[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50036.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bl0A.bssp"
#ERROR : Can't open dsspfile "2dg6A.bssp"
#ERROR : Can't open dsspfile "2ao9H.bssp"
#ERROR : Can't open dsspfile "2ao9C.bssp"
#ERROR : Can't open dsspfile "3bcyA.bssp"
#ERROR : Can't open dsspfile "1d5yA.bssp"
#ERROR : Can't open dsspfile "2d40A.bssp"
#ERROR : Can't open dsspfile "2d40B.bssp"
#ERROR : Can't open dsspfile "2d40D.bssp"
#ERROR : Can't open dsspfile "3bcwA.bssp"
#ERROR : Can't open dsspfile "3bcwB.bssp"
#ERROR : Can't open dsspfile "2araA.bssp"
#ERROR : Can't open dsspfile "2aacA.bssp"
#ERROR : Can't open dsspfile "2arcA.bssp"
#ERROR : Can't open dsspfile "2arcB.bssp"
#ERROR : Can't open dsspfile "3cewA.bssp"
#ERROR : Can't open dsspfile "3bu7A.bssp"
#ERROR : Can't open dsspfile "2d40C.bssp"
#ERROR : Can't open dsspfile "2b8mA.bssp"
#ERROR : Can't open dsspfile "3ejkA.bssp"
#ERROR : Can't open dsspfile "2eaaC.bssp"
#ERROR : Can't open dsspfile "3ebrA.bssp"
#ERROR : Can't open dsspfile "3d82A.bssp"
#ERROR : Can't open dsspfile "3bu7B.bssp"
#ERROR : Can't open dsspfile "3d0jA.bssp"
#ERROR : Can't open dsspfile "3d82B.bssp"
#ERROR : Can't open dsspfile "3cjxF.bssp"
#ERROR : Can't open dsspfile "3balA.bssp"

## Summary of PDB Search
:240
    4e-19  21%  1bl0A  [a.4.1 - a.4.1] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE
    1e-15  14%  2dg6A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    4e-13  10%  2ao9H  [x.x.x] PHAGE PROTEIN
    6e-11  11%  2ao9C  [x.x.x] PHAGE PROTEIN
    7e-11  11%  3bcyA  [x.x.x] PROTEIN YER067W
    4e-08  24%  1d5yA  [a.4.1 - a.4.1 - d.60.1] ROB TRANSCRIPTION FACTOR
    2e-07   8%  2d40A  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    6e-07   8%  2d40B  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    7e-07   9%  2d40D  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    2e-06   9%  3bcwA  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-06   9%  3bcwB  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-06  11%  2araA  [x.x.x] ARAC
    4e-06  11%  2aacA  [b.82.4] ARAC
    6e-06  12%  2arcA  [b.82.4] ARABINOSE OPERON REGULATORY PROTEIN
    8e-06  12%  2arcB  [b.82.4] ARABINOSE OPERON REGULATORY PROTEIN
    3e-05  13%  3cewA  [x.x.x] UNCHARACTERIZED CUPIN PROTEIN
    4e-05  14%  3bu7A  [x.x.x] GENTISATE 1,2-DIOXYGENASE
    5e-05   9%  2d40C  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    7e-05   8%  2b8mA  [x.x.x] HYPOTHETICAL PROTEIN MJ0764
    9e-05  21%  3ejkA  [x.x.x] DTDP SUGAR ISOMERASE
    1e-04  25%  2eaaC  [x.x.x] 7S GLOBULIN-3
    1e-04  13%  3ebrA  [x.x.x] UNCHARACTERIZED RMLC-LIKE CUPIN
    1e-04  19%  3d82A  [x.x.x] CUPIN 2, CONSERVED BARREL DOMAIN PROTEIN
    2e-04  14%  3bu7B  [x.x.x] GENTISATE 1,2-DIOXYGENASE
    3e-04  10%  3d0jA  [x.x.x] UNCHARACTERIZED PROTEIN CA_C3497
    5e-04  17%  3d82B  [x.x.x] CUPIN 2, CONSERVED BARREL DOMAIN PROTEIN
    6e-04  20%  3cjxF  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    0.001  11%  3balA  [x.x.x] ACETYLACETONE-CLEAVING ENZYME
:240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxCLSHAHSFGQLLLPLQGTLFIETNLHRVRLDNKHLFFLPPGDNHTFYSKDKNE
1bl0A           ----------------------------------------------------------------------
2dg6A           ----------------------------------------------------------------------
2ao9H           ----------------------------------------------------------------------
2ao9C           ----------------------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1d5yA           ----------------------------------------------------------------------
2d40A           --------------------ARTTDSTIYHVVEGSGQVIIGNETFSFSAKDIFVVPTWHGVSFQTTQDSV
2d40B           --------------------ARTTDSTIYHVVEGSGQVIIGNETFSFSAKDIFVVPTWHGVSFQTTQDSV
2d40D           --------------------ARTTDSTIYHVVEGSGQVIIGNETFSFSAKDIFVVPTWHGVSFQTTQDSV
3bcwA           --------------------NTTGYIEYCHIIEGEARLVDPDGTVHAVKAGDAFIPEGYTGRWEVDRHVK
3bcwB           --------------------NTTGYIEYCHIIEGEARLVDPDGTVHAVKAGDAFIPEGYTGRWEVDRHVK
2araA           --------------------LGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAR
2aacA           --------------------LGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAR
2arcA           --------------------LGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAR
2arcB           --------------------LGMKGYILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAR
3cewA           --------------------SHKQNEEIYGILSGKGFITIDGEKIELQAGDWLRIAPDGKRQISAASDSP
3bu7A           --------------------HRHTGNVIYNVAKGQGYSIVGGKRFDWSEHDIFCVPAWTWHEHCNTQERD
2d40C           --------------------ARTTDSTIYHVVEGSGQVIIGNETFSFSAKDIFVVPTWHGVSFQTTQDSV
2b8mA           --------------------HYSNSYVHLIIIKGETLTLEDQEPHNYKEGNIVYVPFNVKLIQNINSDIL
3ejkA           --------------------KRHSLTQLFAVPVGTSGRLAQVTLGRPDNYRLLRIPPQVWYGFAATGDTP
2eaaC           -----------------LLPHHADADFLLVVLNGTLVNPDSRDSYILEQGHAQKIPAGTTFFLVNPDDNE
3ebrA           --------------------HHHTGTVIVYTVQGSWRYKEHDWVAHAG--SVVYETASTRHTPQSAYAEG
3d82A           --------------------HEHADTDEVFIVEGTLQIAFRDQNITL-QAGEYVIPKGVEHKPAKEECKI
3bu7B           --------------------HRHTGNVIYNVAKGQGYSIVGGKRFDWSEHDIFCVPAWTWHEHCNTQERD
3d0jA           --------------------IHHSTDEQFILSAGKAILDKFNIELTLEKGKVYNVPAECWFYSITQKDTK
3d82B           --------------------HEHADTDEVFIVEGTLQIAFR-DQNITLQAGEYVIPKGVEHKPAKEECKI
3cjxF           --------------------HFHT-GTVHYTISGCWYYTEY-PGQKQTAGCYLYEPGGSIHQFNTPRDNE
3balA           --------------------HIHAGPGEYFLTKGKMEVGEQEGGSTAYAPSYGFESSGALHGKTFFPVES


                         .         .         *         .         .         .         .:140
query           FLVLDIPASLLPEQNYKNMDGGVYLPLDQRWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bl0A           ----------------------------------------------------------------------
2dg6A           ----------------------------------------------------------------------
2ao9H           ----------------------------------------------------------------------
2ao9C           ----------------------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1d5yA           ----------------------------------------------------------------------
2d40A           LFSFSDRPVQ------------------------------------------------------------
2d40B           LFSFSDRPVQ------------------------------------------------------------
2d40D           LFSFSDRP--------------------------------------------------------------
3bcwA           KIYFVT----------------------------------------------------------------
3bcwB           KIYFVT----------------------------------------------------------------
2araA           EWYHQWVYFRPR----------------------------------------------------------
2aacA           EWYHQWVYFRPRA---------------------------------------------------------
2arcA           EWYHQW----------------------------------------------------------------
2arcB           EWYHQW----------------------------------------------------------------
3cewA           IGFLCIQVKAGSL---------------------------------------------------------
3bu7A           DACLFS----------------------------------------------------------------
2d40C           LFSFSDRP--------------------------------------------------------------
2b8mA           EFF-------------------------------------------------------------------
3ejkA           ALVANC----TDIPHRQGESERAFIPFSWAG---------------------------------------
2eaaC           NLRIIKIPVNNPHR--------------------------------------------------------
3ebrA           PDIITF----------------------------------------------------------------
3d82A           IIE-------------------------------------------------------------------
3bu7B           DACLFS----------------------------------------------------------------
3d0jA           YV--------------------------------------------------------------------
3d82B           IIE-------------------------------------------------------------------
3cjxF           GQTEVI----------------------------------------------------------------
3balA           QFYMTF----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLSPLAFIQKLRLEKAKYLLINTDFSLLRIAQE
1bl0A           -LDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAER
2dg6A           --------------LADLSKRSGVSTATIKYYLREGLLPPGYDEDHLRRLRLVRALIQVGKVPVATAREV
2ao9H           -VENELMESEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQ
2ao9C           -VENELMESEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQ
3bcyA           -HQHIEKHLLKDIKQAVRKPELKFHEKSKEETFDKITWHYGEEHGRPFKIDVQVVCTHEDAVFVDYKTHP
1d5yA           -LIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQ
2d40A           ----------------------------------------------------------------------
2d40B           ----------------------------------------------------------------------
2d40D           ----------------------------------------------------------------------
3bcwA           ----------------------------------------------------------------------
3bcwB           ----------------------------------------------------------------------
2araA           ----------------------------------------------------------------------
2aacA           ----------------------------------------------------------------------
2arcA           ----------------------------------------------------------------------
2arcB           ----------------------------------------------------------------------
3cewA           ----------------------------------------------------------------------
3bu7A           ----------------------------------------------------------------------
2d40C           ----------------------------------------------------------------------
2b8mA           ----------------------------------------------------------------------
3ejkA           ----------------------------------------------------------------------
2eaaC           ----------------------------------------------------------------------
3ebrA           ----------------------------------------------------------------------
3d82A           ----------------------------------------------------------------------
3bu7B           ----------------------------------------------------------------------
3d0jA           ----------------------------------------------------------------------
3d82B           ----------------------------------------------------------------------
3cjxF           ----------------------------------------------------------------------
3balA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VGYEQQSSLARLFRQKEGMSASDYRKAFQR
1bl0A           YGFESQQTLTRTFKNYFDVPPHKYRMTNMQ
2dg6A           LGHVDDDSLGRTVRLGAALWA---------
2ao9H           PSVKAMQLYMQRFGLLTDK-----------
2ao9C           PSVKAMQLYMQRFGL---------------
3bcyA           VGA---------------------------
1d5yA           YRFDSQQTFTRAFKKQFAQTPALYRRSPEW
2d40A           ------------------------------
2d40B           ------------------------------
2d40D           ------------------------------
3bcwA           ------------------------------
3bcwB           ------------------------------
2araA           ------------------------------
2aacA           ------------------------------
2arcA           ------------------------------
2arcB           ------------------------------
3cewA           ------------------------------
3bu7A           ------------------------------
2d40C           ------------------------------
2b8mA           ------------------------------
3ejkA           ------------------------------
2eaaC           ------------------------------
3ebrA           ------------------------------
3d82A           ------------------------------
3bu7B           ------------------------------
3d0jA           ------------------------------
3d82B           ------------------------------
3cjxF           ------------------------------
3balA           ------------------------------