[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50877.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d54D.bssp"
#ERROR : Can't open dsspfile "2abwA.bssp"
#ERROR : Can't open dsspfile "2abwB.bssp"
#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"
#ERROR : Can't open dsspfile "1a9xB.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "3bweE.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "3cyfA.bssp"
#ERROR : Can't open dsspfile "3b3aA.bssp"
#ERROR : Can't open dsspfile "1cf9A.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3cneB.bssp"
#ERROR : Can't open dsspfile "3bhnA.bssp"
#ERROR : Can't open dsspfile "3bweD.bssp"
#ERROR : Can't open dsspfile "3efeD.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "3b38A.bssp"
#ERROR : Can't open dsspfile "3efeA.bssp"
#ERROR : Can't open dsspfile "2an1C.bssp"
#ERROR : Can't open dsspfile "3efeB.bssp"
#ERROR : Can't open dsspfile "3czaA.bssp"
#ERROR : Can't open dsspfile "3cy6A.bssp"
#ERROR : Can't open dsspfile "3b36A.bssp"
#ERROR : Can't open dsspfile "3cneA.bssp"
#ERROR : Can't open dsspfile "3cz9A.bssp"
#ERROR : Can't open dsspfile "3efeC.bssp"
#ERROR : Can't open dsspfile "3efeF.bssp"
#ERROR : Can't open dsspfile "2ab0A.bssp"
#ERROR : Can't open dsspfile "1aa7B.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"

## Summary of PDB Search
:233
    5e-27  43%  3d54D  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 1
    5e-23  17%  2abwA  [x.x.x] PDX2 PROTEIN
    5e-21  17%  2abwB  [x.x.x] PDX2 PROTEIN
    8e-18  19%  2a9vB  [x.x.x] GMP SYNTHASE
    1e-17  16%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
    3e-17  16%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    2e-15  20%  2a9vA  [x.x.x] GMP SYNTHASE
    2e-15  15%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    3e-15  14%  1a9xB  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL
    4e-14  19%  2a9vD  [x.x.x] GMP SYNTHASE
    4e-13  20%  3bweE  [x.x.x] PROTEIN DJ-1
    9e-13  19%  2a9vC  [x.x.x] GMP SYNTHASE
    2e-12  16%  3cyfA  [x.x.x] PROTEIN DJ-1
    3e-12  18%  3b3aA  [x.x.x] PROTEIN DJ-1
    4e-12   8%  1cf9A  [e.5.1 - c.23.16] PROTEIN (CATALASE HPII)
    1e-11  12%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    2e-11  14%  3cneB  [x.x.x] PUTATIVE PROTEASE I
    6e-11  21%  3bhnA  [x.x.x] THIJ/PFPI DOMAIN PROTEIN
    6e-11  20%  3bweD  [x.x.x] PROTEIN DJ-1
    2e-10  14%  3efeD  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    2e-10  14%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    2e-09  18%  3b38A  [x.x.x] PROTEIN DJ-1
    3e-09  13%  3efeA  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    3e-09  11%  2an1C  [x.x.x] PUTATIVE KINASE
    3e-09  16%  3efeB  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    4e-09  18%  3czaA  [x.x.x] PROTEIN DJ-1
    5e-09  19%  3cy6A  [x.x.x] PROTEIN DJ-1
    1e-08  20%  3b36A  [x.x.x] PROTEIN DJ-1
    1e-08  15%  3cneA  [x.x.x] PUTATIVE PROTEASE I
    2e-08  22%  3cz9A  [x.x.x] PROTEIN DJ-1
    5e-08  16%  3efeC  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    8e-08  15%  3efeF  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    8e-07  26%  2ab0A  [x.x.x] YAJL
    2e-06  15%  1aa7B  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    1e-04  11%  1aa7A  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKFGVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCGAVARFSPVMS
3d54D           PRACVVVYPGSNCDRDAYHALEINGFEPS--YVGLDDKLDDYELIILPGGFSYGDYLRPGAVAAREKIAF
2abwA           ITIGVLSLQGDFEPH--INHFIKLQIPSLNIIQVRNVDLGLCDGLVIPGGESTT-VRRCCAYENDTLYNA
2abwB           ITIGVLSLQGDFEPNHFIKLQ----IPSLNIIQVRNVDLGLCDGLVIPGGESTTVRRCC-AYENDTLYNA
2a9vB           LKIYVVDN-GGQWTHREWRVLREL-GVDTKIVPNDSSELDGLDGLVLSGGAP-------NIDEELDKLGS
1bxrB           ELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDMNPDGIFLSNG--------PGDPAPCDYAIT
1c30B           ELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDMNPDGIFLSNGP--------GDPAPCDYAIT
2a9vA           LKIYVVDN-GGQWTHREWRVLREL-GVDTKIVPNDSSELDGLDGLVLSGGAP-------NIDEELDKLGS
1cs0B           ELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDMNPDGIFLSNGP--------GDPAPCDYAIT
1a9xB           ELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDMNPDGIFLSNGP--GDPAPCDYAI-------
2a9vD           LKIYVVDNGGQWTHRE-WRVLREL-GVDTKIVPNDSSELDGLDGLVLSGGAP-------NIDEELDKLGS
3bweE           -RALVILAKGAEEETVIPVDVRRAGIKVTDASLEDAKKEGPYDVVVLPGGNLGAQNLSESA-----AVKE
2a9vC           LKIYVVDN-GGQWTHREWRVLREL-GVDTKIVPNDSSELDGLDGLVLSGGAP-------NIDEELDKLGS
3cyfA           -RALVILAKGAELAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKE-----
3b3aA           -RALVILAKGAEEETVIPVDVMRRAGIKVTVAGLAGKDPGPYDVVVLPGGNLGAQNLSESA-----AVKE
1cf9A           -------------------EVTADDGTVLPIAATFAGPSLTVDAVIVPCGN--IADIADNG-----DANY
2aexA           ----------------------------------------------------------------------
3cneB           -KVAVLAVNPVNCGLFQYLEAFFENGISYKVFAVSDTKEDEFDALVFSCGDAVPVFQQYAN-----QPYN
3bhnA           -------------------PEHHSQLGTVK-TDGHVSEVKEQDVVLITSGYRGIPAALQDENFSA-----
3bweD           -RALVILAKGAEEETVIPVDVRRAGIKVTDASLEDAKKEGPYDVVVLPGGNLGAQNLSESA-----AVKE
3efeD           -------------------------------ISLDECTLESKDLLILPGGTTWSEEIH-------QPILE
2d7jA           ---VIMDNGGQYVHRI-WRTLRYL-GVETKIIPNTT-PLEEIKAMNPKGIIFSGGP----SLENTGNCEK
3b38A           -RALVILAKGAEMETVIPVDVMRRAGIKVTVAGLAGKDPGPYDVVVLPGGNLGAQNLSESA-----AVKE
3efeA           -------------------------------ISLDECTLESKDLLILPGGTTWSEEIHQP-------ILE
2an1C           -------------------------------VEQQIAHELQVPTGTLAEIGQQADLA--VVVGGDGNMLG
3efeB           ---------------------------------------ESKDLLILPGGT--TWSEEIHQ-----PILE
3czaA           -RALVILAKGAEAGIKVTVADPVQCSRDVVISLEDAKKEGPYDVVVLPGGNLGAQNLSESA-----AVKE
3cy6A           -----------------------------DASLEDAKKEGPYDVVVLPGGNLGAQNLSESA-----AVKE
3b36A           -RALVILAKGAEEETVIPVDVLRRAGIKVTVAGLAGKDPGPYDVVVLPGGNLGAQNLSESA-----AVKE
3cneA           -KVAVLAVNPVNCGLFQYLEAFFENGISYKVFAVSDTKEDEFDALVFSCGDAVPVFQQYAN-----QPYN
3cz9A           -RALVILAKGAGIKVTVAGLAGKDPVQCSDASLEDAKKEGPYDVVVLPGGNLGAQNLSESA-----AVKE
3efeC           -----------------------------------------KDLLILPGGTTWSEEIH-------QPILE
3efeF           -------------------------------ISLDECTLESKDLLILPGGTTWSEEIHQP-------ILE
2ab0A           -SALVCLAPGSEVRGGIKVTTASVASDGNLAITCSRGVKGEYDVIVLPGGIKGAECFRDST-----LLVE
1aa7B           -----DVFAGKNTDLEVLMEWLILSPLTKGIGFVFTLTVPSRRRFVQNALNGNGDPNNMDKAVK----LY
1aa7A           -----------------------------------------RRRFVQNALNGNGDP----NNMDKAVKLY


                         .         .         *         .         .         .         .:140
query           PVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVENDISPFTSLASRGSVIKVPI
3d54D           EIAKAAERGKLIMGINGFQILIEMGLLKG-ALLQNSSGKFICKWVDLIVENNDTPFTNAFEKGEKIRIPI
2abwA           LVHFIHVLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITICRNFNDSFICSLNIISDSSAFK
2abwB           LVHFIHVLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITICRNFYGSFICSLNIISDSSAFK
2a9vB           VGKYIDDHNYPILGICVGAQFIALH--FGASVVKAKHPEFGKTKVSVH------SENIFGGLPSEITVWE
1bxrB           AIQKFLETDIPVFGICLGHQL-------------------LALASGAKTVKMKFGHHGGNHPVKDVEKNV
1c30B           AIQKFLETDIPVFGISLGHQL-------------------LALASGAKTVKMKFGHHGGNHPVKDVEKNV
2a9vA           VGKYIDDHNYPILGICVGAQFIALHF--GASVVKAKHPEFGKTKVSVHSENIFGGL------PSEITVWE
1cs0B           AIQKFLETDIPVFGILGHQLLALASAKTVKMKFGHHGGNHPVKDVEK---------------------NV
1a9xB           TAIQKFLETDIPVFGILGHQLLALAS-------------------GAKTVKMKFGHHGGNHPVKDVEKNV
2a9vD           VGKYIDDHNYPILGICVGAQFIAL--HFGASVVKAKHPEFGKTKVSVH------SENIFGGLPSEITVWE
3bweE           ILKEQENRKGLIAAICAGPTALLAHEIGFGHPLAKDKNGGHYTYSENRVEKD-GLILTSRGPGTSFEFAL
2a9vC           VGKYIDDHNYPILGICVGAQFIAL--HFGASVVKAKHPEFGKTKVSVH------SENIFGGLPSEITVWE
3cyfA           -ILKEQENRKGLIAAIAGPTALLAHEIGFGSKVTTHPLAK------------------------------
3b3aA           ILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDK----MMNGGHYTYSENEVEKDGLILTSR
1cf9A           YLMEAYKHLKPIALAGDARKFKATIKIADQEGIVEADSADGSFMDELLTLMAAHRVWS------------
2aexA           -------------------------------------------------------------------IPL
3cneB           VDLEVIKTFGEKGKIGHCAGAFDFTGITKG---KKVAVHPLAKPAIQNGI--------------------
3bhnA           --LKLDPSRQLIGSICAGSFVLHELGLLKG----------------------------------------
3bweD           ILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKNGGHYTYSE-------------------
3efeD           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLV---T
2d7jA           VLEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSL----VEIEIIDEDEIFK-----------GL
3b38A           ILKEQENRKGLIAVICAGPTALLAHEIGFGSKVTTHPLAKDK----MMNGGHYTYSENRVEKDGLILTSR
3efeA           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLV---T
2an1C           AARTLARYDINVIGINRGNLGFLTDL---DPDNALQQLSDVLEGRYISEKRFLLEAQVCQQDRQKRISTA
3efeB           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLV---T
3czaA           ILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTT------HPLAKDKMMNGGHYTYSENRVEKDGLILT
3cy6A           ILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILT------
3b36A           ILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVE-------------
3cneA           VDLEVIKTFGEKGKIGHCAGAFDFTGITKG----------------------------------------
3cz9A           ILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMN-------------------------
3efeC           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLV---T
3efeF           RIGQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSDANLV---T
2ab0A           TVKQFHRSGRIVAAICAAPATVLVP---------------------------------------------
1aa7B           RKLKREITFHGAKEISLSYSAGALA--SCMGLIYNR----------------------------------
1aa7A           RKLKREITFHGAKEISLSYSAGALA--SCMGLIYNRMGAVTTEVAFGLVC--------------------


                         +         .         .         .         .         *         .:210
query           AHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNPNGSVNNIAGICNEQGNVLGMMPHPERCAEE
3d54D           AHGFG--------RYVKIDDVNVVLRYV---------KDVNGSDERIAGVLNESGNVFGLMPHPERAVEE
2abwA           KDLTAACIRAPYIREILSDEVKVLATF------------SHESYGPNIIAAVEQNNCLGTVFHPEL----
2abwB           KDLTAACIRAPYIREILSDEVKVLATF------------SHESYGPNIIAAVEQNNCLGTVFHPEL----
2a9vB           NHN--------DEIINLPDDFTLAASSAT---------------CQVQGFYHKTRPIYATQFHPEVEHTQ
1bxrB           VMITAQNHGFAVDEATLPANLRVTHKSLFD--------------GTLQGIHRTDKPAFSFQGHPEA----
1c30B           VMITAQNHGFAVDEATLPANLRVTHKSLFD--------------GTLQGIHRTDKPAFSFQGHPEA----
2a9vA           NH--------NDEIINLPDDFTLAASSAT---------------CQVQGFYHKTRPIYATQFHPEVEHTQ
1cs0B           VMITAQNHGFAVDEATLPANLRVTHKSLFDG--------------TLQGIHRTDKPAFSFQGHPEA----
1a9xB           VMITAQNHGFAVDEATLPANLRVTHKSLFDG--------------TLQGIHRTDKPAFSFQGNPEA----
2a9vD           NH--------NDEIINLPDDFTLAASSAT---------------CQVQGFYHKTRPIYATQFHPEVEHTQ
3bweE           AIVEALNGKE------------------------------------------------------------
2a9vC           NH--------NDEIINLPDDFTLAASSAT---------------CQVQGFYHKTRPIYATQFHPEVEHTQ
3cyfA           ----------------------------------------------------------------------
3b3aA           GPGTSFKFA--LAIVEALNGKEVAAQVKAPLV--------------------------------------
1cf9A           ----------------------------------------------------------------------
2aexA           KHCDDSFT-PQEKLWQQLRRGRYVEF------------NLLYDRGTKFGLFTPGSRIESLMSLPLTA---
3cneB           ----------------------------------------------------------------------
3bhnA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
3efeD           ASGIAPLEFAMEVLKKIDVFTLDALHSWY-----------------------NLNKTHKPEYFFQ-----
2d7jA           PKRLKVWESHMDEVKELPPKFKILARSET---------------CPIEAMKHEELPIYGVQFHPEVAHTE
3b38A           GPGTSFEFA--LAIVEALNGKEVAAQVKAP----------------------------------------
3efeA           ASGIAPLEFAMEVLKKIDVFTLDALHSWY-----------------------NLNKTHKPEYFFQL----
2an1C           INEVVLHPGKHM---------IEFEVYIDET-FAFSQRSDGLIISTPTGSTAYSLSAGGPILTPSLDA-I
3efeB           ASGIAPLEFAMEVLKKIDTLDALHSWYNLNK---------------------------------------
3czaA           SRGPGTSFEFALAIVEALNGKEVAAQVKAP----------------------------------------
3cy6A           SRGPGTSFEFALAIVEALNGKEVAAQVKAP----------------------------------------
3b36A           ----------------------------------------------------------------------
3cneA           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3efeC           ASGIAPLEFAMEVLKKI------------DVFTL------------DALHSWYNLNKTHKPEYFF-----
3efeF           ASGIAPLEFAMEVLKKI------------DVFTL------------DALHSWYNLNKTHKPEYFF-----
2ab0A           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ILGNIDGQLIFKSLLETWQRRCG
3d54D           LIGGEDGKKVFQSILN-------
2abwA           -----------------------
2abwB           -----------------------
2a9vB           -----YGRDIFRNFIG-------
1bxrB           SPGPHDAAPLFDHFIELIEQY--
1c30B           SPGPHDAAPLFDHFIELIEQY--
2a9vA           -----YGRDIFRNFIG-------
1cs0B           SPGPHDAAPLFDHFIELIEQY--
1a9xB           SPGPHDAAPLFDHFIELIEQYRK
2a9vD           -----YGRDIFRNFIG-------
3bweE           -----------------------
2a9vC           -----YGRDIFRNFIG-------
3cyfA           -----------------------
3b3aA           -----------------------
1cf9A           -----------------------
2aexA           -----------------------
3cneB           -----------------------
3bhnA           -----------------------
3bweD           -----------------------
3efeD           -----------------------
2d7jA           -----KGEEILRNFAK-------
3b38A           -----------------------
3efeA           -----------------------
2an1C           TLVPMFPHTLSARPLVINSSS--
3efeB           -----------------------
3czaA           -----------------------
3cy6A           -----------------------
3b36A           -----------------------
3cneA           -----------------------
3cz9A           -----------------------
3efeC           -----------------------
3efeF           -----------------------
2ab0A           -----------------------
1aa7B           -----------------------
1aa7A           -----------------------