[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50272.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cixA.bssp"
#ERROR : Can't open dsspfile "3ciwA.bssp"
#ERROR : Can't open dsspfile "2a5hA.bssp"
#ERROR : Can't open dsspfile "3c8fA.bssp"
#ERROR : Can't open dsspfile "2bw2A.bssp"
#ERROR : Can't open dsspfile "3chvA.bssp"
#ERROR : Can't open dsspfile "3cl4A.bssp"
#ERROR : Can't open dsspfile "2a5hB.bssp"
#ERROR : Can't open dsspfile "3bz6A.bssp"
#ERROR : Can't open dsspfile "3cl5A.bssp"
#ERROR : Can't open dsspfile "3bg3A.bssp"
#ERROR : Can't open dsspfile "3cb8A.bssp"
#ERROR : Can't open dsspfile "3e65A.bssp"

## Summary of PDB Search
:198
    3e-10  14%  3cixA  [x.x.x] FEFE-HYDROGENASE MATURASE
    2e-07  13%  3ciwA  [x.x.x] FEFE-HYDROGENASE MATURASE
    7e-07  18%  2a5hA  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    1e-06  16%  3c8fA  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    1e-05   8%  2bw2A  [x.x.x] BYPASS OF FORESPORE C
    2e-05  12%  3chvA  [x.x.x] PROKARYOTIC DOMAIN OF UNKNOWN FUNCTION (DUF849)
    8e-05  13%  3cl4A  [x.x.x] HEMAGGLUTININ-ESTERASE
    8e-05  15%  2a5hB  [x.x.x] L-LYSINE 2,3-AMINOMUTASE
    2e-04   9%  3bz6A  [x.x.x] UPF0502 PROTEIN PSPTO_2686
    4e-04  14%  3cl5A  [x.x.x] HEMAGGLUTININ-ESTERASE
    5e-04  15%  3bg3A  [x.x.x] PYRUVATE CARBOXYLASE, MITOCHONDRIAL
    5e-04  15%  3cb8A  [x.x.x] PYRUVATE FORMATE-LYASE 1-ACTIVATING ENZYME
    5e-04  12%  3e65A  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
:198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxTLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCG
3cixA           -------------RAIIEFSNVCRKNCLYCGLRRDNKNLKRYRMTPEEIVERARLAVQFG--AKTIVLQS
3ciwA           -------------RAIIEFSNVCRKNCLYCGLRRDNKNLKRYRMTPE-EIVERARLAVQFGA--KTIVLQ
2a5hA           -------------PDRVLLLITDCSYCRHCTRRRFAG---QSDDSPERIDKAIDYIRNTPQ-VRDVLLSG
3c8fA           -------------IRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTAS
2bw2A           ------------------VEHYEPLQVHVQLEKVYLDGDV----SIEHKHEKVFSMDDFWAAYAGWTLVQ
3chvA           -------------------NKPCIICVAITGSVPTKADNPAVPI----TVSEQVESTQEFEAGAAIAHCH
3cl4A           -------------NSTETITTGFDFNCHYLVLPSGNY--------LAISNELLLTVPTKAICLNKQVVDS
2a5hB           -------------PDRVLLLITDCSYCRHCTRRRFAG---QSDDSPERIDKAIDYIRNTPQ-VRDVLLSG
3bz6A           -------------TNPETYPLTLNALVIACNQKTSRDPV---NLTQGQVGQSLRALEGRG--LTRLVGSR
3cl5A           -------------NSTETITTGFDFNCHYLVLPSGNY--------LAISNELLLTVPTKAICLNKQVVDS
3bg3A           --------------------------------------------------------------YTGDVADP
3cb8A           -------------IRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTAS
3e65A           ---------------TLHHKATSDFTSCLGSIMNPKSLTRG-PRDKPTPLEELLPHAIEFQYYGSFKEAK


                         .         .         *         .         .         .         .:140
query           YGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNATVYTEICR
3cixA           GEDPYYMPDVISDIVKEIKKMG-VAVTLSLGE----WPREYYEKWKEAGADRYLLRHETANPVLHRKLRP
3ciwA           SGEDPYMPDVISDIVKEIKKMGVAVTLSLGEWPREYYEKWK-----EAGADRYLLRHETANPVLHRKLRP
2a5hA           GDALLVSDETLEYIIAKLREIPHEIVRIGSRT--------------------------------------
3c8fA           GGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDP---VIDELLEVTDLVMLDLKQMNDEIH-QNLV
2bw2A           KKGYVLFRKQMDDISPLSKVNGYIGVSDNGVI----STFHGRPEPASEPQSFFQIDLERLESHMQKNLLK
3chvA           VRNDDGTPDRFARLTEGLHTHCPGIVQFSTGGRSGAGQARGGLPLK--PDASLSVGSNNFPSRVYENPPD
3cl4A           RWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYDNHGDAGFTSILSGLLYDGVFRYDNVSSVWPLYSYG
2a5hB           GDALLVSDETLEYIIAKLREIP-HVEIVRIGSRTPVVLPQRITPELVNLKKYHPV------WLNTHFNHP
3bz6A           ADRWEHKLELVPAQVILTGLLLLRGPQTVSELLTRSNRHDEDSEQVHQLERLIARGLATLVP-RQSGQRE
3cl5A           RWNNARQSDNMTAVACQPPYCYFRNSTTNYVGVYD-----------------------------------
3bg3A           S-RTKYSLQYYMGLAEELVRAGTHILCIDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHD---------
3cb8A           GGEAILQAEFVRDWFRACKKEGIHTCLDTNGF--------------------------------------
3e65A           IEEHLARLAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICT


                         +         .         .         .         .         *         .:210
query           PADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQNLGTEFxxxxxxx
3cixA           DTS----FENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLL-------------
3ciwA           ----DTSFENRLNLLTLKELGYETGAGSMVGLPGQTIDDLVDDLL-------------
2a5hA           ----------------------------------------------------------
3c8fA           GVSNHRTLEFAKYLANKNVKVW------------------------------------
2bw2A           GI-PFRTKAEFEDVIEHM----------------------------------------
3chvA           LVDWLAA---QRSRVTPEIEAFDLSHILRA----------------------------
3cl4A           ----------------------------------------------------------
2a5hB           NEITEE----STRACQLLADAGVPLGNQSVLLRGV-----------------------
3bz6A           DRY-------------------------------------------------------
3cl5A           ----------------------------------------------------------
3bg3A           ----------------------------------------------------------
3cb8A           ----------------------------------------------------------
3e65A           NNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEF-------