[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50700.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "1efuA.bssp"
#ERROR : Can't open dsspfile "2bvnB.bssp"
#ERROR : Can't open dsspfile "1d8tA.bssp"
#ERROR : Can't open dsspfile "1efcA.bssp"
#ERROR : Can't open dsspfile "1d8tB.bssp"
#ERROR : Can't open dsspfile "1dg1G.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "1aipA.bssp"
#ERROR : Can't open dsspfile "1aipE.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "2c77A.bssp"
#ERROR : Can't open dsspfile "2d74A.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "2dcuA.bssp"
#ERROR : Can't open dsspfile "2c78A.bssp"
#ERROR : Can't open dsspfile "2b7cA.bssp"
#ERROR : Can't open dsspfile "2dy1A.bssp"
#ERROR : Can't open dsspfile "3cw2B.bssp"
#ERROR : Can't open dsspfile "1d2eA.bssp"
#ERROR : Can't open dsspfile "2brvX.bssp"
#ERROR : Can't open dsspfile "3dpuA.bssp"
#ERROR : Can't open dsspfile "2byeA.bssp"
#ERROR : Can't open dsspfile "3chuA.bssp"
#ERROR : Can't open dsspfile "1eguA.bssp"
#ERROR : Can't open dsspfile "1c82A.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "3bjqE.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "3chuB.bssp"
#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "1aym1.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3a1uB.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "1egaB.bssp"
#ERROR : Can't open dsspfile "3eg5B.bssp"
#ERROR : Can't open dsspfile "3bc1A.bssp"
#ERROR : Can't open dsspfile "3a1sA.bssp"
#ERROR : Can't open dsspfile "1cf4A.bssp"
#ERROR : Can't open dsspfile "2dwqA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2cjwA.bssp"
#ERROR : Can't open dsspfile "3e1yE.bssp"
#ERROR : Can't open dsspfile "3e20A.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"
#ERROR : Can't open dsspfile "1ds6A.bssp"
#ERROR : Can't open dsspfile "1an0B.bssp"
#ERROR : Can't open dsspfile "1eah1.bssp"
#ERROR : Can't open dsspfile "2dfkD.bssp"
#ERROR : Can't open dsspfile "3dsnF.bssp"
#ERROR : Can't open dsspfile "3d5bF.bssp"
#ERROR : Can't open dsspfile "3ea5C.bssp"
#ERROR : Can't open dsspfile "1ecrA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3bb4A.bssp"
#ERROR : Can't open dsspfile "1a4rA.bssp"
#ERROR : Can't open dsspfile "1aztB.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "3a1vB.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1cc0A.bssp"
#ERROR : Can't open dsspfile "2dfkB.bssp"
#ERROR : Can't open dsspfile "3eg5A.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "3bh6A.bssp"
#ERROR : Can't open dsspfile "2dykA.bssp"
#ERROR : Can't open dsspfile "3bb3A.bssp"
#ERROR : Can't open dsspfile "2cxxC.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2ahjD.bssp"
#ERROR : Can't open dsspfile "3dosF.bssp"
#ERROR : Can't open dsspfile "1d1nA.bssp"
#ERROR : Can't open dsspfile "1ceeA.bssp"
#ERROR : Can't open dsspfile "1d5cA.bssp"
#ERROR : Can't open dsspfile "3a1sB.bssp"
#ERROR : Can't open dsspfile "2aseA.bssp"
#ERROR : Can't open dsspfile "1a2kD.bssp"
#ERROR : Can't open dsspfile "1an0A.bssp"
#ERROR : Can't open dsspfile "1ajeA.bssp"
#ERROR : Can't open dsspfile "3e5hA.bssp"
#ERROR : Can't open dsspfile "3bc1E.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "3dsnC.bssp"
#ERROR : Can't open dsspfile "3dosC.bssp"
#ERROR : Can't open dsspfile "1byuA.bssp"
#ERROR : Can't open dsspfile "3bfkB.bssp"
#ERROR : Can't open dsspfile "3bh7A.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "1e96A.bssp"
#ERROR : Can't open dsspfile "1cxzA.bssp"
#ERROR : Can't open dsspfile "1byuB.bssp"
#ERROR : Can't open dsspfile "3efxD.bssp"
#ERROR : Can't open dsspfile "3dosE.bssp"
#ERROR : Can't open dsspfile "2a5dA.bssp"
#ERROR : Can't open dsspfile "2e87A.bssp"
#ERROR : Can't open dsspfile "2bkuA.bssp"
#ERROR : Can't open dsspfile "2bmeC.bssp"
#ERROR : Can't open dsspfile "2bmjA.bssp"
#ERROR : Can't open dsspfile "3dsnE.bssp"
#ERROR : Can't open dsspfile "3cqgB.bssp"
#ERROR : Can't open dsspfile "1cluA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3dwaA.bssp"
#ERROR : Can't open dsspfile "3dpbB.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "1a4xB.bssp"
#ERROR : Can't open dsspfile "3dwaE.bssp"
#ERROR : Can't open dsspfile "3dwaC.bssp"
#ERROR : Can't open dsspfile "3doeA.bssp"
#ERROR : Can't open dsspfile "3ea5A.bssp"
#ERROR : Can't open dsspfile "2c5lA.bssp"
#ERROR : Can't open dsspfile "3ddcA.bssp"
#ERROR : Can't open dsspfile "3a1uA.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "521pA.bssp"
#ERROR : Can't open dsspfile "2crvA.bssp"
#ERROR : Can't open dsspfile "1a2kE.bssp"
#ERROR : Can't open dsspfile "1dpfA.bssp"
#ERROR : Can't open dsspfile "621pA.bssp"
#ERROR : Can't open dsspfile "2ahjB.bssp"
#ERROR : Can't open dsspfile "3dwaB.bssp"
#ERROR : Can't open dsspfile "1chpD.bssp"
#ERROR : Can't open dsspfile "3bjiD.bssp"
#ERROR : Can't open dsspfile "3bbpA.bssp"
#ERROR : Can't open dsspfile "121pA.bssp"
#ERROR : Can't open dsspfile "3defA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3batA.bssp"

## Summary of PDB Search
:635
    4e-44  30%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    6e-43  30%  1efuA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-42  31%  2bvnB  [x.x.x] ELONGATION FACTOR TU
    2e-41  31%  1d8tA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    5e-41  31%  1efcA  [c.37.1 - b.43.3 - b.44.1] PROTEIN (ELONGATION FACTOR)
    5e-38  31%  1d8tB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-36  31%  1dg1G  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-34  29%  1eftA  [x.x.x] ELONGATION FACTOR TU
    3e-34  29%  1aipA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    4e-28  30%  1aipE  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    4e-27  33%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    8e-27  29%  2c77A  [x.x.x] ELONGATION FACTOR TU-B
    1e-24  25%  2d74A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    3e-24  16%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    4e-24  27%  2dcuA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    2e-23  30%  2c78A  [x.x.x] ELONGATION FACTOR TU-A
    3e-23  25%  2b7cA  [x.x.x] ELONGATION FACTOR 1-ALPHA
    2e-21  21%  2dy1A  [x.x.x] ELONGATION FACTOR G
    7e-20  22%  3cw2B  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT GAMMA
    1e-18  27%  1d2eA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    1e-18  10%  2brvX  [x.x.x] HYALURONATE LYASE
    3e-17   9%  3dpuA  [x.x.x] RAB FAMILY PROTEIN
    3e-17  14%  2byeA  [x.x.x] PHOSPHOLIPASE C, EPSILON 1
    8e-17   9%  3chuA  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    1e-16  10%  1eguA  [a.102.3 - b.30.5 - b.24.1] HYALURONATE LYASE
    6e-16  11%  1c82A  [a.102.3 - b.30.5 - b.24.1] HYALURONATE LYASE
    7e-16  14%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    1e-15  10%  3bjqE  [x.x.x] PHAGE-RELATED PROTEIN
    1e-15  14%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-15   7%  3chuB  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    3e-14  30%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-14  11%  1aym1  [b.121.4] HUMAN RHINOVIRUS 16 COAT PROTEIN
    6e-14  12%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    7e-14  18%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    1e-13  14%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-13  31%  3a1uB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-13  23%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-12  11%  1egaB  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    2e-12  10%  3eg5B  [x.x.x] PROTEIN DIAPHANOUS HOMOLOG 1
    7e-12  15%  3bc1A  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    2e-11  21%  3a1sA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-11  13%  1cf4A  [c.37.1] PROTEIN (CDC42 HOMOLOG)
    5e-11  20%  2dwqA  [x.x.x] GTP-BINDING PROTEIN
    6e-11  16%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-10  13%  2cjwA  [x.x.x] GTP-BINDING PROTEIN GEM
    1e-10  21%  3e1yE  [x.x.x] EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR GTP-
    1e-10  20%  3e20A  [x.x.x] EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR GTP-
    1e-10  16%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    3e-10  13%  1ds6A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
    4e-10  12%  1an0B  [c.37.1] CDC42HS-GDP
    5e-10  10%  1eah1  [b.121.4] POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
    5e-10  14%  2dfkD  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    8e-10  26%  3dsnF  [x.x.x] F1 CAPSULE ANTIGEN
    9e-10  16%  3d5bF  [x.x.x] 50S RIBOSOMAL PROTEIN L4
    1e-09  14%  3ea5C  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    2e-09   7%  1ecrA  [e.2.1] PROTEIN (REPLICATION-TERMINATOR PROTEIN)
    2e-09  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-09  12%  3bb4A  [x.x.x] T7I23.11 PROTEIN
    2e-09  18%  1a4rA  [c.37.1] G25K GTP-BINDING PROTEIN
    2e-09  15%  1aztB  [c.37.1 - a.66.1] GS-ALPHA
    5e-09  17%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    5e-09  23%  3a1vB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    6e-09  12%  1ahjB  [b.34.4] NITRILE HYDRATASE (SUBUNIT BETA)
    1e-08  12%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    1e-08  17%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-08  10%  1cc0A  [c.37.1] TRANSFORMING PROTEIN RHOA
    3e-08  14%  2dfkB  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    4e-08  13%  3eg5A  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    4e-08  19%  2bv3A  [x.x.x] ELONGATION FACTOR G
    1e-07  15%  3bh6A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    1e-07  20%  2dykA  [x.x.x] GTP-BINDING PROTEIN
    1e-07  11%  3bb3A  [x.x.x] T7I23.11 PROTEIN
    1e-07  14%  2cxxC  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    1e-07  16%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-07  10%  2ahjD  [b.34.4] NITRILE HYDRATASE
    2e-07  26%  3dosF  [x.x.x] F1 CAPSULE ANTIGEN
    5e-07  18%  1d1nA  [b.43.3] INITIATION FACTOR 2
    7e-07  13%  1ceeA  [c.37.1] GTP-BINDING RHO-LIKE PROTEIN
    7e-07  14%  1d5cA  [c.37.1] RAB6 GTPASE
    8e-07  25%  3a1sB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-06  16%  2aseA  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    1e-06  12%  1a2kD  [c.37.1] RAN
    1e-06  10%  1an0A  [c.37.1] CDC42HS-GDP
    1e-06  15%  1ajeA  [x.x.x] CDC42HS
    2e-06  12%  3e5hA  [x.x.x] RAS-RELATED PROTEIN RAB-28
    2e-06  11%  3bc1E  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    2e-06   9%  1a2kC  [c.37.1] RAN
    2e-06  15%  3dsnC  [x.x.x] F1 CAPSULE ANTIGEN
    2e-06  24%  3dosC  [x.x.x] F1 CAPSULE ANTIGEN
    3e-06  11%  1byuA  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    3e-06   9%  3bfkB  [x.x.x] SMALL GTPASE RAB11
    4e-06  15%  3bh7A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    4e-06  12%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    4e-06  15%  1e96A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    5e-06  12%  1cxzA  [c.37.1] PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-
    6e-06   9%  1byuB  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    7e-06   6%  3efxD  [x.x.x] CHOLERA ENTEROTOXIN SUBUNIT B, HEAT-LABILE
    7e-06  13%  3dosE  [x.x.x] F1 CAPSULE ANTIGEN
    8e-06  12%  2a5dA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    8e-06  16%  2e87A  [x.x.x] HYPOTHETICAL PROTEIN PH1320
    1e-05  10%  2bkuA  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    1e-05  13%  2bmeC  [x.x.x] RAS-RELATED PROTEIN RAB4A
    1e-05  13%  2bmjA  [x.x.x] CENTAURIN GAMMA 1
    3e-05  14%  3dsnE  [x.x.x] F1 CAPSULE ANTIGEN
    3e-05  14%  3cqgB  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP133
    3e-05  12%  1cluA  [c.37.1] TRANSFORMING PROTEIN P21/H-RAS-1
    3e-05  14%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-05   6%  3dwaA  [x.x.x] SUBTILASE CYTOTOXIN, SUBUNIT B
    4e-05  26%  3dpbB  [x.x.x] F1 CAPSULE ANTIGEN
    4e-05  23%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    5e-05  11%  1a4xB  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    6e-05   6%  3dwaE  [x.x.x] SUBTILASE CYTOTOXIN, SUBUNIT B
    6e-05   7%  3dwaC  [x.x.x] SUBTILASE CYTOTOXIN, SUBUNIT B
    8e-05  11%  3doeA  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2
    9e-05  11%  3ea5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    1e-04  15%  2c5lA  [c.37.1 (1he8B)] GTPASE HRAS
    1e-04  13%  3ddcA  [x.x.x] GTPASE HRAS
    1e-04  23%  3a1uA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-04  14%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    1e-04  15%  521pA  [x.x.x] H-RAS P21 PROTEIN
    1e-04  14%  2crvA  [x.x.x] TRANSLATION INITIATION FACTOR IF-2
    2e-04  11%  1a2kE  [c.37.1] RAN
    2e-04  12%  1dpfA  [c.37.1] RHOA
    2e-04  15%  621pA  [x.x.x] H-RAS P21 PROTEIN
    3e-04  11%  2ahjB  [b.34.4] NITRILE HYDRATASE
    3e-04   6%  3dwaB  [x.x.x] SUBTILASE CYTOTOXIN, SUBUNIT B
    3e-04  10%  1chpD  [b.40.2] CHOLERA TOXIN B PENTAMER
    3e-04  12%  3bjiD  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    3e-04  16%  3bbpA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    4e-04  15%  121pA  [c.37.1 (1bkdR)] H-RAS P21 PROTEIN
    4e-04  11%  3defA  [x.x.x] T7I23.11 PROTEIN
    5e-04  11%  3ec1A  [x.x.x] YQEH GTPASE
    6e-04  13%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    0.001   7%  3batA  [x.x.x] MYOSIN HEAVY CHAIN, STRIATED MUSCLE/GENERAL
:635

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKHIIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPGHEKFIKN
2bvnA           --HVNVGTIGHVDHGKTTLTAAITTVLAKTYGGEKARGITINTSHVEYD-TPTRHYAHVDCPGHADYVKN
1efuA           --HVNVGTIGHVDHGKTTLTAAITTVLA------KTYGGTSHVEYDT----PTRHYAHVDCPGHADYVKN
2bvnB           -PHVNVGTIGHVDHGKTTLTAAIT---TVLAKTYGARGITINTSHVEYDTP-TRHYAHVDCPGHADYVKN
1d8tA           -PHVNVGTIGHVDHGKTTLTAAITFDQIDNAPEEKARGITINTSHVEYDTPTRHYA-HVDCPGHADYVKN
1efcA           -PHVNVGTIGHVDHGKTTLTAAITFDQIDNAPEEKARGITINTSHVEYDTP-TRHYAHVDCPGHADYVKN
1d8tB           -PHVNVGTIGHVDHGKTTLTAAITFDQIDNAPEEKARGITINTSHVEYD-TPTRHYAHVDCPGHADYVKN
1dg1G           -PHVNVGTIGHVDHGKTTLTAAITTVQIDNAPEEKARGITINTSHVEYDTP-TRHYAHVDCPGHADYVKN
1eftA           -PHVNVGTIGHVDHGKTTLTAALTYGDIDKAPEERARGITINTAHVEYETA-KRHYSHVDCPGHADYIKN
1aipA           --HVNVGTIGHVDHGKTTLTAALTYVTA-------AENPTAHVEYET----AKRHYSHVDCPGHADYIKN
1aipE           --HVNVGTIGHVDHGKTTLTAALTYVTA----AENPAHVEYETAKRHYS--------HVDCPGHADYIKN
1b23P           -PHVNVGTIGHVDHGKTTLTAALTYVAIDKAPEERARGITINTAHVEYETA-KRHYSHVDCPGHADYIKN
2c77A           -PHVNVGTIGHVDHGKTTLTAALTYGDIDKAPEERARGITINTAHVEYE-TAKRHYSHVDCPGHADYIKN
2d74A           -AEVNIGMVGHVDHGKTTLTKALTGDAEIRRCSNCGRYSTSPICPYCGHETEFIRRSFIDSPGHEALMTT
2ahoA           -PEVNIGVVGHVDHGKTTLVQAITGIWTSGMTIKLGYAETNIGVCESDEPKFLRRISFIDAPGHEVLMAT
2dcuA           -AEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRRGITIKIGFADAEIEFIRRVSFIDSPGHEALMTT
2c78A           --HVNVGTIGHVDHGKTTLTAALTYGDIDKAPEERARGITINTAHVEYETA-KRHYSHVDCPGHADYIKN
2b7cA           --HINVVVIGHVDSGKSTTTGHLIYKCGDKLKAERERGITIDIALWKFETP-KYQVTVIDAPGHRDFIKN
2dy1A           -MIRTVALVGHAGSGKTTLTEALLYKTTDYTPEAKLHRTTVRTGVAPLLFRGHRVF-LLDAPGYGDFVGE
3cw2B           -PEVNIGVVGHVDHGKTTLVQAITGCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMAT
1d2eA           -PHVNVGTIGHVDHGKTTLTAAITYEEIDNAPEERARGITINAAHVEYSTAARHYA-HTDCPGHADYVKN
2brvX           ----------------------------DTYTDRLDDWNGIIAGNQYY---------DSKNDQMAKLNQE
3dpuA           -RQYFQSIEEARSKGEALVHLQEIKVLIGGLNVVTKQAPNIKGLEND-DELKECLFHFWDFGGQEIMHAS
2byeA           ---------------------------------------------------QTHRVTVHGVPGPEPFTVF
3chuA           ---------------------------------------------------WPRRAAVVNKADILDEWAD
1eguA           ----------------------------DTYTDRLDDWNGIIAGNQYYDSKNDQMAKLNQELEGKVADSL
1c82A           ----------------------------DTYTDRLDDWNGIIAGNQYYDSKNDQMAKLNQELEGKVADSL
1eg7A           ANIAHGCNSIIATKTALKLADYVVTEAGFGADLGAEKFYDVKCRYAGFK------PDATVIV-ATVRALK
3bjqE           --------------------------------------------------------------GKKLF---
1cjtC           --------------------------VPSDQDLLRCRVLTSGIFETKFQVDKVNFH-MFDVGGQRDERRK
3chuB           ----------------------------RLVRAWPRRAVVNKA--------DILDEWADYDTLVPDYPLE
3a1tA           ---VKVALAGCPNVGKTSLFNALTGANWPGVTVEKKEGVFTYKGY---------TINLIDLPGTEKIARD
1aym1           --------------------------------ERYVDEVLNEVLVVPNINQSHP-----TTSNAAPVLDA
1egaA           -YCGFIAIVGRPNVGKSTLLNKLLGTSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHMEEKRAINRLMNK
3cb4D           --------------RNFSIIAHISTLSDR--IIQICGGQSVTLDYKASDGETYQLNFI-DTPGHVDFSYE
1culC           --------------------------VPSDQDLLRCRVLTSGIFETKFQVDKVNFH-MFDVGGQRDERRK
3a1uB           ---VKVALAGCPNVGKTSLFNALTGTKQYVANTEKKEGVFTYKGY---------TINLIDLPGDEKIARD
3a1vA           -----VALAGCPNVGKTSLFNALTG---TKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSSIDEK
1egaB           -YCGFIAIVGRPNVGKSTLLNKLLGITSRKAQTTRHRVGIHTEGAYQAIYVDTPGLHMEEKRAINRLMNK
3eg5B           KLLSALCILPQPEDMNERVLEAMTERAE---MDEVERFQPLLDGLKSGTSIALKVGCLQLINALDFRVHI
3bc1A           -YLIKFLALGDSGVGKTSVLYQYTDTVGIDFREKRVVYRANGP-DGAVGRGQRIHLQLWDTAGLERFRSL
3a1sA           --HVKVALAGCPNVGKTSLFNALT---GTKQYVANWPGVTVEKKEGVFT-YKGYTINLIDLPGTYSLGYS
1cf4A           MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPL
2dwqA           -----VGIVGLPNVGKSTLFNALTRANPLEDERLYALQRTFAKGERVPPVVP-THVEFVDIAGLEGLGNQ
1cs4C           ---------------------------------------------------------MFDVGGQRDERRK
2cjwA           MTYYRVVLIGEQGVGKSTLANIFAG---VHDSEVLGEDTYERTLMVDGESATIILLDMWE-NEWLHDHCM
3e1yE           ----------------------------------------------------------------------
3e20A           ----------------------------------------------------------------------
2cxxB           -----IIFAGRSNVGKSTLIYRLTGIEIEWKNHKIIDPGFGFGLPKEVQERIKDEIVHFIEDNAKNIDVA
1ds6A           MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPL
1an0B           -QTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYA----VTVIGGEPYTLGLFDTAGQEDYDRL
1eah1           -------------------------------------------------------------SKETPALTA
2dfkD           MQTIKCVVVGDGAVGKTLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLS
3dsnF           ----------------------------------------------------------------------
3d5bF           --------RRRGTASTKTRGEVAYSQKHTGRARHGDIGAPIFVGGGVVFGPKPRDY-SYTLPKKVRKKGL
3ea5C           FKLVLVG---DGGTGKTTFVKRHLT-GEFEKKYVATLGVEVHPLVFHTNRGPIKFNVW-DTAGQEKFGGL
1ecrA           -KLLVARVFSLPEVKKEDEHNPLDAQSLALRHFRHLFIQQQSENRSSKAALPGVLCYQVDNLSQAALVSH
1cjuC           -------------------------YVPSDQDLLRCRVLTSGIFETKFQVDKVNFH-MFDVGGQRDERRK
3bb4A           -----VGFQQFPAATQEKLIEFFGKLKQKDMNIGEQVVRVSPFLRPVMVSRTMGTINIIDTPGLVEAGYV
1a4rA           MQTIKCVVVGDVAVGKTCLLISYTTNKFP---SEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRL
1aztB           -NEYQLIDCAQYFLDKIDVIKQDD-YVPSDQDLLRCRVLTSGIFETKFQ-VDKVNFHMFDVGGQRDERRK
3degC           -NIRNFSIIAHIDHGKSTLSDRIIQMDLERERGITIKAQSVTLDYKASDGETYQLNFIDTPGHVDFS-YE
3a1vB           -----VALAGCPNVGKTSLFNALTGTKQ----YVANWPGVTVEKKEVF-TYKGYTINLIDLPGTYSLGYS
1ahjB           EGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYFAA
2a5fA           -KEMRILMLGLDAAGKTTILYKLK-LGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQ-DKIRPLWRHYY
3c14C           ---------------------------------------------------------MFDVGGQRDERRK
1cc0A           -----LVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPL
2dfkB           MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVF---DNYAVTVMIGGEPYTLGLFDTAGQEDYDRL
3eg5A           MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL
2bv3A           -RLRNIGIAAHIDAGKT----TTTERILYYTGRIHKRGI-TITAAVTTCFWKDHRINIIDAPGHVDFTIE
3bh6A           VRILLLG---LDNAGKTTLLKQLASEDISH--ITPTQGFNIKSVQSQGFKLNVWDIGGLRKIRPYWRSYF
2dykA           -----VVIVGRPNVGKSSLFNRLLK------KRSDLKEGVVETDRGRFLL-VDTGGLWSGDKWEKKIQEK
3bb3A           -EKLIEFFGKLKQKDMNSMTVLVLGSSTVNSLIGEQVVRVSPFGLRPVMVDTPGLVEAGYVNHQALELIK
2cxxC           -----IIFAGRSNVGKSTLIYRLTGKKVRGVTRKIIDPGFGFGLPKEVQERIKDEIVHFIEDNAKNIDVA
3c15C           ---------------------------------------------------------MFDVGGQRDERRK
2ahjD           ELESLAGGPFPLSRPSESEGRPAPVETTTFPGHIRMPAYCRGRVGTISHRT-TEKWPFPDAIGHGRNFAA
3dosF           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1ceeA           MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL
1d5cA           YKLVFLG---EQAVGKTSIITRFYD---TFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQERFRSL
3a1sB           -LHVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKG----YTINLIDLPGTYSLGYS
2aseA           MQTIKCVVVGDGAVGKTCLLISYTTNKLP---SEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRL
1a2kD           FKLVLVG---DGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFN--VWDTAGQEKFGGL
1an0A           -QTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVIGGEPYTLGLFDTAGQEDYDRLRPLS
1ajeA           MQTIKCVVVGDGAVGKTCLLISYTTNKFP---SEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYPLS
3e5hA           MRQLKIVVLGDGASGKTSLTTCFAQETQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKY
3bc1E           IKFLALG---DSGVGKTSVLYQYTDGKKFITTVGIDFREKRVVYRAGQRIHLQLWDTAGLERFRSLTTAF
1a2kC           -VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP--LVFHTNRGPIKFNVWDTAGQEKFGGL
3dsnC           ----------------------------------------------------------------------
3dosC           ----------------------------------------------------------------------
1byuA           -----LVLVGDGGTGKT----TFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIKFNVTAGQEKFGGL
3bfkB           FKIVLIG---DSGVGKSNLLSRFTRDEESKSTIGVEFATKSIQLKNNKIIKAQIWDTAGQERYRAITSAY
3bh7A           VRILLLG---LDNAGKTTLLKQLASEDISH--ITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYF
1eg7B           -----------------------------------------------------KCRYAGFKPDATVIVAT
1e96A           -QAIKCVVVGDGAVGKTCLLISYTTNAFPG---EYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYRPL
1cxzA           -IRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPL
1byuB           -VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNGPIKFNVWDTAGQEKFGGLRDG
3efxD           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
2a5dA           -KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG
2e87A           LEIPTVVIAGHPNVGKSTLLKALTTTTRGINVGQFEDGYFRYQIIDTPGLLDRPISERNEIEKQAILALR
2bkuA           FKLVLVG---DGGTGKTTFVKRHLTGEFE---KKYVPTLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGG
2bmeC           -FLFKFLVIGNAGTGKSCLLHQFIE--KKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSV
2bmjA           IPELRLGVLGDARSGKSSLIHRFLTGSYQ----VLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFS
3dsnE           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cluA           MTEYKLVVVGAPGVGKSALTIQLIQNHFV----DEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYM
1cjvC           -------------------------YVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDV-GGQRDERRK
3dwaA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2e1rA           -NVRNMSVIAHVDHGKSTLTDSLVQKSTAISLYSEMSDEDVKEIKQKTDGNSFLIN-LIDSPGHVDFSSE
1a4xB           -------------------------VTVGEIDITLYDEPLVKGADIPVDITDQKVILVDDVGRTVRAGMD
3dwaE           ----------------------------------------------------------------------
3dwaC           ----------------------------------------------------------------------
3doeA           -RELRLLMLGLDNAGKTTILKKFNGEDI---DTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNY
3ea5A           -VQFKLVLVGDGGTGKTTFVKRHLTGEFEK---KYVATLGVEVHPLVFHTNRGPIKFNWDTAGQEKFGGL
2c5lA           MTEYKLVVVGAVGVGKSALTIQLIQ---NHFVDE-YDPTIEDSYRKQVIDGETCLLDILDTAGQEEYSAM
3ddcA           MTEYKLVVVGAGGVGKSALTIQLI--QNHFVEKYDPTIEDSYRKQVVID-GETCLLDILDTAGQEEYSAM
3a1uA           -----VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLLPGTYSLGYSSIDEKI
3cwzA           FKLVFLG---EQSVGKTSLITRFMY---DSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTALERFRSL
521pA           MTEYKLVVVGAVGVGKSALTIQLIQ---NHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTTGQEEYSAM
2crvA           ----------------------------------------------------------------------
1a2kE           FKLVLVG---DGGTGKTTFVKRH--LTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGL
1dpfA           -IRKKLVIVGDVACGKTCLLIVFSKDQFPAVYVPTVFENYV---ADIEVDGKQVELALWDTAGQEDYDRA
621pA           MTEYKLVVVGAGGVGKSALTIQLIQ--NHFVDEYDPTIEDSYRKQVVID-GETCLLDILDTAGHEEYSAM
2ahjB           ---PAPVETTTFEVGQRVRVRDEYVPGHIR-----MPAYCRGRVGTISHRTT-EKWPFPDAIGHGRNFAA
3dwaB           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
3bjiD           IKCVVVG---DGAVGKTCLLISYTTNAFPGYIPTVFDNYSANVMKPVNLGLWDTAGQEDYDRLRPLSYPQ
3bbpA           -KLVFLG---EQSVGKTSLITRFMYDSFD-NTYQATIGIDFLSKTMYLEDRTVRLQLWDT-AGLERFRSL
121pA           MTEYKLVVVGAGGVGKSALTIQLIQ---NHFVDE-YDPTIEDSYRKQVVIGETCLLDILDTAGQEEYSAM
3defA           --------------GKSSTVNSLIG---EQVVRVSPFQAGLRPVMVSRTMG-GFTINIIDTPGLVEAGYV
3ec1A           ----------------------------------------------------------------DDFLSM
3bb1A           -NSLTILVMGKGGVGKSSTVNSIIGERVVQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNII
3batA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKIDMVDEEWLSLVTEEIREYLKDTV
2bvnA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDEELLELVEMEVRELLSDFP
1efuA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDEELLELVEMEVRELLSDFP
2bvnB           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDEELLELVEMEVRELLPIVR
1d8tA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDEELLELVEMEVRELLPIVR
1efcA           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDEELLELVEMEVRELLPIVR
1d8tB           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDEELLELVEMEVRELLPIVR
1dg1G           MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDEELLELVEMEVRELLPIVR
1eftA           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPE--LLDLVEMEVRDLLN
1aipA           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDPELLDLVEMEVRDLLNEFP
1aipE           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPE--LLDLVEMEVRDLLN
1b23P           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPE--LLDLVEMEVRDLLN
2c77A           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPE--LLDLVEMEVRDLLN
2d74A           MLAGASLMDGAILVIAANEPCPRPTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTV
2ahoA           MLSGAALMDGAILVVAANEPFPQPQREHFVALGIIGVKNLIIVQNKVDVVSKEEA-----LSQYRQIKQF
2dcuA           MLAGASLMDGAILVIAANEPCPRPTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTV
2c78A           MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMDPELLDLVEMEVRDLLNQYEF
2b7cA           MITGTSQADCAILIIAGGVGEFEAGIEHALLAFTLGVRQLIVAVNKMDSVKESRFQEIVKETSNFIKGYN
2dy1A           IRGALEAADAALVAVSAEAGVQVGTERAWTVAERLGLPR-MVVVTKLDKGGDYYALLEDLRSTLGPIL--
3cw2B           MLSGAALMDGAILVVAANEPFPQQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTW
1d2eA           MITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQSEMVELVELEIRELLFGYK
2brvX           LEGKVADSLSSILWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRYYQDETVV-RTVRDSMEWMHKHVY
3dpuA           HQFFMTRSSVYMLLLDSRTDSNKHY-WLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENR
2byeA           TINGGTKAKQLLQQILTNEQDIKPVTTD----YFLMEEKYFISKEKNECRKQPFQRAIGPILSSWFPEEG
3chuA           YDTLVPDYPLEIVEHPLFLAAEPHQRQRVLTGMWIGYNERVIATEQLIAEPAFDLVMHGVFPGS------
1eguA           S-----SISSQADRIYLWEKFSNYKTSANLTATYRKLEEMAKQTNPSSRYDETVVRTVRDSMEWMHKHV-
1c82A           SSI-----SSQADRIYLWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRDETVVRTVRDSMEWMHK---
1eg7A           MHGGVPKSDLATENLEALREGFANLEKHIENIGKFGVPA-VVAINAFPTDTEAELNLLYELCAKA-----
3bjqE           PVAPVAQYGGKILTFGKEAFRLYNTKRAPRIDFGYEGDPYSIVPSALEAKVPRELRDASQVPGIDLGAR-
1cjtC           WIQCFNDVTAIIFVVASSSYNMVIRFKSIWNNRWLRTISVILFLNKQDLLAEKVL-AGKSKIEDYFPE--
3chuB           IVPF--------AEHPLFLAAEPHQRQRVLTGMWIGYNERVIATEQLIAEPAFDLVMHGVFPGS------
3a1tA           YLL-KGDADLVILVA---DSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKH-----
1aym1           AETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGR-SGCIHESVLDI-VDNYNDQSFTKWNINLQEMA
1egaA           AASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPV-ILAVNKVDNVQEKADLLPHLQFLASQMNF-
3cb4D           VSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEV-VPVLNKIDLPAAD----PERVAEEIEDIVG
1culC           WIQCFNDVTAIIFVVASSSYNMVILFKSIWNNRWLRTISVILFLNKQDLLAEKV-LAGKSKIEDYFPEFA
3a1uB           YLL-KGDADLVILVA---DSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHL----
3a1vA           IARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHL----
1egaB           AASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPV-ILAVNKVDNVQEKADLLPHLQFLASQMN--
3eg5B           RSELLGLHQVLQELREIENEDMKVQEQGDEDFFDLKGRLDDIRMEMDDFGEVF------QIILNTVK---
3bc1A           TTAFFRDAMGFLLLFDLTNEQSFLNVRNWQLQMHAYSENPDIVLCGNKSDLEDQRAVKEEEARELAEK--
3a1sA           SIDEKIARDYLLKGDADLVILSVNPEQSLYLLLEILEEKKVILATAIDEAKKTGKIDRYELQKHLGI---
1cf4A           SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPLARD
2dwqA           FLAHIREVAAIAHVLRCFPDPDPLEDAEVVETELLTLERRLERLRKEARADRERLPLLEEGLYVHLQEG-
1cs4C           WIQCFNDVTAIIFVVASSSYNMVIREDNNLFKSIWNNRWLILFLNKQDLLAEKVLA-GKSKIEDYFPEFA
2cjwA           QVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPI-ILVGNKSDLVRRE-----VSVSEGRAAV--
3e1yE           ----------------------------------------------------------------------
3e20A           ----------------------------------------------------------------------
2cxxB           VLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPT-IVAVNKLDKIKNVQEVINFLAEKFEVPLSE
1ds6A           SYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLLALAKE
1an0B           RPLSYPQTDVFLVCFSVVSPSSFTHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARD
1eah1           VETGATNPLVPSDTVQTRHVIQKRTRSESTVESFFA-RGACVAIIEVDNDSSVWKVQLRRKLEFFTYSRF
2dfkD           YPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPF-LLVGTQIDLRDDPSTIEKLAKNKQKPITPE
3dsnF           ----------------------------------------------------------------------
3d5bF           AMAVARAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNRAARNLPWVVTLAPEGLNDIV
3ea5C           RDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLNKVDIKDRK----VKAKSIVFHRK--
1ecrA           IQHINKLKTTFEHIVTVESELPTAAHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHDEVLAQLE
1cjuC           WIQCFNDVTAIIFVVASSSYNMVILFKSIWNNRWLRTISVILFLNKQDL-LAEKVLAGKSKIEDYFPE--
3bb4A           GFLVNRTIDVLLYVDRLDVYRVDELDKITQTFGKEIWCKTLLVLTHAQF-SPPDELSYETFSSKRSDRKQ
1a4rA           RPLSYPQTDVFLVSVVSPSSFENVKEKWVPEITHHCPKTPFLVGTQIDLRDDPSTIEKLAKNKQKPLARD
1aztB           WIQCFNDVTAIIFVVASSSYNMVILFKSIWNNRWLRTISVILFLNKQDLLAEKVLA-GKSKIEDYFPE--
3degC           VSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEV-VPVLNKIDLPAAD----PERVAEEIEDIVG
3a1vB           SIRDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTKKTGMKID---------RYELQK--
1ahjB           EELFGSDTDGGSVVVDLFEGYLPAA---------------------------------------------
2a5fA           TGTQGLIFVVDCADRDRIDEARQELHRIINDR-EMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIR--
3c14C           WIQCFNDVTAIIFVVASSSYNMVIREDNLFKSIWNNRWLRILFLNKQDLLAEKVLAGK-SKIEDYFPE--
1cc0A           SYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAPEEGRDMANR
2dfkB           RPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPI
3eg5A           SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQEKLARD
2bv3A           VERSMRVLDGAIVVFDSSQGVEPQSETVW----RQAEKYKVPRIAFANKMDKTGADLW--LVIRTMQERL
3bh6A           ENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPV-LIFANKQDLLTAAPASEIAEGLNLHTIRD-
2dykA           VDRALEDAEVVLFAVDGRAELTQAD-YEVAEYLRRKGKPVILVATKVDDPKH----------ELYLGPLY
3bb3A           GFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAGKEIWCKTLLVLTHAQFSPPDELS-YETFSSKRS----
2cxxC           VLVVDGKAAPEIIKRWEKRGEIPI-DVEFYQFLRELDIPTIVAVNKLDKIKNVQEVINFLAEKFEVPLSE
3c15C           WIQCFNDVTAIIFVVASSSYNMVILFKSIWNNRWLRTISVILFLNKQDL-LAEKVLAGKSKIEDYFPE--
2ahjD           EELFGSDTDGGSVVVDLFEGYLEP----------------------------------------------
3dosF           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1ceeA           SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE
1d5cA           IPSYIRDSAAAIVVYDITNRQSFENTTKWILNERGKDVIIALVGNKTDLGDLRKVT--YEEGQKAQEY--
3a1sB           SIDEKIARDYADLVILVADSVNPEQSLYL-LLEILEEKK-VILATAIDEAKKTGK-IDRYELQKHL----
2aseA           RPLSYPQTDVFLVCFSVVVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDL
1a2kD           RDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIVLCGNKVDIKDRKVKAKSIVFHRKK-----
1an0A           YPQTDVFLVCFSVVSPSSFENVKEKWVPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARD
1ajeA           YPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPF-LLVGTQIDLRDDPSTIEKLAKNKQKPITPE
3e5hA           IYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQE--
3bc1E           FRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYSENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGI-
1a2kC           RDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIVLCGNKVDIKDRKV-------KAKSIVFHR
3dsnC           ----------------------------------------------------------------------
3dosC           ----------------------------------------------------------------------
1byuA           RDGYYIQAQCAIIMFDVTSRVTYKNNWHRDLVRVCENIPIVLCGNKVDIKDR-------KVKAKSIVFHR
3bfkB           YRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNIVILLVGNKSDLKHLRV---INDNDATQYAKK--
3bh7A           ENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPV-LIFANKQDLLTAAPASEIAEGLNLHTIRD-
1eg7B           MHGGVPKSDLATENLEALREGFANLEKHIENIGKFGVPA-VVAINAFPTDTEAELNLLYELCAKA-----
1e96A           SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYE
1cxzA           SYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAPEEGRDMANR
1byuB           YYIQAQCAIIMFDVTSRVTYKNVPNW-HRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK-----
3efxD           --APQNITELCSEHNTQIYTINDKILSYTESLAGKRE---MAIITFKNGATFQV---EVPGQKKAIER--
3dosE           -----------------------------------------------------------TVTATLVEPAR
2a5dA           TQGLIFVVDCA--DRDRIDEARQELHRIINDREMRDAIILIFA-NKQDLPDAMKPH--EIQEKLGLTRIR
2e87A           YLGNLIIYIFDPSEHCGFPLEEQI-HLFEEVHGEFKDLPFLVVINKIDVADEENIKRLEKFVKEK-----
2bkuA           LDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKK-----
2bmeC           TRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQ--
2bmjA           GWADAVIFVFSLEDENSFQAV---SRLHGQ-LSSLRGRGGLLVGTQDRISASSPRVVGDAR--ARALCAD
3dsnE           ----------------------------------------------------------------------
3cqgB           -------------------------------------FSEDMLQEKIEEMQERFLLHQETLPEQLLAQLN
1cluA           RTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPM-VLVGNKCDLAART----VESRQAQDLAR--
1cjvC           WIQCFNDVTAIIFVVASSSYNMVIREKSIWNNRWLRTISVILFLNKQDLLAEKVLA-GKSKIEDYFPE--
3dwaA           ---------------------------------------------EWTGDARDGFS---GVVITQFH--T
3dpbB           ----------------------------------------------------------------------
2e1rA           VTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKP-VVVINKVDRALLE----LQVSKEDLYQ---
1a4xB           ALVDVGRPSSIQLAVLVDRGHRELPI--------------RADYIGKNIPTSKSE-KVMVQLDEVDQNDL
3dwaE           ---------------------------------------------EWTGDARDGFS---GVVITQFH--T
3dwaC           ---------------------------------------------EWTGDARDGFS---GVVITQFH--T
3doeA           FESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRS-
3ea5A           RDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPLCGNKVDIKDRK----VKAKSIVFHR---
2c5lA           RDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVDDVPMVLVGNKCDLAART---VESRQAQ--DLAR
3ddcA           RDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR--
3a1uA           ARDYLLKGDADLVILVADSVNPEQSLYLLLEIL-EMEKKVILAMTAIDEAKKTGMKIDRYELQKHL----
3cwzA           IPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGE--RKAK
521pA           RDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR--
2crvA           ----------------------------------------------------------------------
1a2kE           RDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIVLCGNKVDIKDR-------KVKAKSIVFHR
1dpfA           RPLSYPDTDVILMCFSIDSPDSVKHFCPNVPIILVGNKKDLRNDEHTARELAKMKQEPVKPAEGRDMANR
621pA           RDQYMRTGEGFLCVFAINNTKSFEDIHQYRKRVKDSDDVPMVLVGNKCDLAART---VESRQAQDLAR--
2ahjB           EELFGSDTDGGSVVVDLFEGY-------------------------------------------------
3dwaB           ---------------------------------------------EWTGDARDGFS---GVVITQFH--T
1chpD           -------TDLCAEYHNTQIHTLND--KIFSYTESLADKREMAIITFKNGATFQVEVPGSQHIDSQKKAI-
3bjiD           TDVFLICFS-----LVSPASFENVRAKWYPEVRHHCPNTPIIVGTKLDLRDDKKEKKLTPITYPQGLAMA
3bbpA           IPSYIRDSTVAVVVYDITNVNSFQKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNV-
121pA           RDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDMVLVGNKCDLAART---VESRQAQDLAR--
3defA           NHQALELIKGFLVNRTIDVLLYAVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSY--ETFS
3ec1A           LHRIGESKALVVNIVDIFDFNGSF---IPGLPRFAADNPILLVGNKADLLPRSV----------------
3bb1A           KSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKIVALTHAQFSPDEFFSKRSEALLQVVRSGA
3batA           ----------------------------------------LKQMDKMKEDLAKTERIKKELEEQNVTLLE


                         +         .         .         .         .         *         .:210
query           LSEAPVVPVSSTTKQGIPQLLDLIDQFVDDTEERNSSGKLRLPIDRXXXXXXXXXXXXXXXXXXRVSTGD
2bvnA           GDDTPIVRGSALKALEGDAEWEAKILELIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGE
1efuA           GDDTPIVRGSALKALEGDAEWEAKILELAGFPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGE
2bvnB           GSALKALEGDAEWEAKILELAGFLDSYIPEP-ERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGE
1d8tA           GSALKALEGDAEWEAKILELAGFLDSYI-PEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGE
1efcA           GSALKALEGDAEWEAKILELAGFLDSYI-PEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGE
1d8tB           GSALKALEGDAEWEAKILELAGFLDSYI-PEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGE
1dg1G           GSALKALEGDAEWEAKILELAGFLDSYIPEP-ERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGE
1eftA           QYEFPVIRGSALLALEEMHKNPKTKRGENEWVDRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1aipA           GDEVPVIRGSALLALEQMHRNPKTRRGENEWVDRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1aipE           QYEFPVIRGSALLALEQMHRNPKTRRGENEWVDRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
1b23P           QYEFPEMHKNPKTKRGIWELLDAIDEY-IPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
2c77A           QYEFPVIRGSALLALEQMHRNPKTRRGENEWVDKIWELLDLMPVEDVFTITGRGTVATGRIERGKVKVGD
2d74A           AENAPIIPISALHGANIDVLVKAIEEFIPTPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGD
2ahoA           TKGTWAENVPIIPVSALHKINIDSLIEGIEEYVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQ
2dcuA           AENAPIIPISALHGANIDVLVKAIEEFIPTPKRDLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGD
2c78A           GDEVPVIRGSALLALEQMHRNPKTRRGENEWVDRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGD
2b7cA           PKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKRLPLQDVYKIGGIGTVPVGRVETGVIKPGM
2dy1A           --PIDLPLYEGGKWVGLIDVFHGKAYRYENGEEREA----------------------------------
3cw2B           AENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQ
1d2eA           GEETPIIVGSALCALEQRDPELGLKDAVDTVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGD
2brvX           NSEKSIVGNWWDYEIGTPRAINNTLSLMKE-YFSDEEIKKYTDVIEKFVPDPEHFRKTTDNPFKALGGNG
3dpuA           FHRISCVESIAKSLKSAVLHPDSIVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLG
2byeA           YMGRIVLKTQ------------------------------------------------------------
3chuA           --DDPLIRKSVQQAIVDESFHTYMHMLAIDRTRELRKIPELVTYRRLRRVLADMPEQWERDIAVLVWGAV
1eguA           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
1eg7A           --GAEVALSWAKGGEGGLELARKVLQTLESRPSN------------------------------------
3bjqE           SVNTVLRIALAHEHECAQIALDPAKSARWTSPDSDPTKDVETAKEAIADSIGEPNRLLSRKALSACKYHP
1cjtC           -FARYTTPEDATPEPGEDFIRDEFLRISTADGRHYCYPHFTCAVDT------------------------
3chuB           --DDPLIRKSVQQAIVDESFHTYMHMLAIDRTRELRKIPELVTYRRLRRVLADMPEQWERDIAVLVWGAV
3a1tA           -LGIPVVFTSSVTGEGLEELKEKIVEY-------------------------------------------
1aym1           DSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDD-------------------------------
1egaA           ---LDIVPISAETGLNVDTIAAIVRKH-LPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSV
3cb4D           IDATDAVRCSAKTGVGVQDVLERL---VRDPPEGDPEGPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGD
1culC           R---YTTPEDATPEPGEDP---------------------------------------------------
3a1uB           --GIPVVFTSSVTGEGLEELKEKIVEYA------------------------------------------
3a1vA           --GIPVVFTSSVTGEGLEELKEKI----------------------------------------------
1egaB           --FLDIVPISAETGLNVDTIAAVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTV
3eg5B           DSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEE------------------------------------
3bc1A           -YGIPYFETSAANGTNISHAIEMLLDLIMKRMERS-----------------------------------
3a1sA           ----PVVFTSSVTGEGLEELKE------------------------------------------------
1cf4A           LKAVKYVECSALTQKGLKNVFDEAILAALEPPEP------------------------------------
2dwqA           ----------------------------------------------------------------------
1cs4C           R---YTTPEDATPEPGIRDEFLRISTAS-GDGRHYCYPHFTCAVDT------------------------
2cjwA           -VFDKFIETSAAVQHNVKELFEGI----------------------------------------------
3e1yE           -----------------------------------------------------------------ICKGQ
3e20A           -----------------------------------------------------------------IKKNS
2cxxB           I-DKVFIPISAKFGDNIERLKNRIFEVI------------------------------------------
1ds6A           IDSVKYLECSALTQRGLKTVFDEAIRAV------------------------------------------
1an0B           LKAVKYVECSALTQKGLKNVFDEAILAALEEPKK------------------------------------
1eah1           DMEFTFVVTSNYT---------------------------------------------------------
2dfkD           LKAVKYVECSALTQKGLKNVFDEAILAALEPSRRCV----------------------------------
3dsnF           -------------------------------------------------------------------NGD
3d5bF           RTERLVMDLD--AWEVFQNRI-------------------------------------------------
3ea5C           -KNLQYYDISAKSNYNFEKPFLWL----------------------------------------------
1ecrA           KSLKSPRSVAPWTREEWQRKLEREYQDIAALPQPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGA
1cjuC           -FARYTTPEDATPEPGEDPRVTRAKYFI------------------------------------------
3bb4A           EFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAW------------------------------------
1a4rA           LKAVKYVECSALTQKGLKNVFDEAILAALEPEPKKSRR--------------------------------
1aztB           -FARYTTPEDATPEPGEDPRVTRAKYFIRDEFLR------------------------------------
3degC           IDATDAVRCSAKTGVGVQDVLERL---VRDPPEGDPEGPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGD
3a1vB           HLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTILH-----------------------------------
1ahjB           ----------------------------------------------------------------------
2a5fA           DRNWYVQPSCATSGDGLYEGLTLTSNY-------------------------------------------
3c14C           -FARYTTPEDATPEPGEDPRVTRAKYFI------------------------------------------
1cc0A           IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSG-------------------------------
2dfkB           LKAVKYVECSALTQKGLKNVFDEAILAALEPKSR------------------------------------
3eg5A           LKAVKYVECSALTQRGLKNVFDEAILAA------------------------------------------
2bv3A           GARPVVMQLPIGREDTFSGIIDVLRMKAYTYGND------------------------------------
3bh6A           -RVWQIQSCSALTGEGVQDGMNWV----------------------------------------------
2dykA           LGFGDPIPTSSEHARGLEELLEAI----------------------------------------------
3bb3A           ----DSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKN-----------------------------
2cxxC           I-DKVFIPISAKFGDNIERLKNRIFEVI------------------------------------------
3c15C           -FARYTTPEDATPEPGEDPRVTRAKYFIRDEFRHYCYPHFTCAVDT------------------------
2ahjD           ----------------------------------------------------------------------
3dosF           -------------------------------------------------------------------NGD
1d1nA           ----------------------------------------------------------------KITRDS
1ceeA           LKAVKYVECSALTQKGLKNVFDEAILAA------------------------------------------
1d5cA           ---NTFHETSAKAGHNIKVLFKKT----------------------------------------------
3a1sB           --GIPVVFTSSVTGEGLEELKEKIVEYA------------------------------------------
2aseA           K-AVKYVECSALTQKGLKNVFDEA----------------------------------------------
1a2kD           --NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPE------------------------
1an0A           LKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRR-------------------------------
1ajeA           TAEVKYVECSALTQKGLKNVFDEAILAALEPPEP------------------------------------
3e5hA           -NGFSSHFVSAKTGDSVFLCFQKVAAEI------------------------------------------
3bc1E           ----PYFETSAANGTNISHAIEMLLDLIMKRMER------------------------------------
1a2kC           KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPE------------------------
3dsnC           -------------------FTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDIS-------PKVNGD
3dosC           ----------------------------------------------------------------ENLVGD
1byuA           KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPE------------------------
3bfkB           -EKLAFIETSALEATNVELAFHQLLNEIYNVRQKKQATK-------------------------------
3bh7A           -RVWQIQSCSALTGEGVQDGMNWV----------------------------------------------
1eg7B           --GAEVALSWAKGGEGGLELARKVLQTLESVLYNLDLSIKDKIAKIATEIYGADGVNYTAEADKAIQRYE
1e96A           IGAVKYLECSALTQRGLKTVFDEA----------------------------------------------
1cxzA           IGAFGYMECSAKTKDGVREVFEMATR--------------------------------------------
1byuB           --NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPE------------------------
3efxD           --MKDTLRIAYLTEAKVEKLCVWNNKTPN-----------------------------------------
3dosE           ITLTYKAPITIMDNGNIDTFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLV--GD
2a5dA           DRNWYVQPSCATSGDGLYEGLTWLTSNY------------------------------------------
2e87A           --GLNPIKISALKGTGIDLVKEEIIKTLRPLAEKVAREKIERELRR------------------------
2bkuA           --NLQYYDISAKSNYNFEKPFLWL----------------------------------------------
2bmeC           ENELMFLETSALTGENVEEAFVQCARKI------------------------------------------
2bmjA           MKRCSYYETCATYGLNVDRVFQEV---AQKVVTLRKQQQL------------------------------
3dsnE           -------------------FTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVG--D
3cqgB           LSAMPVLTAPQLIGLYIKKALDLLEYIDENINDLKLEIL-CKALQRDNWVSKDSIFVKILLPEVKDLLQA
1cluA           SYGIPYIETSAKTRQGVEDAFYTL----------------------------------------------
1cjvC           -FARYTTPEDATPEPGEDPRVTRAKYFIRDEFLR------------------------------------
3dwaA           GQIDNKPYFCIEGKQSAGSSISACSKN-------------------------------------------
3dpbB           --------------------------------------------------------------------GD
2e1rA           ----------------------------------------------------------------------
1a4xB           VA--------------------------------------------------------------------
3dwaE           GQIDNKPYFCIEGKQSAGSSISACSKN-------------------------------------------
3dwaC           GQIDNKPYFCIEGKQSAGSSISACSK--------------------------------------------
3doeA           -HHWCIQGCSAVTGENLLPGIDWLLDDISFTADLE-----------------------------------
3ea5A           KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPN-------------------------------------
2c5lA           SYGIPYIETSAKTRQGVEDAFYTL----------------------------------------------
3ddcA           SYGIPYIETSAKTRQGVEDAFYTL----------------------------------------------
3a1uA           --GIPVVFTSSVTGEGLEELKEKIVEYAQKNTIR------------------------------------
3cwzA           ELNVMFIETSAKAGYNVKQLFRRV----------------------------------------------
521pA           SYGIPYIETSAKTRQGVEDAFYTL----------------------------------------------
2crvA           --------------------------------------------------------------------HK
1a2kE           KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPAL----------------------------
1dpfA           IGAFGYMECSAKTKDGVREVFEMA----------------------------------------------
621pA           SYGIPYIETSAKTRQGVEDAFYTL----------------------------------------------
2ahjB           ----------------------------------------------------------------------
3dwaB           GQIDNKPYFCIEGKQSAGSSISACSKN-------------------------------------------
1chpD           ERMKDTLRIAYLTEAKVEKLCVWNNKTPH-----------------------------------------
3bjiD           IGAVKYLECSALTQRGLKTVFDEA----------------------------------------------
3bbpA           ----MFIETSAKAGYNVKQLFRRV----------------------------------------------
121pA           SYGIPYIETSAKTRQGVEDAFYTL----------------------------------------------
3defA           SKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAEN------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1A           KSDIPVVLIENSGRCNKNDSDEKV----------------------------------------------
3batA           --QKNDLFGSMKQLEDKVEELSKNYHLENEVAR------LKKLVGE------------------------


                         .         .         .         +         .         .         .:280
query           TVEIMPLGTVSRVRSIQVHGKKVEQARAGQRTAVNIIGVEVEEVKRGSVLVTPNSVEPSHRMDVKFLLLE
2bvnA           EVEIVGITQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1efuA           EVEIVGITQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILG
2bvnB           EVEIVGITQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1d8tA           EVEIVGITQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1efcA           EVEIVGITQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1d8tB           EVEIVGITQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILS
1dg1G           EVEIVGITQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESESKDEG
1eftA           EVEIVGLAPETRKTVVTGHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
1aipA           EVEIVGLARRTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKTPHTKFEASVYVLKKEEG
1aipE           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
1b23P           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLAKPGSITPHTKFEASVYILK
2c77A           EVEIVGLARKTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLK
2d74A           EIEIRPGVPYEEHGRIQAGGQFVEEAYPGGLVGIGDPYLTKGDLMAGNVVGKPGKLPPWTDLRLEVHLLE
2ahoA           EIKVLPGLRVVSYEPIFTKDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVLWNIRIKYLE
2dcuA           EIEIRPGVPYEEHVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGPPVWTDLRLHLLE
2c78A           EVEIVGLAPETRVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLG
2b7cA           VVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIV
2dy1A           ----------------------------------------------------------------------
3cw2B           EIKVLPGLRVEKQSSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKY
1d2eA           ECEFLGHSKNIRVTGIEMFHKSLDRAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILT
2brvX           LLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQK------
3dpuA           IVLYFALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEKTYTLLEQRYLLDIMKQFEL
2byeA           ----------------------------------------------------------------------
3chuA           AETCINALLALLARDATIQPMHSLITTLHLRDETAHGSIVVEVVR-------------------------
1eguA           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
3bjqE           KLIERVKYTRAESITIDLALWEVEEIVVGTA--RVATDSFGDVWGPDVWLGYVSDNPD------------
1cjtC           ----------------------------------------------------------------------
3chuB           AETCINALLALLARDAITTLHLRDETAHGSIVVEVVRELYARMNEQQRRALVRLLELNAAGIRGAEEIVG
3a1tA           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
1egaA           TVEIERFVSNERGGGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFAPVHLELWVKVKSGW----
3cb4D           KVKVMSTGQTYNADRLGIKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNPAEKALPGFKK----
1culC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1egaB           EIERFVSRGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFAPVHLELWVKVKSGWA---
3eg5B           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3e1yE           QLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVII
3e20A           NVLVMPINQTLEVTAIYDADEEISSSICGDQVRLRVRGDD-SDVQTGYVLTTKNPVHATTRFIAQIAILE
2cxxB           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
1eah1           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3dsnF           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
3d5bF           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1ecrA           GVPDVGELLNYDADNVQPQAQPLRLIIPR-----------------------------------------
1cjuC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
3degC           KVKVMSTGNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNPAEKALPGFKK----
3a1vB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3dosF           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
1d1nA           KVRLIRQGIVVYIDSLKRYKDDVREVAQGYECGLTIKN--FNDIKEGDVIEAYVMQE-------------
1ceeA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dsnC           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
3dosC           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
1byuA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1eg7B           SLGYGNLPVVMAKTQYSFS--DDMTKLGRPRNFTITVREVRLSAGGRLIVPITGA---------------
1e96A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
3dosE           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
2a5dA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
3dsnE           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
3cqgB           DFEFVKANYEYYVQ--------------------------------------------------------
1cluA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dwaA           ----------------------------------------------------------------------
3dpbB           DVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTV----------------------------------
2e1rA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
3dwaE           ----------------------------------------------------------------------
3dwaC           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
2crvA           KFKLIRNGQVIWLTSLKHHKDDISVIKTGMDCGLSLDEE-KVEFKPGDQVICYEENK-------------
1a2kE           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3dwaB           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SAEKPLKNRARVRLYLGTDEILGRVRLLDREEIEPNQEAYVQLELEERGIAGKGDRFVIRSYSPMRTIGG
2bvnA           KDETPFFKGYRPQFYFRTTDVTGTILPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1efuA           GRHTPFFKGYRPQFYFRTTDVTGTIELPEGVMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
2bvnB           KDEGGFFKGYRPQFYFRTTDVTGTIELEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1d8tA           KDEGGFFKGYRPQFYFRTTDVTGTILPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1efcA           GRHTPFFKGYRPQFYFRTTDVTGTIELPGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1d8tB           KDETPFFKGYRPQFYFRTTDVTGTILPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1dg1G           GRHTPFFKGYRPQFYFRTTDVTGTIELPEGVMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGG--RTVGA
1eftA           KEEGGRSGYRPQFYFRTTDVTGVVRLPQGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1aipA           GRHTGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1aipE           KEETGFFSGYRPQFYFRTTDVTGVVQLPPVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
1b23P           KEEGGFFTGYRPQFYFRTTDVTGVVRLQGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2c77A           KEEGGRHTGFFSFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2d74A           RVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAIQIGSRWRLIGY
2ahoA           RVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIARMIGW
2dcuA           RVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAIQIGSRWRLIGY
2c78A           GRHTGFFSGYRPQFYFRTTDVTGVVQLPPGEMVMPGDNVTFTVELIKPVALEEGLRFAIREGG--RTVGA
2b7cA           LNHSPVLDCHTAHIACRFDELLEKNDRRSGKKLESGDAALVKFVPEAFSEYPPLGRFAVRDMR--QTVAV
2dy1A           ----------------------------------------------------------------------
3cw2B           NLLGPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTV--ISRQI---AGRWRMIGW
1d2eA           KEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPGKGEDLKLTLILRQPMILEKGQRFTLRDGN--RTIGT
2brvX           ----------------------------------------------------------------------
3dpuA           CYDEGKGLFIPSNLPTQIITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGA
2byeA           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3chuB           DLRSTAGGTRLVRDFSGARKMVEQLGLDDAVD---------------------FDFPERPDWSP------
3a1tA           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3e1yE           EHKSIICPGYNAVLHIHTCEITALICLVDKKSVKQDQVCIARLRTAGTICLEQMGRFTLRDEG--KTIAI
3e20A           -LPSILTTGYSCVMHISFAKLLHKLDKTNRKSKKPGMKIIAELETQTPVCMERFERFTLRDQG--TTVAV
2cxxB           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
1eah1           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3dsnF           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
3degC           ----------------VKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPE---------------
3a1vB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3dosF           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
3dosC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dwaA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
3dwaE           ----------------------------------------------------------------------
3dwaC           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3dwaB           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVVIEPNAPKHKRYRSEVLEGLATKEKGTPEELVNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bvnA           GVVAKVLS--------------------------------------------------------------
1efuA           GVVAKVLS--------------------------------------------------------------
2bvnB           GVVAKVLS--------------------------------------------------------------
1d8tA           GVVAKV----------------------------------------------------------------
1efcA           GVVAKVLS--------------------------------------------------------------
1d8tB           GVVAKVLG--------------------------------------------------------------
1dg1G           GVVAKVLS--------------------------------------------------------------
1eftA           GVVTKI----------------------------------------------------------------
1aipA           GVVTKI----------------------------------------------------------------
1aipE           GVVTKI----------------------------------------------------------------
1b23P           GVVTKI----------------------------------------------------------------
2c77A           GVVTKI----------------------------------------------------------------
2d74A           GIIKE-----------------------------------------------------------------
2ahoA           GLV-------------------------------------------------------------------
2dcuA           GIIKE-----------------------------------------------------------------
2c78A           GVVTKI----------------------------------------------------------------
2b7cA           GVIKS-----------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3cw2B           GLVE------------------------------------------------------------------
1d2eA           GLVTDT-------PA-MTEEDKNIK---------------------------------------------
2brvX           ----------------------------------------------------------------------
3dpuA           LAKVVAETKDSTITIA-----IQGEPRCKREYLSI-----------------------------------
2byeA           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3e1yE           GKVLK-----------------------------------------------------------------
3e20A           GKVVK-----------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
1eah1           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3dsnF           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3dosF           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
3dosC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dwaA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
3dwaE           ----------------------------------------------------------------------
3dwaC           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3dwaB           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bvnA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
2brvX           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3e1yE           ----------------------------------------------------------------------
3e20A           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
1eah1           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3dsnF           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3dosF           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
3dosC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dwaA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
3dwaE           ----------------------------------------------------------------------
3dwaC           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3dwaB           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bvnA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
2brvX           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3e1yE           ----------------------------------------------------------------------
3e20A           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
1eah1           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3dsnF           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3dosF           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
3dosC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dwaA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
3dwaE           ----------------------------------------------------------------------
3dwaC           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3dwaB           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bvnA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
2dy1A           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
2brvX           ----------------------------------------------------------------------
3dpuA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
3cb4D           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
3e1yE           ----------------------------------------------------------------------
3e20A           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
1eah1           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
3dsnF           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
3degC           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3dosF           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
3dosC           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
3dsnE           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dwaA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
2e1rA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
3dwaE           ----------------------------------------------------------------------
3dwaC           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3a1uA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
3dwaB           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxx
2bvnA           -----
1efuA           -----
2bvnB           -----
1d8tA           -----
1efcA           -----
1d8tB           -----
1dg1G           -----
1eftA           -----
1aipA           -----
1aipE           -----
1b23P           -----
2c77A           -----
2d74A           -----
2ahoA           -----
2dcuA           -----
2c78A           -----
2b7cA           -----
2dy1A           -----
3cw2B           -----
1d2eA           -----
2brvX           -----
3dpuA           -----
2byeA           -----
3chuA           -----
1eguA           -----
1c82A           -----
1eg7A           -----
3bjqE           -----
1cjtC           -----
3chuB           -----
3a1tA           -----
1aym1           -----
1egaA           -----
3cb4D           -----
1culC           -----
3a1uB           -----
3a1vA           -----
1egaB           -----
3eg5B           -----
3bc1A           -----
3a1sA           -----
1cf4A           -----
2dwqA           -----
1cs4C           -----
2cjwA           -----
3e1yE           -----
3e20A           -----
2cxxB           -----
1ds6A           -----
1an0B           -----
1eah1           -----
2dfkD           -----
3dsnF           -----
3d5bF           -----
3ea5C           -----
1ecrA           -----
1cjuC           -----
3bb4A           -----
1a4rA           -----
1aztB           -----
3degC           -----
3a1vB           -----
1ahjB           -----
2a5fA           -----
3c14C           -----
1cc0A           -----
2dfkB           -----
3eg5A           -----
2bv3A           -----
3bh6A           -----
2dykA           -----
3bb3A           -----
2cxxC           -----
3c15C           -----
2ahjD           -----
3dosF           -----
1d1nA           -----
1ceeA           -----
1d5cA           -----
3a1sB           -----
2aseA           -----
1a2kD           -----
1an0A           -----
1ajeA           -----
3e5hA           -----
3bc1E           -----
1a2kC           -----
3dsnC           -----
3dosC           -----
1byuA           -----
3bfkB           -----
3bh7A           -----
1eg7B           -----
1e96A           -----
1cxzA           -----
1byuB           -----
3efxD           -----
3dosE           -----
2a5dA           -----
2e87A           -----
2bkuA           -----
2bmeC           -----
2bmjA           -----
3dsnE           -----
3cqgB           -----
1cluA           -----
1cjvC           -----
3dwaA           -----
3dpbB           -----
2e1rA           -----
1a4xB           -----
3dwaE           -----
3dwaC           -----
3doeA           -----
3ea5A           -----
2c5lA           -----
3ddcA           -----
3a1uA           -----
3cwzA           -----
521pA           -----
2crvA           -----
1a2kE           -----
1dpfA           -----
621pA           -----
2ahjB           -----
3dwaB           -----
1chpD           -----
3bjiD           -----
3bbpA           -----
121pA           -----
3defA           -----
3ec1A           -----
3bb1A           -----
3batA           -----