[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50761.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1booA.bssp"

## Summary of PDB Search
:227
    1e-09  14%  1booA  [c.66.1] PROTEIN (N-4 CYTOSINE-SPECIFIC METHYLTRANSFERASE
:227

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1booA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxFDNTENLYIEGDNLDALKLLQETYLGKVKMIYIDPPYNTGND
1booA           ----------------------------YTTSNGSMYIGDSLELLESFPEE---SISLVMTSPPFALQRK


                         +         .         .         .         .         *         .:210
query           FIYEDDFAQDADEYLANSGQYDENGNRLVQNTESNGRFHTDWLNMIYPRLKLAKDLLTEDGAIFISIDDN
1booA           KEYGNL---EQHEYVD---------------------WFLSFAKVVNKKLKPDGSFVVDFGGAYMKGVPA


                         .         .         .         +         .         .         .:280
query           EVENLxxxxxxxxxxxx
1booA           RSIYN------------