARNGQNSADFAIAQL------FSQGKG
3e33A           -----IKLVPHNESAWNYLGILQDRGLSRYPNLLNQLLDLQPSHSSPYLI-----AFLVDIYEDMLENQC
3cvqA           --------DDAQLWNKLGATLANGNRPQEALDAYNRALDI--------------NPGYVRVMYNMAVSYS
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3cvnA           ----------------------------------------------------------------------
3dsuA           --------------------------------------------------------------------VE
3dswA           DDLRSKFLLENSVLKM------------------------------------------------------
3dsvA           --------------------------------------------------------LLGAGSGRCELSVE
3beeB           --------------------------------------------------------------------YL
3beeA           --------------------------------------------------------------------YL
2c63A           ----------------------------------------------------------------------
3ck7A           LPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVDEQIDA
3c72A           --------------------------------------------------------------------VE
2dbaA           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
2btpA           ---------------------------------------------------------------------H
2e2eA           ----------------------------------------------------------------------
2b05F           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2bugA           ----------------------------------------------------------------------
3ck7B           LPIRQDGVKTRNYGGSTYLVCGTRVAGMPRMGTTNGWSCIFARAAMVQKFFSNLEDVPMLPADVDEQIDA
3ceqA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
3dsxA           --------------------------------------------------------RCELSVEKSTVLQS
1e96B           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
3e6yB           SRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAASGDSKVFYLKMKGDYH-RYLAEFKTGAE
2crbA           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2e0zC           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
2c0lA           ------------------------------------------------------PNDYLLWNKLGATLAN
2bq0B           EKKQQMGKEYREKIEAELQDICNDVLELL-----DKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDN
2axzB           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3efzC           ----------------------------------------------------------------------
2c1nA           ------------------------------------------------------------------KLAE
2cg3A           -------------------------------------------------------------------ASY
2cfuA           -------------------------------------------------------------RELQADALE
1dceA           -------------------------------------------------------------------KRQ
2cfzA           --------------------------------------------------------------------LP
2cg2A           -------------------------------------------------------------------ASY
3cv0A           ----------------------------------------------------------------------
3ck7D           --------------------------------------------------------------------FD
2c0mA           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2c2lA           -------------------------------------------------------------------CQL
3cvpA           -------------------------------------------------------------------PFE
3dswA           ---------------------------------------------------------GSGRCELSVEKST
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           EKKLEKVKAYREKIEKELETV--CNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYVASGEKKNSVVEA
1a37A           -----------------------------------------------------------------VLSLL
2e2eA           --------------------------------------------------------------------QA
3dssA           ----------------------------------------------------------------------
2avpA           -------------------------------------------------------------------AYY
2d4cD           -------------------------------------------------------------------ERK
3edtH           --------KTLGKDHPAVAATLNNLAVLYRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLNNLALLCQ
3dsxA           ----------------------------------------------------------------------
2c08A           --------NLHDKDLREIQHH----------------------------LKKLEGRRLDFDYKKKRQGKI
2crbA           -------------------------------------------------------------------RLL
2c0lA           ----------------------------------------------------------------------
2aw6B           -------------------------------------------------------------ALTISIMNR


                         .         .         .         *         .         .         .:630
query           EHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDRS
2cg3A           ----------------------------------------------------------------------
2cfuA           ----------------------------------------------------------------------
2bedA           LENQCDNKEDILNKALELCILAKEKDIRKEYWRYIGRSLQS-----------------------------
1dceA           ----------------------------------------------------------------------
2cfzA           ----------------------------------------------------------------------
3ckqA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
3cv0A           AAKQLVRAIYMQVGGTTSREARSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQ-----------
3ck7D           ----------------------------------------------------------------------
3bcvA           ----------------------------------------------------------------------
2d0jA           ----------------------------------------------------------------------
2c0mA           NGNQSEEAVAAYRRALELQGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIW
2ae7A           ----------------------------------------------------------------------
2bo7A           ----------------------------------------------------------------------
3e26A           ----------------------------------------------------------------------
2d7iA           ----------------------------------------------------------------------
3draA           SITQLEEFSLQFVDLEKDQTSSFALETLAKIYTQQKKYNESRTVYLLKSKYNPIRSNFWDYQISKL----
2c0nA           ----------------------------------------------------------------------
2dm9A           ----------------------------------------------------------------------
3c3oA           ----------------------------------------------------------------------
3ckjA           ----------------------------------------------------------------------
3e25A           ----------------------------------------------------------------------
3cvlA           ----------------------------------------------------------------------
3ckbB           MVQKFFSNLEDVPMLPADVIPTKGLDTDEQIDAFDAEHGIRTEDMIKAAGDDRALLYSGVGGGRRKIQT-
2bo4A           ----------------------------------------------------------------------
2dl1A           ----------------------------------------------------------------------
2agdA           ----------------------------------------------------------------------
2d0jD           ----------------------------------------------------------------------
3dstA           ----------------------------------------------------------------------
3e4bA           TKPDPLNAYVFSQLAKAQDPEANDLATQLEAPLTPAQRAEGQRLVQQELAARGTLLQLH-----------
3e33A           DNDILNKALELCEILAKEKDRKEYWRYIGRSLQSKHSRESD-----------------------------
3cvqA           NMSQYDLAAKQLVRAIYMQVTRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAK----------------
2c2lA           ----------------------------------------------------------------------
3cvpA           ----------------------------------------------------------------------
3cvnA           -------------------EREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSH----
3dsuA           KSTVLQSELESCKELQELEPELLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFL---
3dswA           ----------------------------------------------------------------------
3dsvA           KSTVLQSELESCKELQELEPENLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLEN
3beeB           HKQATDEVSLLLEQALQLEPNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTIIESINKAK-
3beeA           HKQATDEVSLLLEQALQLEPNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTIIESINKAK-
2c63A           ----------------------------------------------------------------------
3ck7A           FDAEHGIRTEDMIKAAGDDRALYSGVGGGRRKIQTDAISGFTDGLSIVKWQNYRSDGKPVSHATYP----
3c72A           KSTVLQSELESCKELQELEPENKTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLEN
2dbaA           ----------------------------------------------------------------------
2b05A           ----------------------------------------------------------------------
1a37A           ----------------------------------------------------------------------
1a38A           ----------------------------------------------------------------------
2btpA           HHHHHSSGVDLGTENLYFQMEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELS--------------
2e2eA           ----------------------------------------------------------------------
2b05F           ----------------------------------------------------------------------
3dssA           ----------------------------------------------------------------------
2bugA           ----------------------------------------------------------------------
3ck7B           FDAEHGIRTEDMIKAAGDDALLYSGVGGGRRKIQTDAISGFTDGLSIVKWQNYRSDGKPVSHATYPD---
3ceqA           ----------------------------------------------------------------------
2avpA           ----------------------------------------------------------------------
2d4cD           ----------------------------------------------------------------------
3edtH           ----------------------------------------------------------------------
2axvA           ----------------------------------------------------------------------
3dsxA           ELESCKELQELEPENKW---CLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLEN
1e96B           ----------------------------------------------------------------------
2c08A           ----------------------------------------------------------------------
2axuL           ----------------------------------------------------------------------
3e6yB           RKEAAESTLTAYKAAQDIATTGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAEEESY-----------
2crbA           ----------------------------------------------------------------------
2axuE           ----------------------------------------------------------------------
2e0zC           ----------------------------------------------------------------------
2c23A           ----------------------------------------------------------------------
3efzD           ----------------------------------------------------------------------
2c0lA           GNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIW
2bq0B           KQTTVSNSQQAYQEAFEISKKGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTL-----------
2axzB           ----------------------------------------------------------------------
2b05E           ----------------------------------------------------------------------
2aw6B           ----------------------------------------------------------------------
2bq0A           ----------------------------------------------------------------------
2axuB           ----------------------------------------------------------------------
3efzC           ----------------------------------------------------------------------
2c1nA           QAERYDDMAACMKSVTEQGASNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREY----
2cg3A           ARGEYRWVVEVVNRLVFAEDNRAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDQGSAD---
2cfuA           QLGYQAENAGWRNSYLSAAELRHGVPRDQGSADALAAMDTGLLFDYLGVRLDAGAAEGKALSINLRLPDI
1dceA           AGELDESVLELTSQILGANDFATLWNCRREVLQHLETEKSPEESAALVKAELGFLESCL-----------
2cfzA           PSLDQEWYDRGYHGSVSHNRAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEYMGGAERLLEQARAS----
2cg2A           ARGEYRWVVEVVNRLVFAEDNRAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVPRDGSADA---
3cv0A           ----------------------------------------------------------------------
3ck7D           QQGVFVKGYAMLGVTDEGERTTFNCNELPTDECLWAWQKNQDIPQLTSISWSPSSQRTEWVYVRLGY---
2c0mA           ----------------------------------------------------------------------
3cvlA           -------------------EREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSH----
2dl1A           ----GSSGEPAEIKIIREAKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGW
2c2lA           EMESYDEAIANLQRAYSLAKQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYL-----------
3cvpA           ANNPYMYHENPMEEGLSAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVH-----------
3dswA           VLQSELESCKELQELEPENWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFL---
3dsvA           ----------------------------------------------------------------------
3beeB           ----------------------------------------------------------------------
3beeA           ----------------------------------------------------------------------
2c63A           SEAAYKEAFEISKEQMQPTHPGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDS-------
1a37A           EKFLIPNAAESKVFYLKMKDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKIRLGLALNFSVFYYACS
2e2eA           SQHMTAQTRAMIDKALALDNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINM---
3dssA           ---ELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLEN
2avpA           KQGDYDEAIEYYQKALELDRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDP-----------------
2d4cD           VDVTSRAVMEIMTKTIEYLQPPASRAKLSMYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMR---
3edtH           NQGKAEEVEYYYRRALEIYAVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSGDNKPIWMHAE
3dsxA           ----------------------------------------------------------------------
2c08A           PDEELRQALEKFDESKEIASSFNLLEDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL-----------
2crbA           AAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAHSG---
2c0lA           ----------------------------------------------------------------------
2aw6B           NLKEAQYYINQFEHLKTIKNILEINYLKQIYQFLTDKNIDSYLNAVNIINI-------------------


                         .         +         .         .         .         .         *:700
query           EKIKGExxxx
2cg3A           ----------
2cfuA           ----------
2bedA           ----------
1dceA           ----------
2cfzA           ----------
3ckqA           ----------
2cg2A           ----------
3cv0A           ----------
3ck7D           ----------
3bcvA           ----------
2d0jA           ----------
2c0mA           STL-------
2ae7A           ----------
2bo7A           ----------
3e26A           ----------
2d7iA           ----------
3draA           ----------
2c0nA           ----------
2dm9A           ----------
3c3oA           ----------
3ckjA           ----------
3e25A           ----------
3cvlA           ----------
3ckbB           ----------
2bo4A           ----------
2dl1A           ----------
2agdA           ----------
2d0jD           ----------
3dstA           ----------
3e4bA           ----------
3e33A           ----------
3cvqA           ----------
2c2lA           ----------
3cvpA           ----------
3cvnA           ----------
3dsuA           ----------
3dswA           ----------
3dsvA           SVLKME----
3beeB           ----------
3beeA           ----------
2c63A           ----------
3ck7A           ----------
3c72A           SVLKME----
2dbaA           ----------
2b05A           ----------
1a37A           ----------
1a38A           ----------
2btpA           ----------
2e2eA           ----------
2b05F           ----------
3dssA           ----------
2bugA           ----------
3ck7B           ----------
3ceqA           ----------
2avpA           ----------
2d4cD           ----------
3edtH           ----------
2axvA           ----------
3dsxA           SVLKME----
1e96B           ----------
2c08A           ----------
2axuL           ----------
3e6yB           ----------
2crbA           ----------
2axuE           ----------
2e0zC           ----------
2c23A           ----------
3efzD           ----------
2c0lA           STLR------
2bq0B           ----------
2axzB           ----------
2b05E           ----------
2aw6B           ----------
2bq0A           ----------
2axuB           ----------
3efzC           ----------
2c1nA           ----------
2cg3A           ----------
2cfuA           GE--------
1dceA           ----------
2cfzA           ----------
2cg2A           ----------
3cv0A           ----------
3ck7D           ----------
2c0mA           ----------
3cvlA           ----------
2dl1A           ESAR------
2c2lA           ----------
3cvpA           ----------
3dswA           ----------
3dsvA           ----------
3beeB           ----------
3beeA           ----------
2c63A           ----------
1a37A           L---------
2e2eA           ----------
3dssA           SVLKME----
2avpA           ----------
2d4cD           ----------
3edtH           ER--------
3dsxA           ----------
2c08A           ----------
2crbA           ----------
2c0lA           ----------
2aw6B           ----------