[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50753.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eafA.bssp"
#ERROR : Can't open dsspfile "3ckmA.bssp"
#ERROR : Can't open dsspfile "2e4yB.bssp"
#ERROR : Can't open dsspfile "2e4zA.bssp"
#ERROR : Can't open dsspfile "1dp4C.bssp"
#ERROR : Can't open dsspfile "1dp4A.bssp"
#ERROR : Can't open dsspfile "2e4vA.bssp"
#ERROR : Can't open dsspfile "2e4uA.bssp"
#ERROR : Can't open dsspfile "2e4uB.bssp"
#ERROR : Can't open dsspfile "2e4vB.bssp"
#ERROR : Can't open dsspfile "3cznA.bssp"
#ERROR : Can't open dsspfile "3bilA.bssp"

## Summary of PDB Search
:394
    5e-46  17%  3eafA  [x.x.x] ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN
    8e-41  14%  3ckmA  [x.x.x] YRAM (HI1655)
    4e-30  14%  2e4yB  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    1e-27  15%  2e4zA  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 7
    2e-25  15%  1dp4C  [c.93.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
    6e-25  14%  1dp4A  [c.93.1] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
    2e-21  16%  2e4vA  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    9e-20  15%  2e4uA  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    3e-19  15%  2e4uB  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    7e-19  16%  2e4vB  [x.x.x] METABOTROPIC GLUTAMATE RECEPTOR 3
    6e-11  11%  3cznA  [x.x.x] ALPHA-MANNOSIDASE 2
    2e-05  10%  3bilA  [x.x.x] PROBABLE LACI-FAMILY TRANSCRIPTIONAL REGULATOR
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAADANEIVIGGNLELSGPVATFGTAMKNGAEMYFEEVN
3eafA           --------------------------------------INVGLLVDETGPTSDVGKGYSLGAELAFKYFN
3ckmA           ----------------------------------------IGLLLPLSGDGQILGTTIQSGFNDAKG---
2e4yB           --------------------------------GLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEIN
2e4zA           ----------------------------------------GPSGVPCGDIKRENGIHRLEAMLYALDQIN
1dp4C           ------------------------------------SDLTVAVVLPLTNTSYPWSWARGPAVELALARVK
1dp4A           ------------------------------------SDLTVAVVLPLTNTSYPWSWAVGPAVELALARVK
2e4vA           --------------------------------GLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEIN
2e4uA           --------------------------------GLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEIN
2e4uB           --------------------------------GLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEIN
2e4vB           --------------------------------GLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEIN
3cznA           -----------------------------------KARVPPMGLATYVLTISDSKPEHTSYASNLLLRKN
3bilA           ----------------------------------------------VPSLINHYFAAMVTEIQSTASKAG


                         .         .         *         .         .         .         .:140
query           AAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTA
3eafA           EKGIYTGVRVNINKRDYAYNPTTAEEYYREFRDRYGVI-AIIGWGTADTEKLSDQVDTDKITYISASYSA
3ckmA           ------NSTIPVQVFDTSNSVQDII----AQAKQAGIKTLVGPLLKQNLDVILADPAQIQGDVLALNATP
2e4yB           KDNYLLGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLVIGGSYSSVSIQVANLLRLFQIPQISYASTS
2e4zA           SDPNLLNVTLGARILDTCSRDTYALEQSLTFVQALKVVGVIGASGSSVSIMVANILRLFQIPQISYASTA
1dp4C           ARPDLLGWTVRMVLGSSENAAGVCSDTAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPA
1dp4A           ARPDLLGWTVRMVLGSSENAAGVCSDTAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPA
2e4vA           KDNYLLGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLVIGGSYSSVSIQVANLLRLFQIP--------
2e4uA           KDNYLLGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGS----------------------
2e4uB           KDNYLLGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGS----------------------
2e4vB           KDNYLLGVKLGVHILDTCSRDTYALEQSLEFVRASLIAGVIGGSYSSVSIQVANLLRLFQIP--------
3cznA           PTSLPLGQYPEDVKFGDPREISLRVGNGPTLAFSEQ--------------GLLKSIQLTQDSPHVPVHFK
3bilA           ---------LATIITNSNEDATTMSGSLEFLTSHGVDGIICVPNEECANQ---LEDLQKQMPV-------


                         +         .         .         .         .         *         .:210
query           LEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGG
3eafA           KLLV--------KPFNFYPAPDYSTQACSGLAFLASEFGQGKLALAYDSKVAYSRSPIGAIKKAAPSLGL
3ckmA           NSRA--------IPQLCYYGLSPEDEAESAANKWNDGVRN--PLVAPQN--DLGQRVGNAFNVRWQQLAG
2e4yB           AKLS----DKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVA--SEGDYGETGIEAFEQEARLRNI
2e4zA           PELS----DDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNY--VSTLASEGSYGEKGVESFTQISKEAGG
1dp4C           LGIG----VKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYAD--RLGDDRPCFFIVEGLYMRV
1dp4A           LGIG----VKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVL--YADRLGDDRPCFFIVEGLYMRV
2e4vA           ----------------------------------------------------------------------
2e4uA           ----------------------------------------------------------------------
2e4uB           ----------------------------------------------------------------------
2e4vB           ----------------------------------------------------------------------
3cznA           LKYGVRSHGDRSGAYLFLPNGPASPV-----ELGQPVVLVTKGKLESSVSVGLP-----SVVHQTIMRGG
3bilA           --VLVDRELPG--DTIPTATSNPQPGIAAAVELLAHNNALPIGYLSGPMDTSTGRERLEDFKAACANSKI


                         .         .         .         +         .         .         .:280
query           KIVGEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIA
3eafA           QVVGDYDLPLRAEADAERIARELAADPDYVWCGNTISSCS-LLGRAAKVGLDAFLLTNVWGFDERSPQLI
3ckmA           TDANIRYYNLPADVT--YFVQENNSNTTALYAVASPTELA-EKGYLTNIVPNLAIYASSRASASATNTNT
2e4yB           CIATAEKVGRSNIRKSYIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKG
2e4zA           LCIAQSVRIPTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVFLWVGSDSWGSKINPLHQ
1dp4C           REVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGED---------------
1dp4A           REVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEVFFHLDVFGQSLKSAQ
2e4vA           ----------------------------------------------------------------------
2e4uA           ----------------------------------------------------------------------
2e4uB           ----------------------------------------------------------------------
2e4vB           ----------------------------------------------------------------------
3cznA           APEIRNLVDIGSLDNTEIVMRLEHIDSGDIF----YTDLNGLQFIKRR---RLDKLPLQANYYPIPSANT
3bilA           GEQLVFLGGYEQSVGFEGATKLLDQGAKTLFAGDSMMTIG-VIEACHKAGLVIGDVSVIGFDTHPLFALQ


                         .         *         .         .         .         .         +:350
query           GGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEA
3eafA           GEGGYGKVFGISPFPFGQDVEGIQTIFEAARNGVSEDINLRVVQGFVNVWLLIKAIESLQERGGEALKEA
3ckmA           DFIAQNGVQFSDPFFKDTNSPQYQKLAKSTGGEYQ----LRLYAGADAWLLIN-----------QFNELR
2e4yB           SEHVAYGAITLELASH--PVRQFDRYFQSLNPYNNHRNPWF-----------------------------
2e4zA           HEDIAEGAITIQPKRA--TVEGFDAYFTSRTLENNRRNVWFA----------------------------
1dp4C           ----------------------------------------------------------------------
1dp4A           GLVPQKPWERGDGQDR--SARQAFQAAKIITYK-------------------------------------
2e4vA           ----------------------------------------------------------------------
2e4uA           ----------------------------------------------------------------------
2e4uB           ----------------------------------------------------------------------
2e4vB           ----------------------------------------------------------------------
3cznA           RLTLLTGQGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVIYRLVLEKVNNCVRPSKLHPAGYLTS
3bilA           PHP-------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LANAKDVQAITGKLSFDENHNPIKGAVILEMKDGKQVxxxxxxx
3eafA           LEANTDLGGITATIDYEGFHLAYRKVFIIKLGENGEL-------
3ckmA           QVPGYRLSGLTGILSADTNCNVER-DTWYQYQDGAIV-------
2e4yB           --------------------------------------------
2e4zA           --------------------------------------------
1dp4C           --------------------------------------------
1dp4A           --------------------------------------------
2e4vA           --------------------------------------------
2e4uA           --------------------------------------------
2e4uB           --------------------------------------------
2e4vB           --------------------------------------------
3cznA           AAH-----------------------------------------
3bilA           --------------------------------------------