[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50796.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dxjF.bssp"
#ERROR : Can't open dsspfile "3c57A.bssp"
#ERROR : Can't open dsspfile "3c57B.bssp"
#ERROR : Can't open dsspfile "3cloA.bssp"
#ERROR : Can't open dsspfile "2dk5A.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"

## Summary of PDB Search
:200
    1e-26  14%  3dxjF  [x.x.x] RNA POLYMERASE PRICIPAL SIGMA FACTOR (RPOD)
    3e-06  26%  3c57A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    7e-06  28%  3c57B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    3e-04  29%  3cloA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    5e-04   6%  2dk5A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    7e-04  15%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPLEDQLLVERSKKGDREAFEHLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQALPNFRGDSSFS
3dxjF           SLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYRFKFS
3c57A           ----------------------------------------------------------------------
3c57B           ----------------------------------------------------------------------
3cloA           ----------------------------------------------------------------------
2dk5A           ----------------------------------------------------------------------
1bibA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TWIYHITVNVCRDELRKRQRRPTVSLXXXXXXXXXXXTYEIRSNDPGPEEMLDRSETQAMIQACLNTLSD
3dxjF           TYATWWIRQAINRAIADQARTIRIP------VHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
3c57A           -------------------------------------------------------------------LTD
3c57B           ----------------------------------------------------------------------
3cloA           -------------------------------------------------------ETLSLSEEHRNILSE
2dk5A           ------------------------------------------------------SSGDSQNAGKMKGSDN
1bibA           ---------------------------------------------------------------------N


                         +         .         .         .         .         *         .:210
query           DYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQALKEKISKQMELITPAKRLxx
3dxjF           AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSL-----------
3c57A           QERTLLGLL-SEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGME----------------
3c57B           --QERTLLGLLSELTNKQIADRMFLAEKTVKNYVSRLLAKLG------------------
3cloA           --REKEILRCIKGLSSKEIAATLYISVNTVNRHRQNILEKL--SVGNSIEACRAAELK--
2dk5A           QEKLVYQIAGNKGIWSRDVRYKSNLPLTEINKILKN------------------------
1bibA           TVPLKLILANGEFHSGEQLGETLGMSRAAINKHIQTLRDW--------------------