[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50573.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2cnwE.bssp"
#ERROR : Can't open dsspfile "2cnwD.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2c5qB.bssp"
#ERROR : Can't open dsspfile "2cnwF.bssp"
#ERROR : Can't open dsspfile "1augA.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2c5qE.bssp"
#ERROR : Can't open dsspfile "2df5A.bssp"
#ERROR : Can't open dsspfile "2c5qA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3cr8C.bssp"
#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "2b98D.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3cioA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "4ecaA.bssp"
#ERROR : Can't open dsspfile "2bejA.bssp"
#ERROR : Can't open dsspfile "2afiF.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2b98A.bssp"
#ERROR : Can't open dsspfile "2c5qF.bssp"
#ERROR : Can't open dsspfile "3cwqB.bssp"
#ERROR : Can't open dsspfile "2bekA.bssp"
#ERROR : Can't open dsspfile "3ea0B.bssp"
#ERROR : Can't open dsspfile "2b98C.bssp"
#ERROR : Can't open dsspfile "3cwqA.bssp"
#ERROR : Can't open dsspfile "3bfvA.bssp"
#ERROR : Can't open dsspfile "2afkG.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2afkE.bssp"
#ERROR : Can't open dsspfile "3cr8A.bssp"
#ERROR : Can't open dsspfile "2afiE.bssp"
#ERROR : Can't open dsspfile "1byiA.bssp"
#ERROR : Can't open dsspfile "2afiM.bssp"
#ERROR : Can't open dsspfile "3bfjA.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"
#ERROR : Can't open dsspfile "2afiH.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "2afkF.bssp"
#ERROR : Can't open dsspfile "2afkH.bssp"
#ERROR : Can't open dsspfile "2d7uA.bssp"
#ERROR : Can't open dsspfile "2bekB.bssp"
#ERROR : Can't open dsspfile "2afiO.bssp"
#ERROR : Can't open dsspfile "2b98B.bssp"
#ERROR : Can't open dsspfile "1dulA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1djpA.bssp"
#ERROR : Can't open dsspfile "1dtsA.bssp"
#ERROR : Can't open dsspfile "2afiN.bssp"
#ERROR : Can't open dsspfile "2cb4A.bssp"
#ERROR : Can't open dsspfile "3cf4G.bssp"
#ERROR : Can't open dsspfile "1de0A.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "2b99B.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2afiP.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2am1A.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "3bb4A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3bsdA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3ea0A.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3akyA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1daeA.bssp"
#ERROR : Can't open dsspfile "2b99A.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "3bg3A.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3dreA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2ak3A.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "3cmwA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"

## Summary of PDB Search
:446
    8e-52  38%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-46  36%  2cnwE  [x.x.x] CELL DIVISION PROTEIN FTSY
    3e-45  35%  2cnwD  [x.x.x] CELL DIVISION PROTEIN FTSY
    1e-41  35%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-40  35%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-40   9%  2c5qB  [x.x.x] RRAA-LIKE PROTEIN YER010C
    4e-40  36%  2cnwF  [x.x.x] CELL DIVISION PROTEIN FTSY
    2e-38  17%  1augA  [c.56.4] PYROGLUTAMYL PEPTIDASE-1
    4e-38  19%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    8e-37   9%  2c5qE  [x.x.x] RRAA-LIKE PROTEIN YER010C
    9e-37   9%  2df5A  [x.x.x] PYRROLIDONE-CARBOXYLATE PEPTIDASE
    7e-36   9%  2c5qA  [x.x.x] RRAA-LIKE PROTEIN YER010C
    7e-34  52%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    5e-33  14%  3cr8C  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    3e-31   9%  1cp2A  [c.37.1] NITROGENASE IRON PROTEIN
    2e-30  12%  2b98D  [x.x.x] RIBOFLAVIN SYNTHASE
    2e-30  36%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-30  12%  3cioA  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-29  52%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-29  52%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-28  10%  4ecaA  [c.88.1] L-ASPARAGINE AMIDOHYDROLASE
    7e-28  17%  2bejA  [x.x.x] SEGREGATION PROTEIN
    3e-27  11%  2afiF  [x.x.x] NITROGENASE IRON PROTEIN 1
    4e-27  34%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    9e-27  13%  2b98A  [x.x.x] RIBOFLAVIN SYNTHASE
    1e-24   6%  2c5qF  [x.x.x] RRAA-LIKE PROTEIN YER010C
    4e-24  21%  3cwqB  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    8e-24  18%  2bekA  [x.x.x] SEGREGATION PROTEIN
    1e-23  13%  3ea0B  [x.x.x] ATPASE, PARA FAMILY
    1e-23  12%  2b98C  [x.x.x] RIBOFLAVIN SYNTHASE
    1e-22  20%  3cwqA  [x.x.x] PARA FAMILY CHROMOSOME PARTITIONING PROTEIN
    2e-22  13%  3bfvA  [x.x.x] MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
    6e-22  11%  2afkG  [x.x.x] NITROGENASE IRON PROTEIN 1
    6e-22  12%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    2e-21  11%  2afkE  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-21  18%  3cr8A  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    8e-21  11%  2afiE  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-20  17%  1byiA  [c.37.1 (1bs1A)] DETHIOBIOTIN SYNTHASE
    2e-20  11%  2afiM  [x.x.x] NITROGENASE IRON PROTEIN 1
    4e-20  13%  3bfjA  [x.x.x] 1,3-PROPANEDIOL OXIDOREDUCTASE
    1e-19  15%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
    1e-19  10%  2afiH  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-19  13%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    3e-19  11%  2afkF  [x.x.x] NITROGENASE IRON PROTEIN 1
    1e-18  11%  2afkH  [x.x.x] NITROGENASE IRON PROTEIN 1
    3e-17  11%  2d7uA  [x.x.x] ADENYLOSUCCINATE SYNTHETASE
    7e-17  16%  2bekB  [x.x.x] SEGREGATION PROTEIN
    2e-16  10%  2afiO  [x.x.x] NITROGENASE IRON PROTEIN 1
    5e-16  14%  2b98B  [x.x.x] RIBOFLAVIN SYNTHASE
    8e-16  53%  1dulA  [a.36.1] SIGNAL RECOGNITION PARTICLE PROTEIN (FIFTY-FOUR
    1e-15  36%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-15   9%  1djpA  [c.88.1] GLUTAMINASE-ASPARAGINASE
    6e-15  15%  1dtsA  [x.x.x] DETHIOBIOTIN SYNTHETASE
    9e-15  11%  2afiN  [x.x.x] NITROGENASE IRON PROTEIN 1
    9e-14   8%  2cb4A  [x.x.x] MOSQUITOCIDAL TOXIN
    1e-13  18%  3cf4G  [x.x.x] ACETYL-COA DECARBONYLASE/SYNTHASE EPSILON
    4e-13  10%  1de0A  [c.37.1] NITROGENASE IRON PROTEIN
    6e-12  13%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    8e-12   9%  2b99B  [x.x.x] RIBOFLAVIN SYNTHASE
    6e-10  32%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-09  12%  2afiP  [x.x.x] NITROGENASE IRON PROTEIN 1
    2e-09  27%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    3e-08  13%  2am1A  [x.x.x] UDP-N-ACETYLMURAMOYLALANINE-D-GLUTAMYL-LYSINE-D-
    4e-08  24%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-07  28%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    2e-07  20%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-07  14%  3bb4A  [x.x.x] T7I23.11 PROTEIN
    6e-07  14%  1e2hA  [c.37.1] THYMIDINE KINASE
    7e-07  14%  3bsdA  [x.x.x] BACTERIOCHLOROPHYLL A PROTEIN
    5e-06  14%  1e2jA  [c.37.1] THYMIDINE KINASE
    6e-06  23%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-05  19%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-05  17%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    3e-05  12%  3ea0A  [x.x.x] ATPASE, PARA FAMILY
    4e-05  18%  1e0jA  [c.37.1] DNA HELICASE
    5e-05  22%  3akyA  [x.x.x] ADENYLATE KINASE
    6e-05  19%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-05  17%  1daeA  [x.x.x] DETHIOBIOTIN SYNTHETASE
    7e-05  15%  2b99A  [x.x.x] RIBOFLAVIN SYNTHASE
    8e-05  15%  3cmvC  [x.x.x] PROTEIN RECA
    9e-05  15%  3cmvG  [x.x.x] PROTEIN RECA
    9e-05  35%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-04  12%  3bg3A  [x.x.x] PYRUVATE CARBOXYLASE, MITOCHONDRIAL
    1e-04  13%  3cmvA  [x.x.x] PROTEIN RECA
    2e-04   9%  3dreA  [x.x.x] CREATINE KINASE B-TYPE
    2e-04  19%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-04  28%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    2e-04  14%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    3e-04  15%  2ak3A  [c.37.1 - g.41.2] ADENYLATE KINASE ISOENZYME-3
    4e-04  27%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    5e-04  14%  3cmwA  [x.x.x] PROTEIN RECA
    5e-04  33%  1e2jB  [c.37.1] THYMIDINE KINASE
    6e-04  27%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    7e-04  14%  3cmtD  [x.x.x] PROTEIN RECA
    7e-04  30%  1e2lB  [c.37.1] THYMIDINE KINASE
    8e-04  14%  2c95B  [x.x.x] ADENYLATE KINASE 1
    9e-04  16%  1e2kB  [c.37.1] THYMIDINE KINASE
    9e-04  27%  2bifA  [c.37.1 - c.60.1] PROTEIN
    9e-04  10%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    0.001  20%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    0.001   8%  1e2iA  [c.37.1] THYMIDINE KINASE
    0.001  36%  3adkA  [x.x.x] ADENYLATE KINASE
:446

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAVGQDVLESLSP
3dm5A           VLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
2cnwE           -------------------------NLEEVLEELEMALLAADVGLSATEEILQEVRGRKDLKEAVKEKLV
2cnwD           -------------------------NLEEVLEELEMALLAADVGLSATEEILQEVRASG--RKDLKEAVK
3dm9B           ---------------------IKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDK
3dm5B           VLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISK
2c5qB           ----------------------------------------------------------------------
2cnwF           -------------------------NLEEVLEELEMALLAADVGLSATEEILQEVRASG-----------
1augA           ----------------------------------------GGETVNPSWEAVKRLNGAAEGP--------
3cr8B           ----------------------------------------------------------------------
2c5qE           ----------------------------------------------------------------------
2df5A           --------------------------------------------FEPFGGEKINPTERIAKDLDGIKIGD
2c5qA           ----------------------------------------------------------------------
2c03B           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
3cr8C           AIVARNFGCSLLIAGGDPSVAERAEKIGVRLIAYPRMVYVEDRAEHLPEAEAPQGARLLTLSGEEFQRRM
1cp2A           ----------------------------------------------------------------------
2b98D           ----------------------------------------------------------------------
3dmdC           -----------LLDRILTV-EIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDK
3cioA           ----------------------------EAPEQLEEHGISVYATIPMSEWLDKRQRHRTKNIPFLAVDNP
2c03A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
2c04A           MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTP
4ecaA           ----------------------------------------------------------------------
2bejA           ----------------------------------------------------------------------
2afiF           ----------------------------------------------------------------------
3dmdB           MFGKLREKLKKGLLDRILTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDK
2b98A           ----------------------------------------------------------------------
2c5qF           ----------------------------------------------------------------------
3cwqB           ----------------------------------------------------------------------
2bekA           ----------------------------------------------------------------------
3ea0B           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
3bfvA           -----------------------------RIKDEEDVEKELGLPVLGSIQKFNMTNTRRSTSSLIVHEQP
2afkG           ----------------------------------------------------------------------
3cioD           -------------------------EAPEQLEEHGISVYATIPMSEWLDKRTRLQRHRTKNIPFLAVDNP
2afkE           ----------------------------------------------------------------------
3cr8A           ---------------------IADPSVAERAEKIGVRLIAYPRMVEDRAEHLPEAEAPQGARLLTLSGEE
2afiE           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
3bfjA           ----------------------------------------------------------------------
1b25A           -------------------GRILRVNL--TTGEVKVQEYPEEVAKKFIGG-------RGLAAWILWNEAR
2afiH           ----------------------------------------------------------------------
1eg7B           -----------------------------------------EIAQAAKMKPVMELARGLGIQE------D
2afkF           ----------------------------------------------------------------------
2afkH           ----------------------------------------------------------------------
2d7uA           ----------------------------------------HSVVINGKKYAVRQIPTGFMQTKARLLIGA
2bekB           ----------------------------------------------------------------------
2afiO           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
3e70C           ---------------------IKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGGKI
1djpA           ----------------------------------------------------------------------
1dtsA           ----------------------------------------------------------------------
2afiN           ----------------------------------------------------------------------
2cb4A           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
1de0A           ----------------------------------------------------------------------
1eg7A           -----------------------------------------EIAQAAKMKPVMELARG---------LGI
2b99B           ----------------------------------------------------------------------
3dmdA           --KSFVKRVEEEVEKEEEEVELTEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDK
2afiP           ----------------------------------------------------------------------
3b9qA           VFSGFSKTRENLAVIDELLLFWNLAETDRVLDELEEALLVSDFGPKITVRIVERLREDIMSGKL----KS
2am1A           ---------------------TQLEKAEFDSRLIGGDLFVPLKGARDGHDFIETA--FENGAAVTLSEKE
2ax4A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3bsdA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------FESAEV
1cr1A           -------------------------------------------------------------ERIREHLSS
3ea0A           ----------------------------------------------------------------------
1e0jA           ---------------------------------------------------------------VVSALSL
3akyA           ----------------------------------------------------------------------
3bh0A           -------------------------------------------------------------GSIDEALVT
1daeA           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3bg3A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dreA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
3do6A           ---------------------------------------------------------------IADQLEL
2ak3A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2dgmA           ----------------------------------------------------------------------
3dvlC           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKLAKLLSKQGRRPLMVAGDIYR
3dm5A           KEHIIKIVYEELTKFLGTEA-KPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
2cnwE           GMLEPDERRATLRKLGFNPQKPKPVEPKG-RVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFR
2cnwD           EKLVGMLEPDERRATLRKLGFQKPKPVEPKRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFR
3dm9B           GKIIEEAVKEAVSEILETSRRIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
3dm5B           KEHIIKIVYEELTKFLGTEAK-PIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWR
2c5qB           ---------------------------------------------DLQKLQRFSTCDISDGLLNVYNIPT
2cnwF           RKDLKEAVKEKLVGMLEPPVEP------KGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFR
1augA           ----ASIVSEQVPTVFYKSLAVLRIKKHQPDIIICVGQAGGRMQITPERVAI------------NLNEAR
3cr8B           -AGLKIPEWYSFPEVLAELHRQTPPRERQGFTVFFTGLSGAGKSTLARALAARLMEMGGRCVTLDGDIVR
2c5qE           ------------------------------------------------KLQRFSTCDISDGLLNVYNIPT
2df5A           AQVFGRVLPVVFGKAKEVLEKTLE--EIKPDIAIHVGLAPGRSAISIERIAVNA------------IDAR
2c5qA           --------------------------------------------SDLQKLQRFSTCDISDGLLNVYNIPT
2c03B           AE----VILATVYEALKEALGARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
3cr8C           RAGLKIPEWYSFPEVLAELHRQTPPRERQGFTVFFTGLSGAGKSTLARALAARLMEMGGRCTLLDGDIVR
1cp2A           -------------------------------QVAIYGKGGIGKSTTTQNLTSGLHAMGKTIMVVGCDPKA
2b98D           ----------------------------------------------------------KKVGIVDTVDMA
3dmdC           GKIIEEAVKEAVSEILETSRRIEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
3cioA           ADSAVEAVRALRTSLHF-----AMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRR
2c03A           AE----VILATVYEALKEALGARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
2c04A           AE----VILATVYEALKEALGARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR
4ecaA           ----------------------------------------------------------------------
2bejA           ---------------------------KVRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLDPQG
2afiF           ------------------------------RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
3dmdB           GKIIAVKEAVSEILETSRRIIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
2b98A           ----------------------------------------------------------KKVGIVDTVDMA
2c5qF           ----------------------------------------------------------------------
3cwqB           -------------------------------ITVASFKGGVGKTTTAVHLSAYLAL-QGETLLIDGDPNR
2bekA           ---------------------------KVRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQG
3ea0B           ---------------------------NAKRVFGFVSAKGDGGSCIAANFAFALSQEDIHVLAVDISLPF
2b98C           ----------------------------------------------------------KKVGIVDTVDMA
3cwqA           -------------------------------IITVASFKGVGKTTTAVHLSAYL-ALQGETLLIDGDPNR
3bfvA           KSPISEKFRGIRSNIMFA-----NPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRK
2afkG           ------------------------------RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
3cioD           ADSAVEAVRALRTSLHF-----AMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRR
2afkE           ------------------------------RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
3cr8A           FQRLKIPEWYSFPEVLAELHRQTPPRERQGFTVFFTGLSGAGKSTLARALARLMEMGGRCVTLLDGDIVR
2afiE           ------------------------------RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
1byiA           -------------------------------RYFVTGTDEVGKTVASCALLQAAKAAGYRTAGYKPVASG
2afiM           --------------------------------CAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
3bfjA           -----------------------MFDYLVPNVN----FFGPNAISVVGERCQLLGG--KKALLVTKGLRK
1b25A           GVEPLSPENKLIFAAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKK
2afiH           -------------------------------QCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
1eg7B           EVELYGKYKAKISLDVYRRLKDKPDGKLILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSL
2afkF           ------------------------------RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
2afkH           ------------------------------RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
2d7uA           GVLVDPEVFFHELEQLKNVKDRVGIDYRCAIIEAKDVKELEPYLTDVAQEINDALDEGSLVLVEGTQGFG
2bekB           ---------------------------KVRRIALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLAPQG
2afiO           -------------------------------QCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
2b98B           ---------------------------------------------------------------FARVDMA
1dulA           ----------------------------------------------------------------------
3e70C           IEEAVKEAVSEILETSRRIDLIEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFR
1djpA           ----------------------------------------------------------------------
1dtsA           -------------------------------RYFVTGTTEVGKTVASCALLQAAKAAGYRTAGYKPVASG
2afiN           --------------------------------CAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
2cb4A           --------------------------------KDNTWIQAALTWLDSSLLYQLISTRIPSFASPNGLHRE
3cf4G           -----------------------------NTKLFTSYGVNTSKAVSPEMAAKIISKAKRPLLMVGTLALD
1de0A           ------------------------------RQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
1eg7A           QEDEVELYGKYKAKISLDVYRRLKDGKLILVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSL
2b99B           ----------------------------------------------------------KKVGIVDTTFAR
3dmdA           GKIIEEAVKEAVSEILSRRIDEEIRKAEKPYVIMFVGFNGSGK---------------------------
2afiP           ---------------------------------------GIGKSTTTQNLVAALAEMGKKVMIVGCDPKA
3b9qA           GSEIKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFR
2am1A           VSNHPYILVDDVLTAFQSLASYYLEKTTVD-VFAVTGSNG--KTTTKDLAHLLSTRYKTYK-TQGNYNNE
2ax4A           AHHVSRNKRGQVVGTRGG---------FRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVR
2ax4B           -------------------QVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVR
3czpB           --DTYEKAVIELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEE
3bb4A           --------------------------------VGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVGGVGK
1e2hA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYLGASETI
3bsdA           ----------------------------------------------------------------------
1e2jA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGAS
2dwoA           ----TQSRVQKIWVPVDHRPSLRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYR
3czpA           GHSIKDTYEKAVIELLLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEE
1cr1A           EESVGLLF--------SGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGAMGKKVGLAMLEESV
3ea0A           -------------------------------VFGFVSAKGDGGSCIAANFAFALSQEPDIHVLAVDISLP
1e0jA           RERIREHLSSSVGLLFSGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEES
3akyA           -----------------------------SIRMVLIGPPGAGKGT----QAPNLQERFHAAHLATGDMLR
3bh0A           VYEEIESADGNITGVPSGFTERMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNL-------
1daeA           -------------------------------RYFVTGTDTVGKTVASCALLQAAKAAGYRTAGYKPVASG
2b99A           ------------------------------------------------------------------VDMA
3cmvC           ----------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
3cmvG           ----------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
1ckeA           ----------------------------IAPVITIDGPSGAGKGT----LCKAMAEALQWHLLDSGAIYR
3bg3A           ----------------------------------------------------------------------
3cmvA           ----------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL
3dreA           ---------NYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVALSSLDGDLAGRYYALKSMTEAEQQ
1e2hB           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVPMTYWRVLGA
2bwjA           ----------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKY----------------
3do6A           KDDILYPYGHYIAKIDHRFLKSLENHELILVTAVTPTPAGEGKTTTSIGLSSLN-RIGKKSIVTLRE---
2ak3A           -------------------------ASARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNML
2bwjE           ---------------------------RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS----------
3cmwA           ----------------------------MGRIVEIYGPESSGKTTLTLQVIAAAQREGKT--CAFIDAEH
1e2jB           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALG----------------
2bwjD           ---------------------------RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS----------
3cmtD           ---------------------------PMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHLD
1e2lB           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIV----------
2c95B           -----------------------EEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSDLLRSEVSSG
1e2kB           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWR
2bifA           -----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYR
2dgmA           ----------------------------------------------------------------------
3dvlC           -----------LDEMCGGGFFK-------DSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESR
1e2iA           ---------------------------PTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIY
3adkA           ----------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKI--------------------


                         +         .         .         .         .         *         .:210
query           PAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANSTGRDLVIIDTAGRLHINEELMDELANIKSTV
3dm5A           PGAYHQLRQLLDRYHIEVFGNPQEKAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVI
2cnwE           AAGGTQLSEWGKRLSIPVIQGPEGDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
2cnwD           AAGGTQLSEWGKRLSIPVIQGPEGDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
3dm9B           AGAIEQLEEHAKRIGVKVIKHSYGAPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLDEKKIARV--T
3dm5B           PGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEMKQISNVI
2c5qB           GGYFPNLTAISPPQNSSIVGTAYVLFAPIDDPRPAVNYIDPNSILVLALEPHLQSQFHPFIKITMSTRAQ
2cnwF           AAGGTQLSEWGKRLSIPVIQGEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAI
1augA           IPDNEGNQPVGEDISQGGP--AAYWTGLPIKRIVEEIKKEGIPAAVSYTAGTFVCNHLFYGLMDEISRHH
3cr8B           RHLSSELGFSKAHRDVNVRRIGFVAITKNRGIAICAPIA--PYRQTRRDVRAMIEAVGGFVEIHVATDPY
2c5qE           GGYFPNLTAISPPQNSSIVGTAYTDDPRPAVNYIDSVP--PNSILVLALEPHLQSQFHPFIKITMSTRAQ
2df5A           IPDNEGKKIEDEPIVPGAPTAY--FSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKG
2c5qA           GGYFPNLTAISPPQNSSIVGTAYTDDPRPAVNYIDSVP--PNSILVLALEPHLQSQFHPFIKITQATRAQ
2c03B           PAAREQLRLLGEKVGVPVLEVMDESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
3cr8C           RHLSSELGFSKAHRDVNVRRIGFVAPYRQTRRDVRAMIEAVGGFVEIHVATPIEYEVPETPELAIDTTGL
1cp2A           DSTRLLLGGLAQKSVLDTLREEGDVELDSILKEGYGGIRCVESGGPEPGVGCAGRGIITSINMLEQLGAY
2b98D           SIAIKKLKELSPNIKIIRKT--VPGIKDLPVACKKLLEEEGCDIVMLGMPGKAEKDKVCAHEASLAQLMT
3dmdC           AGAIEQLEEHAKRIGVKVIKHSGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
3cioA           GYSHNLFTVSNEHGLSEYLAGK-----DELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWA
2c03A           PAAREQLRLLGEKVGVPVLEVMGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2c04A           PAAREQLRLLGEKVGVPVLEVMDESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
4ecaA           ---------------------------------------------SNYTVGKVGV-ENLVNAVPQLKDIA
2bejA           NATSGLGVRAERGVTPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAEGVVVPV
2afiF           DSTRLILHSKAQNTIMEMAAEAGTEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITNFLEEEGAY
3dmdB           AGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARIDVVLIDTAGRSETNRNLMDEMKKIARVT
2b98A           SIAIKKLKELSPNIKIIRKT--VPGIKDLPVACKKLLEEEGCDIVMLGMPGKAEKDKVCAHEASLAQLMT
2c5qF           ----------------------------------------PNSILVLALEPHLQSQFHPFIKIAMYGGLM
3cwqB           SATGWGKRGSLPFKVVDERQAAKYAIVIDTQARDLEALADGCDLLVIPSTPDALALDALLTIETLQKLGN
2bekA           NATSGLGVRAERGVTPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAEGVVVPV
3ea0B           GDLDYLSGNTHSQDLADISNA---SDRLDKSLLDTVQHISPSLDLIPSPATFEKIVNIEPERVSDLIHIA
2b98C           SIAIKKLKELSPNIKIIRKT--VPGIKDLPVACKKLLEEEGCDIVMLGMPGKAEKDKVCAHEASLGLMLA
3cwqA           SATGWGKRGSLPFKVVDERQAAKIDTQARPEDEDLEALADGCDLLVIPSTPDALALDALLTIETLQKLGN
3bfvA           PTQHYIFNLPNNEGLSSLLLNWSTQDSIISTEIEDLDVLTSGPIPPNPSELIYDTLLMNYNFVIIDTPPV
2afkG           DSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAY
3cioD           GYSHNLFTVSNEHGLSEYLAGKDELN-----KVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWA
2afkE           DSTRLILHSKAQNTIMEMAAEGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVAINFLEEEGAY
3cr8A           RHLSSELG-FSKA-------HRDVNVRRIGFVASEKNRGIAICAPIAPYRQTRRDVRAMIEAVGGFVEIH
2afiE           DSTRLILHSKAQNTIMEMAAEGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEGAY
1byiA           SEKTPEGLRNSDALALQRNSSLQLDYATVNPYAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQE
2afiM           DSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYKCVESGGPEPGVGCAGRGVITAINFLEEEGAY
3bfjA           DGAVDKTLHYLREAGIEVAIFDPNPKDTNVRDGLAVFRREQCDIIVHDCGKGIGIAATHEGDLYQYAGIE
1b25A           PVYIYIEDDNVSILSAEGLWGKTT----------------------------------------------
2afiH           DSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKAGYKCVESGGPEPGVGCAGRGVITAINFLEEEGAY
1eg7B           GP--------------------------------------------------------------------
2afkF           DSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAY
2afkH           DSTRLILHSKAQNTIMEMAAEAGTEDLELEDVLKAGYGGVVESGGPEPGVGCAGRGVITAINFLEEEGAY
2d7uA           LSLYYGTYPYVTSKDVTASSV----AADVGIGPTRVDEVIVVFKSFPTRVGAGPFPTEMPMEEADRLGLV
2bekB           NATSGLGVRAERGVTPDLVGATVELAGAPTALREALRDEGYDLVLLDAPPSLSPLTLNALAAAEGVVVPV
2afiO           DSTRLILHSKAQNTIMEMAAEAGTVEDLELEDVLKGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAY
2b98B           SIAIKKLKELSPNIKIIRKT--VPGIKDLPVACKKLLEEEGCDIVMLGMPGKAEKDKVCAHEASLAQLMT
1dulA           ----------------------------------------------------------------------
3e70C           AGAIEQLEEHAKRIGVKVIKHSYGADPAAVYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
1djpA           -------------------------------------------------AAKVGV-DKLIAGVPELADLA
1dtsA           SEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPQADWVLVEGAGGWFTPLSDTFTFADWVTQE
2afiN           DSTRLILHSKAQNTIMEMAAEAGTEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEG
2cb4A           QTIDSNTGQIQIDNEHRLLRWD-RRPPNDIFLNG---FIPRVTNQNLSPVEDTHLLNYLRTNSPSIFVST
3cf4G           PELLDRVVKISKAANIPIAATGSSLAV----LADKDVDAKYINAHMLGFYLTDPKWPGLDGNG-------
1de0A           DSTRLILHSKAQNTIMEMAAEGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAILEEEGAY
1eg7A           GP--------------------------------------------------------------------
2b99B           VDMASIAIKKLKELSPNIIRKTVPGIKDLPVACKKLLEEEGCD-IVMALGMPKVCAHEASLGLMLAQLMT
3dmdA           ----------------------------------------------------------------------
2afiP           DSTRLILHSKAQNTIMEMAAEAGTEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVIINFLEEEGAY
3b9qA           AAASDQLEIWAERTAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVGKIVSG
2am1A           IGLPYTVLHPEG--TEKLVLEGQDHLGDIH----LLSELARPKTAIVTLVGEAHLAFKDRSEIAKGKQIA
2ax4A           HGLNRNLGF--------SPGDREENIRRIAEVAKLFADAGLVCITISPFAKDRENARKIHESAG------
2ax4B           HGLNRNL---------------------------------------------------------------
3czpB           LERPPQWRFWR-----------------------------------------------------------
3bb4A           SSTVNSL--IGEQVVR---------VSPFLRPVMVSRTMGGFTINIIDTPGLGYVNHQALELIKGFLVNR
1e2hA           ANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALL
3bsdA           ----------------------------------------------------------------------
1e2jA           ETIANIYTTQHRLDQGEISAGDAAVVMNITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALL
2dwoA           REAVKQYSSYNFFRPDNEEAM-------------------------------------------------
3czpA           LERPPQWRFWRRLP--------------------------------------------------------
1cr1A           EETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGL
3ea0A           FGDLDYLSGNTHSQDLADISNAS---DRLDKSLLDTVQHISPSLDLIPSPATFEKIVNIEPERVSDLIHI
1e0jA           V---------------------------------------------------------------------
3akyA           SQIAKGTQLGLEAKKIMGGLVSDDIMVNMIKDELTNNPACKNG-FILDGFPRTIPQAEKLDQMLKEQGTP
3bh0A           ----------------------------------------------------------------------
1daeA           SEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPQADWVLVEGAGGWFTPLSDTFTFADWVTQE
2b99A           SIAIKKLKELSPNIKIIRKT--VPGIKDLPVACKKLLEEEGCDIVMAGMPGKAEKDKVCAHEAMLAQLMT
3cmvC           DPIYARKLGVDIDNLLCSQPDTGEQALEICD---ALARSGAVDVIVVDSVAALTPKAEIEGLAARMMS--
3cmvG           DPIYARKLGVDIDNLLCSQPDTGEQALEICD---ALARSGAVDVIVVDSVAALTPKAEIEGLAA------
1ckeA           VLALAALH--------------------------------------------------------------
3bg3A           --------------------SRTKYSLQYYMGLAEELVRAGTHILCIDMAGLLKP-TACTMLVSSLRDRF
3cmvA           DPIYARKLGVDIDNLLCSQPDTGEQALEI---CDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGL
3dreA           Q-LIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQI
1e2hB           SETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLGGEAGSPPPALTLIFDRHPIAALL
2bwjA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ak3A           R---------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3cmwA           ALDPIYARKLGVDIDNLL----CSQPDTGEQACDALARSGAVDVIVVDSVAALTPKAE--IEMGLAARMM
1e2jB           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cmtD           PIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA----VDVIVVDSVAALTPKAEMGLAARMMSQAM
1e2lB           ----------------------------------------------------------------------
2c95B           SARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA
1e2kB           VLGASETIANIYT-TQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIF
2bifA           RDMVKTYKSFEFFLPDNEEGL-------------------------------------------------
2dgmA           ----------------LREIPMRPGQLFMDPKRMIEACDENTIGVVPTFYTGNYEFPQPLHDALDKFQAD
3dvlC           AQLLRNAYSWGNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARNNAFRQFVIGVTGYA
1e2iA           TTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAA
3adkA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RPHEILLVVDAMTGQEAVNVADTFNQKLGLDGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDAL
3dm5A           HPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDI
2cnwE           APKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
2cnwD           APKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
3dm9B           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
3dm5B           HPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDI
2c5qB           YLKSNGTVVFGRIRDVDE--HRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKI---LTSDGVTQTIPGDY
2cnwF           APKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDL
1augA           PHHIPYIPEQTLQKSAPSLSLDHITKALKIAAVTAAVHEDDIETG-------------------------
3cr8B           VPETPELAIDT-TGLAIDEAVQQILLKLEHEGYL------------------------------------
2c5qE           YLKSNGTVVFGRIRD--VDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQ---LKILTSDGVTQTIPGDY
2df5A           YPKMSGFIHVPYIPEQIIDKIGKGQVPPSMCYEMELE-------AVKVAIEVALTQ--------------
2c5qA           YLKSNGTVVFGRIRD--VDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKI---LTSDGVTQTIPGDY
2c03B           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
3cr8C           AIEAVQQILLKLEHEGYLRL--------------------------------------------------
1cp2A           TDDLDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMALYAANNISKGIYAKSGGVRLGGIICNSR
2b98D           NKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGK-------------------
3dmdC           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
3cioA           NDHYDLVIVDTPPMLAVSDAAVVGR--SVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIK
2c03A           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
2c04A           GPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGL
4ecaA           NVGEQVVNIGSMNDNVWLTLAKKINTDCKTDGFVITHVDTMEETAYFLDLTVKCDKPVVMVGAMRPSTSM
2bejA           QAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGEKVFWTV------
2afiF           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYANSTDREDELIIAL
3dmdB           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
2b98A           NKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPE---------------------------
2c5qF           STRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGSCAPKAVVKAVGTNVQLKILTSDGVTQTIPGDY
3cwqB           NRFRILLTIIPPYPSKDGDEARQLFQKASLNGVVVSEVSDSKAGIAWSDYKATGKEIVEEIL--------
2bekA           QAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVE-------AQLRAHFGEKVFWT
3ea0B           ASFYDYIIVDFGASIDHVGVWVLEHLDE---LCIVTTPSLQSLRRAGQLLKLCFEKPISRIEIILNRADT
2b98C           QKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLTRMAGKGLR------QGFED-----
3cwqA           NRFRILLTIIPPYPSKDGDEARQLLTTAGLNGVVVSEVSDSKAGIAWSDYKATGKEIVEEILTLEH----
3bfvA           NTVTDAQLFSKFTGKDEVKKGKELIEATGAKGVVLNRMP-------------------------------
2afkG           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVCNSRNTDREDELIIAL
3cioD           NDHYDLVIVDTPPMLAVSDAAVVGRSVGTS--LLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIK
2afkE           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGLICNSRNTDREDELIIAL
3cr8A           VPETPELAIDT-TGLAIDEAVQQILLKLEHEGYL------------------------------------
2afiE           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYANSTDREDELIIAL
1byiA           QLPVILVVGVKLGCINHAMLTAQVIQHAGLTGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEI------
2afiM           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIGSVRLGGLICNSRNTDR
3bfjA           TLTNVAVNTTAGTASEVTRHCVLTNTETKVKF--------------------------------------
1b25A           ----------------------------------------------------------------------
2afiH           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGLICNSRNTDREDELIIAL
1eg7B           ----------------------------------------------------------------------
2afkF           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGLICNSRNTDREDELIIAL
2afkH           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIGSVRLNTDREDELIIAL
2d7uA           EYGTVTGRRRRVGWFDF-EMARYSARINGATMLAVTMLDKYDKEAFGVTIEERVGVPVGLIKTGPELEHI
2bekB           QAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTMYDGRTLLAQQVEAQLRAHFGEK------VFWTV
2afiO           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGI-----------------
2b98B           NKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYL--------------------------------
1dulA           ----------------------------------------------------------------------
3e70C           KPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDL
1djpA           NVGEQVMQIASITNDDLLKLGKRVAELADSNDVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRPGTAM
1dtsA           QLPVILVVGVKLGCINHAMLTAQVIQHAGLTGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGE-------
2afiN           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGI-----------------
2cb4A           TRGLEITPWTPHSANNNIIYRYEIFAPGGIDINASFSRNHNPFPNEDQITFPGGIRPEFIRST-------
3cf4G           ----------------------------------------------------------------------
1de0A           EDDLDFVFYDVLGDVVCGGWAMPIRENKAQEIYIVCSGEMMAMYAANNISKGLICNSRNTDREDELIIAL
1eg7A           ----------------------------------------------------------------------
2b99B           NKHIIEVFVHEDEAKDDKELDWLAKRRAEEHAENVYYL--------------------------------
3dmdA           -------------------------------------------------ISYVIDAPILFVGVGQGYDDL
2afiP           EDDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGINSGSVRLGGLDELIIAL
3b9qA           APNEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVKFIGVGEAVEDL
2am1A           DGASGSLLLAP-----------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3bb4A           TIDVLLYVDRLRVDELDKQVVIAITQTFGKEILVLTHAQFSPPDELSYETFSSKRSDELLKTIRAGSKMR
1e2hA           CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALP-------------------------------
3bsdA           ----------------------------------------------------------------------
1e2jA           CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALP-------------------------------
2dwoA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1cr1A           GCD--VIILDHISIRNLMTKLKGFAKSTGVVLVVICHLKTDLRGSGAL----------------------
3ea0A           AASFYDYIIVDFGASIDHVGVWVLEHLDELCIVTTPSLQSLRRAGQLLKLCKEFEKPISRIEI-------
1e0jA           ----------------------------------------------------------------------
3akyA           LEKAIELKVD------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1daeA           QLPVILVVGVKLGCNHAMLTAQVIHAGLTLAGWVANDVTPPGKRHAEYTLTRMIPAPL------------
2b99A           NKHIIEVFVHEDEAKDDKE---------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3bg3A           PDLPLHIHTHDTSGAGVAAM--------------------------------------------------
3cmvA           AARMMSQAMRKLAGNL-----------KQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYAVRLDIR
3dreA           ETLFKSKDYEFMWNP--HLGYILTCPSNLGTGLRA-----------------------------------
1e2hB           CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALP-------------------------------
2bwjA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3cmwA           S--QAMRKLAGNLKQSNTLLIFINQIRNPETTTGGNALKFYASIGAVKEGENVVGSETRVKVVK-----N
1e2jB           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cmtD           RNLKQSNTLLIFINQITGGNALKFYASVRLDIRRIGAVKEGEN--VVGSETRVKVVKNKIA-APFKQAEF
1e2lB           ----------------------------------------------------------------------
2c95B           GPETMT----------------------------------------------------------------
1e2kB           DRHPIAALLC------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2dgmA           TGIDIDMHIDAAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQ
3dvlC           KQEEILFTNTSDQFMGAHSITDS-----------------------------------------------
1e2iA           R---------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EPFYPDRMADRILGMGDVLTLIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGM
3dm5A           EPFDPPRFVSRLLGLGDIQGLLEKKELEKEVEIKEEDIERFLRGKFTLKDMYAQLEAMRKMGPISI----
2cnwE           QPFDPEAFVEALL---------------------------------------------------------
2cnwD           QPFDPEAFVEALL---------------------------------------------------------
3dm9B           RPFEKEWFLERIFG--------------------------------------------------------
3dm5B           EPFDPPRFVSRLLGLGDIQGLLEKKELEKEVEIKEEDIERFLRGKFTLKDMYAQLEAMRKMGPSIGE---
2c5qB           IAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVSEDIK---NGIPAKQAQNDRRSVLK----------
2cnwF           QPFDPEAFVEALL---------------------------------------------------------
1augA           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2c5qE           IAGDNNGIVRIPVQETDISKLVTYIEKSIEVDL--LVSEDIKNG-IPAKQAQNDRRSVLKKY--------
2df5A           ----------------------------------------------------------------------
2c5qA           IAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLLVS--EDIKNG-IPAKQAQNDRRSVLK----------
2c03B           EPFYPERLAGRILGMGDV----------------------------------------------------
3cr8C           ----------------------------------------------------------------------
1cp2A           KVANEYELLDAFAKELGFVPRSPMVTKAEINKQTVIEYDPTCEQAEEYRELARKVDAIPKPMTQERLEEI
2b98D           ----------------------------------------------------------------------
3dmdC           RPFEKEWFLERIFG--------------------------------------------------------
3cioA           RASTAYSYGYN-----------------------------------------------------------
2c03A           EPFYPERLAGRILGMG------------------------------------------------------
2c04A           EPFYPERLAGRILGMGDV----------------------------------------------------
4ecaA           SADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQR
2bejA           IPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQEA--------------------------
2afiF           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLV--IPNPITMDELEEL
3dmdB           RPFEKEWFLERIFG--------------------------------------------------------
2b98A           ----------------------------------------------------------------------
2c5qF           IAGDNNGIVRIPVQETDISKLVTYIEKSIEVDLL---VSEDIKNGIPAKQAQNDRRSVLK----------
3cwqB           ----------------------------------------------------------------------
2bekA           VIPRNVRLAEPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQE---------------------------
3ea0B           SRITSDEIEKVIGRPISRIPQDEDAQESLLSGQSVLKVAPKSQLSKTIVDWALH----------------
2b98C           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
3bfvA           ----------------------------------------------------------------------
2afkG           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLV--IPNPITMDELEEL
3cioD           RASTAYSYG-------------------------------------------------------------
2afkE           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLVIPNP--ITMDELEEL
3cr8A           ----------------------------------------------------------------------
2afiE           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLV--IPNPITMDELEEL
1byiA           -PWLAENPENAATGKYINLALL------------------------------------------------
2afiM           EDELIIALANKVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRAARKVVDNKLLVIPNPITMDELEELL--
3bfjA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2afiH           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLV--IPNPITMDELEEL
1eg7B           ----------------------------------------------------------------------
2afkF           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRA---------------------------
2afkH           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRA---------------------------
2d7uA           IDR-------------------------------------------------------------------
2bekB           IPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRLAEEVMARVQ----------------------------
2afiO           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
3e70C           RPFEKEWFLERIFG--------------------------------------------------------
1djpA           SADGMLNLYNAVAVASNKDSRGKGVLVTMN----------------------------------------
1dtsA           IPWLAEAATGKYINLAL-----------------------------------------------------
2afiN           ----------------------------------------------------------------------
2cb4A           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
1de0A           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDP----KAKQADEYRALARKVVD-----NKLLVIPNPIT
1eg7A           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------
3dmdA           RPFEKEWFLERIFG--------------------------------------------------------
2afiP           ANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADEYRALARKVVDNKLLV---------------
3b9qA           QPFDPEAFVNAIF---------------------------------------------------------
2am1A           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3bb4A           KQEFEDSVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAI-------------------
1e2hA           ----------------------------------------------------------------------
3bsdA           ------------------------------------VTTAHSDYEIVLEGGSSSWGKVKAKVNAPPASPL
1e2jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3ea0A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3akyA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1daeA           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3bg3A           ----------------------------------------------------------------------
3cmvA           RIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAG--------
3dreA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3cmwA           KIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIE--KAGAWYSYKGEKIGQGKANATAW---------
1e2jB           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cmtD           ------QILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPET---------
1e2lB           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2dgmA           IGTFAINFAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKL
3dvlC           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IPGMGKLTKQLKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
3dm5A           ----------------GEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQ
2cnwE           ----------------------------------------------------------------------
2cnwD           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3dm5B           ------------------ERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQ
2c5qB           ----------------------------------------------------------------------
2cnwF           ----------------------------------------------------------------------
1augA           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2c5qE           ----------------------------------------------------------------------
2df5A           ----------------------------------------------------------------------
2c5qA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3cr8C           ----------------------------------------------------------------------
1cp2A           LMQYG-----------------------------------------------------------------
2b98D           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
3cioA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
4ecaA           TPARKHTSDTP--FDVSKLNELPKVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLAT
2bejA           ----------------------------------------------------------------------
2afiF           LMEFGIM---------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2b98A           ----------------------------------------------------------------------
2c5qF           ----------------------------------------------------------------------
3cwqB           ----------------------------------------------------------------------
2bekA           ----------------------------------------------------------------------
3ea0B           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------
3cwqA           ----------------------------------------------------------------------
3bfvA           ----------------------------------------------------------------------
2afkG           LMEFG-----------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2afkE           L---------------------------------------------------------------------
3cr8A           ----------------------------------------------------------------------
2afiE           L---------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------
2afiM           ----------------------------------------------------------------------
3bfjA           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2afiH           L---------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2afkF           ----------------------------------------------------------------------
2afkH           ----------------------------------------------------------------------
2d7uA           ----------------------------------------------------------------------
2bekB           ----------------------------------------------------------------------
2afiO           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
1dulA           ----------FDLNDFLEQKVLVREAIINSTK--ERAKPEIIKGSRKRRIAAGSGQ-VQDVNRLLKQFDD
3e70C           ----------------------------------------------------------------------
1djpA           ----------------------------------------------------------------------
1dtsA           ----------------------------------------------------------------------
2afiN           ----------------------------------------------------------------------
2cb4A           ----------------------------------------------------------------------
3cf4G           ----------------------------------------------------------------------
1de0A           MDELEELLMEFGIMEVEDESIVGKTA--------------------------------------------
1eg7A           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2afiP           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
2am1A           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3bsdA           LPADCDVKLNLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEG
1e2jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3ea0A           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3akyA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1daeA           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
3bg3A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
3dreA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
3cmwA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2dgmA           KDGEDPGYTLYDLSERLRLRGWQVPAFTL---GGEATDIVVM------RIMCRRGFEMDFAELLLEDYKA
3dvlC           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TRKMMKQISNMxxxxxxxxxxxxxxx
3dm5A           MKKLFKSMNKR---------------
2cnwE           --------------------------
2cnwD           --------------------------
3dm9B           --------------------------
3dm5B           MKKLFKSMNKR---------------
2c5qB           --------------------------
2cnwF           --------------------------
1augA           --------------------------
3cr8B           --------------------------
2c5qE           --------------------------
2df5A           --------------------------
2c5qA           --------------------------
2c03B           --------------------------
3cr8C           --------------------------
1cp2A           --------------------------
2b98D           --------------------------
3dmdC           --------------------------
3cioA           --------------------------
2c03A           --------------------------
2c04A           --------------------------
4ecaA           AAKTGTAVVRS---------------
2bejA           --------------------------
2afiF           --------------------------
3dmdB           --------------------------
2b98A           --------------------------
2c5qF           --------------------------
3cwqB           --------------------------
2bekA           --------------------------
3ea0B           --------------------------
2b98C           --------------------------
3cwqA           --------------------------
3bfvA           --------------------------
2afkG           --------------------------
3cioD           --------------------------
2afkE           --------------------------
3cr8A           --------------------------
2afiE           --------------------------
1byiA           --------------------------
2afiM           --------------------------
3bfjA           --------------------------
1b25A           --------------------------
2afiH           --------------------------
1eg7B           --------------------------
2afkF           --------------------------
2afkH           --------------------------
2d7uA           --------------------------
2bekB           --------------------------
2afiO           --------------------------
2b98B           --------------------------
1dulA           QRK-----------------------
3e70C           --------------------------
1djpA           --------------------------
1dtsA           --------------------------
2afiN           --------------------------
2cb4A           --------------------------
3cf4G           --------------------------
1de0A           --------------------------
1eg7A           --------------------------
2b99B           --------------------------
3dmdA           --------------------------
2afiP           --------------------------
3b9qA           --------------------------
2am1A           --------------------------
2ax4A           --------------------------
2ax4B           --------------------------
3czpB           --------------------------
3bb4A           --------------------------
1e2hA           --------------------------
3bsdA           SVVNLFY-------------------
1e2jA           --------------------------
2dwoA           --------------------------
3czpA           --------------------------
1cr1A           --------------------------
3ea0A           --------------------------
1e0jA           --------------------------
3akyA           --------------------------
3bh0A           --------------------------
1daeA           --------------------------
2b99A           --------------------------
3cmvC           --------------------------
3cmvG           --------------------------
1ckeA           --------------------------
3bg3A           --------------------------
3cmvA           --------------------------
3dreA           --------------------------
1e2hB           --------------------------
2bwjA           --------------------------
3do6A           --------------------------
2ak3A           --------------------------
2bwjE           --------------------------
3cmwA           --------------------------
1e2jB           --------------------------
2bwjD           --------------------------
3cmtD           --------------------------
1e2lB           --------------------------
2c95B           --------------------------
1e2kB           --------------------------
2bifA           --------------------------
2dgmA           SLKYLSDHP-----------------
3dvlC           --------------------------
1e2iA           --------------------------
3adkA           --------------------------