[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50885.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dlaB.bssp"
#ERROR : Can't open dsspfile "2dplA.bssp"
#ERROR : Can't open dsspfile "3dlaC.bssp"
#ERROR : Can't open dsspfile "3a4iA.bssp"
#ERROR : Can't open dsspfile "2c5sA.bssp"
#ERROR : Can't open dsspfile "2dplB.bssp"
#ERROR : Can't open dsspfile "3dlaA.bssp"
#ERROR : Can't open dsspfile "3dlaD.bssp"
#ERROR : Can't open dsspfile "2derA.bssp"
#ERROR : Can't open dsspfile "2deuA.bssp"
#ERROR : Can't open dsspfile "3b9xA.bssp"
#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "1bsuA.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "2e18A.bssp"
#ERROR : Can't open dsspfile "3b9xD.bssp"
#ERROR : Can't open dsspfile "2derB.bssp"
#ERROR : Can't open dsspfile "3dpiA.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "3b9xC.bssp"
#ERROR : Can't open dsspfile "2e89D.bssp"
#ERROR : Can't open dsspfile "3dfyA.bssp"
#ERROR : Can't open dsspfile "2detA.bssp"
#ERROR : Can't open dsspfile "2dyiA.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "1bgbB.bssp"
#ERROR : Can't open dsspfile "3bl5E.bssp"
#ERROR : Can't open dsspfile "1bsuB.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"
#ERROR : Can't open dsspfile "2d13B.bssp"
#ERROR : Can't open dsspfile "1ee1B.bssp"
#ERROR : Can't open dsspfile "1a9xB.bssp"
#ERROR : Can't open dsspfile "2e21B.bssp"
#ERROR : Can't open dsspfile "2abwB.bssp"
#ERROR : Can't open dsspfile "3bl5A.bssp"
#ERROR : Can't open dsspfile "2e21A.bssp"
#ERROR : Can't open dsspfile "3dpiB.bssp"
#ERROR : Can't open dsspfile "1b97A.bssp"
#ERROR : Can't open dsspfile "3cl6A.bssp"
#ERROR : Can't open dsspfile "3efbC.bssp"
#ERROR : Can't open dsspfile "1az0A.bssp"
#ERROR : Can't open dsspfile "2abwA.bssp"
#ERROR : Can't open dsspfile "3efeD.bssp"
#ERROR : Can't open dsspfile "3efeB.bssp"
#ERROR : Can't open dsspfile "3bgyB.bssp"
#ERROR : Can't open dsspfile "3d54D.bssp"
#ERROR : Can't open dsspfile "2an1C.bssp"
#ERROR : Can't open dsspfile "2d13A.bssp"
#ERROR : Can't open dsspfile "3efeA.bssp"
#ERROR : Can't open dsspfile "3cy6A.bssp"
#ERROR : Can't open dsspfile "3cz9A.bssp"
#ERROR : Can't open dsspfile "3dkyE.bssp"
#ERROR : Can't open dsspfile "3efeC.bssp"
#ERROR : Can't open dsspfile "3czaA.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1aa7B.bssp"
#ERROR : Can't open dsspfile "3b38A.bssp"
#ERROR : Can't open dsspfile "3efeF.bssp"
#ERROR : Can't open dsspfile "3b36A.bssp"
#ERROR : Can't open dsspfile "3b3aA.bssp"
#ERROR : Can't open dsspfile "3bweD.bssp"
#ERROR : Can't open dsspfile "2an1D.bssp"
#ERROR : Can't open dsspfile "1cf9A.bssp"
#ERROR : Can't open dsspfile "3bweE.bssp"
#ERROR : Can't open dsspfile "2d13C.bssp"
#ERROR : Can't open dsspfile "1c4fA.bssp"
#ERROR : Can't open dsspfile "2an1B.bssp"
#ERROR : Can't open dsspfile "1ct9B.bssp"
#ERROR : Can't open dsspfile "2ab0A.bssp"
#ERROR : Can't open dsspfile "3efbA.bssp"
#ERROR : Can't open dsspfile "1ct9D.bssp"

## Summary of PDB Search
:513
    1e-63  12%  3dlaB  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    1e-59  56%  2dplA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    1e-56  11%  3dlaC  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    3e-56  56%  3a4iA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    2e-55  17%  2c5sA  [x.x.x] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII
    4e-55  55%  2dplB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    5e-55  10%  3dlaA  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    2e-54  11%  3dlaD  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    1e-45  19%  2derA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    1e-44  16%  2deuA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    8e-43  14%  3b9xA  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    4e-41  27%  2a9vB  [x.x.x] GMP SYNTHASE
    5e-41   9%  1bsuA  [c.52.1] ENDONUCLEASE ECORV (3.1.21.4)
    1e-40  41%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    9e-40  27%  2a9vD  [x.x.x] GMP SYNTHASE
    9e-40  27%  2a9vC  [x.x.x] GMP SYNTHASE
    1e-39  21%  2e18A  [x.x.x] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    1e-39  11%  3b9xD  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    1e-37  23%  2derB  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    2e-37  17%  3dpiA  [x.x.x] NAD+ SYNTHETASE
    2e-36  26%  2a9vA  [x.x.x] GMP SYNTHASE
    1e-35  15%  3b9xC  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    3e-35  14%  2e89D  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    4e-35  13%  3dfyA  [x.x.x] MUCONATE CYCLOISOMERASE
    1e-34  22%  2detA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    8e-33  14%  2dyiA  [x.x.x] PROBABLE 16S RRNA-PROCESSING PROTEIN RIMM
    8e-33  23%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
    1e-32  23%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    3e-32  11%  1bgbB  [c.52.1] ECORV ENDONUCLEASE
    3e-32  17%  3bl5E  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    1e-31  12%  1bsuB  [c.52.1] ENDONUCLEASE ECORV (3.1.21.4)
    2e-31  19%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    7e-31  17%  2d13B  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    1e-30  20%  1ee1B  [c.26.2] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    2e-30  18%  1a9xB  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL
    2e-30  18%  2e21B  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    4e-29  15%  2abwB  [x.x.x] PDX2 PROTEIN
    4e-28  17%  3bl5A  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    5e-28  18%  2e21A  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    7e-28  16%  3dpiB  [x.x.x] NAD+ SYNTHETASE
    9e-28  10%  1b97A  [c.52.1] RESTRICTION ENDONUCLEASE ECORV
    1e-27   9%  3cl6A  [x.x.x] PUUE ALLANTOINASE
    2e-27  12%  3efbC  [x.x.x] PROBABLE SOR-OPERON REGULATOR
    2e-27  11%  1az0A  [c.52.1] PROTEIN (TYPE II RESTRICTION ENZYME ECORV)
    4e-26  15%  2abwA  [x.x.x] PDX2 PROTEIN
    6e-26   9%  3efeD  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    7e-26  11%  3efeB  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    9e-24  12%  3bgyB  [x.x.x] POLYNUCLEOTIDE 5'-TRIPHOSPHATASE
    1e-23  18%  3d54D  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 1
    1e-23  14%  2an1C  [x.x.x] PUTATIVE KINASE
    2e-20  18%  2d13A  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    5e-20   8%  3efeA  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    1e-19   8%  3cy6A  [x.x.x] PROTEIN DJ-1
    2e-19   8%  3cz9A  [x.x.x] PROTEIN DJ-1
    3e-19   8%  3dkyE  [x.x.x] REPLICATION PROTEIN REPB
    8e-19   9%  3efeC  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    8e-19   8%  3czaA  [x.x.x] PROTEIN DJ-1
    9e-19   4%  1aa7A  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    1e-18   5%  1aa7B  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    2e-18   8%  3b38A  [x.x.x] PROTEIN DJ-1
    1e-16   9%  3efeF  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    2e-16   8%  3b36A  [x.x.x] PROTEIN DJ-1
    5e-16   9%  3b3aA  [x.x.x] PROTEIN DJ-1
    6e-16  12%  3bweD  [x.x.x] PROTEIN DJ-1
    2e-15   8%  2an1D  [x.x.x] PUTATIVE KINASE
    2e-14  12%  1cf9A  [e.5.1 - c.23.16] PROTEIN (CATALASE HPII)
    2e-14  13%  3bweE  [x.x.x] PROTEIN DJ-1
    3e-14  15%  2d13C  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    6e-14   7%  1c4fA  [d.22.1] GREEN FLUORESCENT PROTEIN
    9e-10  13%  2an1B  [x.x.x] PUTATIVE KINASE
    7e-06  22%  1ct9B  [d.153.1 - c.26.2] ASPARAGINE SYNTHETASE B
    2e-04   9%  2ab0A  [x.x.x] YAJL
    5e-04  14%  3efbA  [x.x.x] PROBABLE SOR-OPERON REGULATOR
    8e-04  27%  1ct9D  [d.153.1 - c.26.2] ASPARAGINE SYNTHETASE B
:513

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLAEQELILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTV
3dlaB           ----------------------------------------------------------------------
2dplA           ----------------------------------------------------------------------
3dlaC           ----------------------------------------------------------------------
3a4iA           ----------------------------------------------------------------------
2c5sA           ----------------------------------------------------------------------
2dplB           ----------------------------------------------------------------------
3dlaA           ----------------------------------------------------------------------
3dlaD           ----------------------------------------------------------------------
2derA           ----------------------------------------------------------------------
2deuA           ----------------------------------------------------------------------
3b9xA           ----------------------------------------------------------------------
2a9vB           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSELDGLDGLVLSGGAPNIDEELDKLGSV
1bsuA           ----------------------------------------------------------------------
2d7jA           -------MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKV
2a9vD           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSELDGLDGLVLSGGAPNIDEELDKLGSV
2a9vC           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSELDGLDGLVLSGGAPNIDEELDKLGSV
2e18A           ----------------------------------------------------------------------
3b9xD           ----------------------------------------------------------------------
2derB           ----------------------------------------------------------------------
3dpiA           ----------------------------------------------------------------------
2a9vA           --------IYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSELDGLDGLVLSGGAPNIDEELDKLGSV
3b9xC           ----------------------------------------------------------------------
2e89D           ----------------------------------------------------------------------
3dfyA           ----------------------------------------------------------------------
2detA           ----------------------------------------------------------------------
2dyiA           ----------------------------------------------------------------------
1bxrB           --------FHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPDYAITA
1c30B           --------FHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCYAITA
1bgbB           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
1cs0B           --------FHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAIT
2d13B           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
1a9xB           --------FHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAIT
2e21B           ----------------------------------------------------------------------
2abwB           --------IGVLSLQGDFEPHINHFIKLQIPSLNIIQV---RNVHDLGLCDGLVIPGGESTTVRRCCAYE
3bl5A           ----------------------------------------------------------------------
2e21A           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
1b97A           ----------------------------------------------------------------------
3cl6A           -----------AQRHPDVIRAMVAAGHEICSHGYRWIDYMDEAQEREHMLEAIRLTGERPLGWYTGRTGP
3efbC           ----------------------------------------------------------------------
1az0A           ----------------------------------------------------------------------
2abwA           --------IGVLSLQGDFEPHINHFIKLQIPSLNIIQVR---NVHDLGLCDGLVIPGGESTTVRRCCAYE
3efeD           --------FKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPIL
3efeB           --LNSGRYFKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPIL
3bgyB           --------NNYLDISLIFPDK--NVYRVSLFNQEQIGEFITKSKASSNDISRYIVSLDPS----------
3d54D           --------ACVVVYPGNCDRDAYHALEINGFEPSYVGLDDKLDD-----YELIILPGGFSYGDYLRPGAV
2an1C           --------IGIVGHTTHEM--LYRWLCDQGYEVIVEQQIAHELQVPTGTAEIGQQADLAVVVGGGNMLGA
2d13A           ----------------------------------------------------------------------
3efeA           --------FKKDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPIL
3cy6A           ------DVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
3cz9A           ------DVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
3dkyE           --------KLETLGVPMAISPLHDKDHVLYIAKNPVTADSVRKKIKLLLGVQVVLNVENMYLYHESKDAI
3efeC           ----------KDLAPLKVITVGANKEMITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQPIL
3czaA           ------DVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
1aa7A           --------DVFAGKNTDLEVLMEWLKTRPILSPLGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKA
1aa7B           --------DVFAGKNTDLEVLMEWLKTRPILSPLGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKA
3b38A           ------DVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
3efeF           ---GRYFKKDLAPLKVITVGANKEMITTMGGLRI--KPDISLDECTLESKDLLILPGGTTWSEEIHQPIL
3b36A           ------DVLRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
3b3aA           ------DVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
3bweD           -------LVILAK-GAEEETVIPVDVRRAGIKVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
2an1D           --------IGIVG----THEMLYRWLCDQGYEVIVEKVPTGTLAEIGQQADLAVVVGGDGNML-----GA
1cf9A           -------------------KLLYSRMGEVTADDGTVPIAATFAGAPSLTVDAVIVPCGNIADIADNGDAN
3bweE           ----------VRRAGIKVTGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQSAAVKEI
2d13C           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2an1B           --------IGIVGHTTHEMRWLCDQGYEVIVEQQIAHVPTGTLAEIGQQADLAVVVGGDGNMLG-----A
1ct9B           ----------------------------------------------------------------------
2ab0A           ------------------------------------LADAPLVEVADGEYDVIVLPGGIKGAERDSTLLV
3efbA           ----------------------------------------------------------------------
1ct9D           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNILKNLTADEECWMSHGDRVEE
3dlaB           --------------------------GEGESTTDLAWDGQTMIWENGALLAESERFPKGVRRSVADVDTE
2dplA           ----------------------------------------------------------------------
3dlaC           --------------------------GEGESTTDLAWDGQTMIWENGALLAESERFPKGVRRSVADVDTE
3a4iA           ----------------------------------------------------------------------
2c5sA           ---------EYILVRYGEMGKNRSLKDNVKFKLDATHDRMYIQLNGEDHEAVSERLKDVFGIHKFNLAMK
2dplB           ----------------------------------------------------------------------
3dlaA           --------------------------GEGESTTDLAWDGQTMIWENGALLAESERFPKGVRRSVADVDTE
3dlaD           --------------------------EGESTTDLAWDGQTMIWENG-ALLAESERFPKGVRRSVADVDTE
2derA           ----------------------------------------------------------------------
2deuA           ----------------------------------------------------------------------
3b9xA           ----------------------------------------------------------------------
2a9vB           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVH-SENIFGGLPSEITVWENHNDEIIN
1bsuA           ----------------------------------------------------------------------
2d7jA           LEHYDEFNVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEDEIFKGLPKRLKVWESHMDEVKE
2a9vD           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSVHSE-NIFGGLPSEITVWENHNDEIIN
2a9vC           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKVSV-HSENIFGGLPSEITVWENHNDEIIN
2e18A           ----------------------------------------------------------------------
3b9xD           ----------------------------------------------------------------------
2derB           ----------------------------------------------------------------------
3dpiA           ----------------------------------------------------------------------
2a9vA           GKYIDDHNYPILGICVGAQFIALHFGASVVKAKHPEFGKTKV-SVHSENIFGGLPSEITVWENHNDEIIN
3b9xC           ----------------------------------------------------------------------
2e89D           ----------------------------------------------------------------------
3dfyA           ---------------YGEASPSFRVNGERVEALLAIENAVREMITGIDVRNYARIFEITDRLFGFPSLAV
2detA           ----------------------------------------------------------------------
2dyiA           ----------------------------------------------------------------------
1bxrB           IQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEK----NVVMITAQNHGFAVDEAT
1c30B           IQKFLETDIPVFGISLGHQLLALASGAKTVKMKFGHHGGNHPVKDVE----KNVVMITAQNHGFAVDEAT
1bgbB           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
1cs0B           AIQKFLETDIPVFGILGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNV------VMITAQNHGFAVAT
2d13B           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
1a9xB           AIQKFLETDIPVFGILGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNV------VMITAQNHGFAVAT
2e21B           ----------------------------------------------------------------------
2abwB           NDFIHVLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITICRNFYFKKDLTAACIRAPYIREI
3bl5A           ----------------------------------------------------------------------
2e21A           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
1b97A           ----------------------------------------------------------------------
3cl6A           NTRRLVM-----EEGGFLYDCDTYDDDLPYWEPNNPTGKPHLVIPYTLDTNDMRFTQVQGFNKGDDFFEY
3efbC           ----------------------------------------------------------------------
1az0A           ----------------------------------------------------------------------
2abwA           NDFIHVLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITICRNFNDSFICSLNCIRAPYIREI
3efeD           ERQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPKGEKFYELGPAVSDANLVTASGIAP
3efeB           ERQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVANLVTASGIAP
3bgyB           DDIEIVYKNRGSGKLIGIDNWAITIKSTEEIPLVAGSKISKPKITGSERI---------MYRYKTRYSFT
3d54D           EKIAFEIGKLIMGINGFQILIEMGLLKGALLQNSSGKFICKWVDLIVENNDTPFTNAFEIPIAHGFGRYV
2an1C           ARTLARYDINVIGINRGNLGFLTDLDPDNARYISEKRFLLEAQVCQQDRQKRISTAINEHPGKHMIEFEV
2d13A           ----------------------------------------------------------------------
3efeA           ERQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVSNLVTASGIAP
3cy6A           LKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGG-HYTYSENRVEKDGLILTSRGPGT
3cz9A           LKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGG-HYTYSENRVEKDGLILTSRGPGT
3dkyE           AKKKHV--YDKADIKLINNFDDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDF---IDENGETYGL
3efeC           ERQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPKGEKFYELGPAVSDANLVTASGIAP
3czaA           LKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGG-HYTYSENRVEKDGLILTSRGPGT
1aa7A           VKLYEITFHGAKEISLSYSAGALASCMGLIYNRMVAFGLVCA----------------------------
1aa7B           VKLYRKLFHGAKEISLSYSAGALASCMGLIYNRMVAFGLVCA----------------------------
3b38A           LKEQENRKGLIAVICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGH-YTYSENRVEKDGLILTSRGPGT
3efeF           ERQALKIGTIVAAICGATDALANMGYLDTRKHTSNNLEYTKMVCPNYKGEKFYELAVSDANLVTASGIAP
3b36A           LKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMN-GGHYTYSENRVEKDGLILTSRGPGT
3b3aA           LKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENEVEKDGLILTSRGPGTS
3bweD           LKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKNGG--------HYTYSENRVEKDGLIL--
2an1D           ARTLARYDINVIGINRGNLGFLTDLDPDNALQQLSDVLEGRYISEKRFLLEAQVCQQDRAINEVVLHPGK
1cf9A           YYEAYKHLKPIALAGDARKFKATIKIADQGEEGIVEADSADGSFM--DELLTLM--AAHRVWSRIPKIDK
3bweE           LKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKNG--------GHYTYSENRVEKDGLI---
2d13C           ----------------------------------------------------------------------
1c4fA           ----------------GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYKFICTTGLVTTFVQCFSR
2an1B           ARTLARYDINVIGINRGNLGFLTDLDPDNALQQLSDVLEGRFLLEAQVCQQDRQKRISTAINEVVLHPGK
1ct9B           ----------------------------------------------------------------------
2ab0A           EKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPT------LKDKIPAEQWLDKRVVWDARVKLLTS
3efbA           ----------------------------------------------------------------------
1ct9D           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVLKSFLFDICGCSGSWSMGSFLDEAVK
3dlaB           LLRSERLRMGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPFVPADPLQQDCYEAYNIQVS
2dplA           ---------------------------------------------------------------FVEEKVR
3dlaC           LLRSERLRMGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPFVPADPQQQDCYEAYNIQVS
3a4iA           ---------------------------------------------------------------FVEEKVR
2c5sA           VPSELEDIKKGALAAFLQVKG-DVKTFKITVHRSYKHFPMRTMELLPEIGGILENTEDITPDVNVRVEIR
2dplB           ---------------------------------------------------------------FVEEKVR
3dlaA           LLRSERLRMGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPPQRLQQDCYEAYNIQVSGLE
3dlaD           LLRSERLRMGTFDDNRRHHRELTESFRRIDFALDPPAGDIGLLREVERFPFVPADPQQQDCYEAYNIQVS
2derA           ----------------------------------------------------------------------
2deuA           ----------------------------------------------------------------------
3b9xA           ----------------------------------------------------------------------
2a9vB           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI-GICASYREIQK---------
1bsuA           --------------------------------------------------------------------RS
2d7jA           LPPKFKILARSETCPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCG-----------------
2a9vD           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI-GICASYREIQKENF------
2a9vC           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI-GICASYREIQKENF------
2e18A           ------------------------------------------------------------------ERIL
3b9xD           ----------------------------------------------------------------------
2derB           ----------------------------------------------------------------------
3dpiA           ------------------------------------MSRPDQAARRRAIAAELHVSPTFDARDEAERRIG
2a9vA           LPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFI-GICASYREIQK---------
3b9xC           ----------------------------------------------------------------------
2e89D           ----------------------------------------------------------SRVIRKVLALQN
3dfyA           QFATLDALSQELGTQVCYLLGGKRDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKVGENLKEDIEAVE
2detA           ----------------------------------------------------------------------
2dyiA           ----------------------------------------------------------------------
1bxrB           LPANLRVTHSLFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIELIEQYRKT------------
1c30B           LPANLRVTHSLFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIELIEQYRKT------------
1bgbB           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
1cs0B           LPANLRVTHKSFDGTLQGIHRTDKPAFSFQGHPEASPGPDAAPLFDHFIELIEQYRKT------------
2d13B           ----------------------------------------------------------------------
1ee1B           --------------------------------------------MQEKIMRELHVKPSIDPKQEIEDRVN
1a9xB           LPANLRVTKSLFDGTLQGIHRTDKPAFSFQGNPEASPGPDAAPLFDHFIELIEQYRKT------------
2e21B           ----------------------------------------------------------SRVIRKVLALQN
2abwB           LSDEVKVLATFSHESNIIAAVEQNNCLGTVFHPELLP---HTAFQQYFYEKVKNYKYSL-----------
3bl5A           ----------------------------------------------------------------------
2e21A           ----------------------------------------------------------SRVIRKVLALQN
3dpiB           ------------------------------------------AARRRAIAAELHVSPTFDARDEAERRIG
1b97A           ----------------------------------------------------------------LRSDLI
3cl6A           LKDAFDVLY--------AEGAEAPKMLSIGLHCRLIGRPARLAALQRFIEYAKSHEQVWFTR--RVDIAR
3efbC           ---------------------------------------------------VVSGNDEDEETQLAGLHGA
1az0A           --------------------------------------------------------------------RS
2abwA           LSDEVKVLATFSHESNIIAAVEQNNCLGTVFHPELLP---HTAFQQYFYEKVKNYKYSL-----------
3efeD           LEFAMEVLKKIDVFTLDALHSWYNLTHKPEYFFQLMNSI-------------------------------
3efeB           LEFAMEVLKKIDVFTLDALHNLNKTHKPEYFFQLMNSINK------------------------------
3bgyB           INKNSRIDI-TDVKSSPIIWKLMTVPSNYELELELINKIDINTLESELVFMII-----------------
3d54D           KIDDVNVVLRYVKDVIAGVLNESGNVFGLMPHPELIGGEDGKKVFQSIL---------------------
2an1C           YIDETFAFSQRSDGLIISTTAYSLSAGGPILTPSLDAIT-LVPMFPHTLSALVINSSST-----------
2d13A           ----------------------------------------------------------------------
3efeA           LEFAMEVLKKIDVFTLDALHSWYNLTHKPEYFFQLMNSI-------------------------------
3cy6A           SFEFALAIVEALNGKEVAAQVKAPLVL-------------------------------------------
3cz9A           SFEFALAIVEALNGKEVAAQVKAPLVL-------------------------------------------
3dkyE           TINLVNEVIAG-----------------------------------------------------------
3efeC           LEFAMEVLKKIDVFTLDALSWYNLNKTHKPEYFFQLMN--------------------------------
3czaA           SFEFALAIVEALNGKEVAAQVKAPLVL-------------------------------------------
1aa7A           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
3b38A           SFEFALAIVEALNGKEVAAQV--KAPLVLK----------------------------------------
3efeF           LEFAMEVLKKIDVFTLDALSWYNLNKTHKPEYFFQLMN--------------------------------
3b36A           SFEFALAIVEALNGKEVAAQVKAPLVL-------------------------------------------
3b3aA           FKFALAIVEALNGKE---VAAQVKAPLVLK----------------------------------------
3bweD           -------TSRGPGTSFEFALAIVEALNGKEVAAQVKAPL-------------------------------
2an1D           VAHMIEFEVYIDETFAFSSTAYSLSAGGPILTPSLDAITLVPMFPHTLSARPLVINSSSTIRLRFSH---
1cf9A           IP--------------------------------------------------------------------
3bweE           ------LTSRGPGTSFEFALAIVEALNGKEVAAQVKA---------------------------------
2d13C           ----------------------------------------------------------------------
1c4fA           YPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEY
2an1B           VAHMIEFEVYIDETFAGPILTPS--LDAITLVPMFPHTL-------------------------------
1ct9B           ----------------------------------------------------------------------
2ab0A           QGPGTAIIIDLLVGREKAHEVASQLVMAAGIY--------------------------------------
3efbA           -------------------------------------------------------------------GAQ
1ct9D           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVD
3dlaB           GLEQALDYPKVVIGVSGGLDSTHALIVATH-AMDREGRPRSDILAFALPGKNN-AIKLARALGVTFSEID
2dplA           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
3dlaC           GLEQRLDYPKVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFALPGFKNNAIKLAR-ALGVTFSEID
3a4iA           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
2c5sA           SGYSYIMCDERMGALSGGIDSPVAAYLTMKR-GVSVEAVHFHSPPFTSERAKQKVIDLAQELTKYCKRVT
2dplB           EIRETVGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLRKGEPEFVVKTFRDEFGMNLHYVD
3dlaA           QRLRALDYPKVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFALPGHTKNNAIKLARALGVTFSEID
3dlaD           GLEQRLRYPKVVIGVSGGLDSTHALIVATHAMDR-EGRPRSDILAFALPGFNNAIK-LARALGVTFSEID
2derA           --------KKVIVGMSGGVDSSVSAWLLQQQ-GYQVEGLFMKNWEEDDGEEYCTAQAVCDKLGIELHTVN
2deuA           --------KKVIVGMSGGVDSSVSAWLLQQQ-GYQVEGLFMKNWEEDDGEEYCTAQAVCDKLGIELHTVN
3b9xA           --------RKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEINVPVYA
2a9vB           ----------------------------------------------------------------------
1bsuA           DLINALYDENQKYDVCGIISAEGKIYPLGSDTKV-------LSTIFELFSRPIINKIAEKHGYIVEEPKQ
2d7jA           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2e18A           EFIREKGNNGVVIGISGGVDSATVAYLATKALGEKVLGLIMPYFENKDVEDAKLVAEKLGIGYKVINIKP
3b9xD           --------RKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEINVPVYA
2derB           -------AKKVIVGMSGGVDSSVSAWLLQQQ-GYQVEGLFMKNWEEDDGEEYCTAQAVCDKLGIELHTVN
3dpiA           FVADYLGLRACVLGISGGIDSSTAGRLAQLA-VERLRASGYDARFLPYGAEADARRALAFVRADETLTVD
2a9vA           ----------------------------------------------------------------------
3b9xC           --------RKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEINVPVYA
2e89D           DEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYFVALAHFNHMLRESAERDEFCKEFAKERNMKIFVGK
3dfyA           EIAKVTRGAKYIVDANMGYTQKEAVEFARAVYQKGIDIAVYEQPVRR--EDIEGLKFVRFHSPFPVAADE
2detA           -------AKKVIVGMSGGVDSSVSAWLLQQQ-GYQVEGLFMKNWEEDDGEEYCTAQAVCDKLGIELHTVN
2dyiA           -------------------------------------------RVYVEGHGWRAIEDLYR----------
1bxrB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1bgbB           -------------SLRSDLINALDVCGIISAEG-KIYPLGSDTKVLSTIFELF-SRPIINKIAEKHGEEP
3bl5E           --------EKAIVVFSGGQDSTTCLLWALKE-FEEVETVTFHYNQRHSQEVEVAKSIAE-KLGVKNHLLD
1bsuB           ---------------------SLRSDLINALYDEDVCGIISAEGKIYPL--GSDTKVLSTIFELFSRPII
1cs0B           ----------------------------------------------------------------------
2d13B           -----VGLADVAVLYSGGKDSNYALYWALKS-GLRVRYLVSMVS-----ENVELTSLQARALGIPIIKGF
1ee1B           FLKQYVKKTGFVLGISGGQDSTLAGRLAQLAVESEGGDAQFIAVRLPHGEDDLALKFIKPDKSWKFDIKS
1a9xB           ----------------------------------------------------------------------
2e21B           DEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYEVALAHFNHMLRESERDEEFCKEFAKERNMKIFVGK
2abwB           ----------------------------------------------------------------------
3bl5A           --------EKAIVVFSGGQDSTTCLLWALKE-FEEVETVTFHYNQRHSQEVEVAKSIAE-KLGVKNHLLD
2e21A           DEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYFVALAHFNHMLRESERDEEFCKEFAKERNMKIFVGK
3dpiB           FVADYLRTAACVLGISGGIDSSTAGRLAQLA-VERLRASGYDARFVAMRQEADARRALAFVRADETLTVD
1b97A           NALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI---INKIAEKH---------GYIVEEP
3cl6A           HWHATHP---------------------------------------------------------------
3efbC           QLLDRLLEPGDIVGFSWGRAVSLVENLPQAGQSRQLICVPIIGGPSGKLESRYHVNTLTYSA---AAKLK
1az0A           DLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINK---------------------
2abwA           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bgyB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
2d13A           -----VGLADVAVLYSGGKDSNYALYWALKS-GLRVRYLVSMVS----ENNVELTSLQARALGIPIIKGF
3efeA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3dkyE           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
1cf9A           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2d13C           ------GLADVAVLYSGGKDSNYALYWALKS-GLRVRYLVSMVSEELTSL-------QARALGIPIIKGF
1c4fA           NYN-------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
1ct9B           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
3efbA           LLDRLLEPGDIVGFSWGRAVSALVENLPQAGQSRQLICVPIIGGPSGKLESRYHVNTLTYSA---AAKLK
1ct9D           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ASERFLGKLQGVTDPEQKRKIIGTEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGTATAEVIKSHHNVG
3dlaB           TARLMLHTIGHVTFENVQAGLRTDYLFRIANQR-------GGIVLGTGDLSELALGWST-----------
2dplA           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTIAPL-------------------
3dlaC           IGDTARLMLHTIGHPYSVGEKVYDVTFENVQAGLR--TDYLFRIANQRGGIVLGTG------DLSELALG
3a4iA           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTIAPNLKL----------------
2c5sA           LHLVPFTEVQKTINKEIPSSYSMTVMRRMMMRITERIAEALAITTGESLGQVAS---------QTLDSMH
2dplB           AQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIG-AEYLIQGTILKLIEP----------------
3dlaA           IGDTARLMLHTIGHDVTFENVQAGLRTDYLFRIANQRG---GIVLGTGDLSELALGWST---YGVGDQMS
3dlaD           IGDTARLMLHTIGHPYSVGEKVYDVTFENVQAGLR--TDYLFRIANQRGGIVLGTGDLSELAGWSTYGVG
2derA           FAAEYWD---NVFELFLAEYKAGRTPNPDILEFAAEDLGADYIATGHYVRRADVDGKLDSNKDQSYFL-Y
2deuA           FAAEYW---DNVFELFLAEYKAGRTPNPDILEFAAEDLGADYIATGHYVRRADVDGKGLDSNKDQSYFLY
3b9xA           GMPQGDTGLDGPVFEPLTRQAESTHAVKYIIDTLMASGDITLVPVGPLSNIAVRMQPAILPKIREIVLMG
2a9vB           ----------------------------------------------------------------------
1bsuA           QNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEK-IKFTLGGYTSFI---------------RNNTKNIV
2d7jA           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2e18A           IVDSFVENLELNLDRKGLGNIMSRTRMIMLYAHANSLG---RIVLGTSNRSEFLTG------YFTKWGDG
3b9xD           GMPQPIMRLDGPVFEPLTRQAESTHAVKYIIDTLMASDDITLVPVGRMQPAILPKYGTGNFTPSAEFNIF
2derB           FAAEYW---DNVFELFLAEYKAGRTFKAFLEFAAEDLGA-DYIATGHYVRRADVDGKLDSNKDQSYFL-Y
3dpiA           VKPAADAMLAALAAGGLAYLDHAQQDFVLGNIKARERMIAQYAVAGARNGVVIGTDHAAESVMGFFTK--
2a9vA           ----------------------------------------------------------------------
3b9xC           GMPQPIMRLDGPVFEPLTRQAESTHAVKYIIDTLMASGDITLVPVGPLSNIAVAMRPAILPKIREIVLMG
2e89D           EDVRAFAKENRMSLEEAGRFLRYKFLKEILESE-----GFDCIATAHHLNDLLET---SLLFFTRGTGLD
3dfyA           FDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSG----------LKLMIGCMGESLGINQSVHFAL
2detA           FAAEYW---DNVFELFLAEYKAGRTPNKAFLEFAAEDLGADYIATGHYVRRADVDGKLDSNKDQSYF-LY
2dyiA           VGEELVVHLAGVTDRTLAEALVGLRVY-AEVADLPPLEEGRYYYFALIGLPVYVEGRQVG-EVVDILDAG
1bxrB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1bgbB           KQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKIKFTLGGTSFIRNNT--KNIVY-------------PFD
3bl5E           M--SLLNQLAPNALTSTFVPGRNLVFLSFASILAYQIG-ARHIITGVCETDFSGYPDCRDEFVKSCNVTV
1bsuB           NKIAEKHGYIVEEPKQQNHYPDFTLYKPSE-----PNKKIAIDIKTTYTNIKFTLGGYTS-FIRNNTKNI
1cs0B           ----------------------------------------------------------------------
2d13B           TEVEDLKNV--LEGLKVDGIVAGALQKERIENVARELGPAWEKDPYQYMLEIIKLGFKV---VFVAVSAY
1ee1B           TVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGQEGLLVLGTDHAAEAVTGF------FTKYGDG
1a9xB           ----------------------------------------------------------------------
2e21B           EDVRAFAKENRMSLEEAGRFLRYKFLKEILESE-----GFDCIATAHHLNDLLET---SLLFFTRGTGLD
2abwB           ----------------------------------------------------------------------
3bl5A           MSLLN--QLAPNALTSTFVPGRNLVFLSFASILAYQIGARHII-----TGVCEGYPDCRDEFVKSCNVTV
2e21A           EDVRAFAKENRMSLEEAGRFLRYKFLKEILESE-----GFDCIATAHHLNDLLET---SLLFFTRGTGLD
3dpiB           VKPAADAMLAALAAGGLAYLDHAQQDFVLGNIKARERMIAQYAVAGARNGVVIGTD---------HAA--
1b97A           KQLNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEK---IKFTLGGYTSFIRNNTIVYPFDQYIAHWIIG
3cl6A           ----------------------------------------------------------------------
3efbC           GESHLADFPALLDNPLIRNGIQSQHFKTISAYWDNL--DIALVGIGSPARQVAGDIDIHGAVETNSEKTL
1az0A           -----IAEKHGYIVEEPKQQNHYPDFTLYKPSEPNK--KIAIDIKTTYTNKENEKGGYTSFIRNNTKNIV
2abwA           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bgyB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
2d13A           TEKEKEVEDLKNVLEGLKVDGIVAGALERIENVARELGKVYTPAWEKDPYQYMLEIIKLFKVVFVAVSAY
3efeA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3dkyE           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
1cf9A           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2d13C           TKKEVEDLKNVLEGLKVDGIVAGAYQKERIENVARELG-LKVYTPAWEKDPYQYMLEIIKLGFKVVFVAV
1c4fA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
1ct9B           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
3efbA           GESHLADFPALLDNPLIRNGIQSQHFKTISAY--------------------------------------
1ct9D           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GLPEDMKFDLVEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVT
3dlaB           -YGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGELQSVLDTEITSEAKVGPFALQDFSLFQVL
2dplA           ------NLKLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
3dlaC           TYGVGDQMSHYNVNAGVPKTLIQHLIRWVISA---GEFGEKVGEVLQSVLDTEAKVGPFALQDFSFQVLR
3a4iA           ----------IEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
2c5sA           TINEVTNYPVIRPLITMDKLEIIKIAEEIGTY-DISIRPYKPKREKANRFEAKYDFTPLEAVANKETMVL
2dplB           -------------LRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVE
3dlaA           HY---------NVNAGVPKTLIQHLIRWVISAGEFGEKVGE----VLQSVLDTEITAKVGPFALQDFSLF
3dlaD           D-----QMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDTEEAKVGPFALQDFSLFQVLR-
2derA           TLSHEQIAQSLFPVGELEKPQVRKIAEDLGLFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHT-----
2deuA           TLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRK
3b9xA           GAYGTG---NFTPSANIFADEAARVVFTSGVPLVM--------MGLDLTNQTVCTPDVIARMERAGGPAG
2a9vB           ----------------------------------------------------------------------
1bsuA           YPFDQYIAWIIGYVYTRVKYNINELNEIPKVKVFLQDKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFD
2d7jA           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2e18A           A-------SDYAPIINLYKTEVWEIAKRIGVPERIVKKKPSAGLGISYNLLDEILWRMIDLKIGKEEIAK
3b9xD           ADPEAARVVFTSGVPLVMMG--LDLTNQTVCTPDVIARMERAGGPAG-ELFSDIMNFTLKTQFENYGLAG
2derB           TLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVREFLGRYLPAQPGKIITVDGDEIGEHQGLMYH------
3dpiA           ---FGDGGADVLPLAGLTKRRVRALARMLGADEPLVLKTPTADLETLRPQRPHITYEQIDDFLEGKPMDD
2a9vA           ----------------------------------------------------------------------
3b9xC           GAYGTGNFTPSAEFNIFADPEAARVVFTSGVPLVM--------MGLDLTNQTVCTPDVIARMERAGGPAG
2e89D           GLIGFLPKEIRRPLYYVKRSEIEEYAKFKGLR-WVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFL
3dfyA           GTGAFEFHDLDSHLMLVFRGKFIQDGPRMR----------------------------------------
2detA           TLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVREFLGRYLPAQPGKIITVDGDEIG--------------
2dyiA           AQ-DVLIIRGVGERLRDRAERVPLQAPYVRVEEGSIHVDPIPG---------------------------
1bxrB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1bgbB           QYIAHWIIGYVYTRVSLKTYNINELNEIPKVKVFLQDKWVIAGAGSGNTTNIGSIHAHYDFVEG------
3bl5E           NLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLIIADGCGECPACHLRSKGYEEYMV------
1bsuB           VYPFDQYIAYVYTRVSLKTYNINELNEIPKVKVFLQDKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFD
1cs0B           ----------------------------------------------------------------------
2d13B           GLNESWLYKNLEELKKLSEKYGIHIAGEGGEFETFVLDMPFFKAKIVIDDAEKFWDGLSGKFIIKR----
1ee1B           GA-------DLLPLTGLTKRQGRTLLKELGAPERLY---LISYDEIDDYLEGEVSAKVSEALEKRYSMTE
1a9xB           ----------------------------------------------------------------------
2e21B           GLFLPKEEVIRRPLYYVKRSEIEEYAKFKGLR-WVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFL
2abwB           ----------------------------------------------------------------------
3bl5A           NLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNNGIIADGCGECPACHLRSKGYEEYMV------
2e21A           GLIGFLEEVIRRPLYYVKRSEIEEYAKFKGLR-WVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFL
3dpiB           ---ESVMGADVLPLAGLTKRRVRALARMLGAD---EPAYGITYEQIDDFLEGPMDDAVAETVLRF-----
1b97A           YVY----TRVATRKSSLKTYNINELNEIPKVKVFLQDKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFD
3cl6A           ----------------------------------------------------------------------
3efbC           SIENKLKARYSIGIASEEKYSGIIGALRGKYINCLV----------------------------------
1az0A           YPFDQYIAWIIGYVYTRVKYNINELNEIPKVKVFLQDKWVIAGAGSGNTTNIGSIHAHYKDFVEGKGIFD
2abwA           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bgyB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
2d13A           GLNESWNYKNLEELKKLSEKYGIHIAGEGGEFETFVLDMPFFKAKI------VIDDAEK-FWDGLSGKF-
3efeA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3dkyE           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
1cf9A           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2d13C           SAYGLNESWLGRELNYKNLEELKKLSEKYGIH--------------------------------------
1c4fA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
1ct9B           -INPQDKMCKME--KHILRECFEAY-----LPASVAWRQDGVGDTLKEVAAQQVSDQQLETARFRFPYNT
2ab0A           ----------------------------------------------------------------------
3efbA           ----------------------------------------------------------------------
1ct9D           ---------------------------EAYLPASVAWRQDGVGDTLKEVAAQQVSDQQLETARFRFPYNT


                         .         .         +         .         .         .         .:490
query           DEIKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLGNISTRLVN
3dlaB           RYFRPSKIAFLAWHAWNDAERGNWPPGFPKSERPSYAEIRHWLQIFVQRFYSFSQFKRSAL-PNGPKVSH
2dplA           EEVERAGLRP--WQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITS
3dlaC           YGFRPSKIAFLAWHAWNDAERGNWPPGFPKSERPSYSLEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSH
3a4iA           EEVERAGL--RPWQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITS
2c5sA           QTVE------------------------------------------------------------------
2dplB           EEVERAGLRP--WQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMTANAMNVPWEVLQRIAFRITS
3dlaA           QVLRYGFRPSKIAFLAWHAWNDAERGNWPP-----GFPKSERPSYSLAEIRHWLQIFVQRFYSFSQFKRS
3dlaD           YGFRPSKIAFLAWHAWNDAERGNWPPGFPKSERPSY---------SLAEIRHWLQIFVQRFYSFSQFKRS
2derA           -----------LGQRKGL-----GIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLH
2deuA           GLGIGGTKEGTEEPWYVVDKDVNNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTRCTVKTRYRQTD
3b9xA           ELFSDKTQFENYGLAGGPVHDATCIGYLINPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVKPANTKVGI
2a9vB           ----------------------------------------------------------------------
1bsuA           SE--------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2e18A           DLGIPLSLVERVEELIKKSEHKRRIGPSFEDLIV------------------------------------
3b9xD           GPVHDALINPDGIKTQEMYVEVDVNSGPCYGRTVCKPANTKVGITID--TDWFWGLVEECVRGYI-----
2derB           ----------------------------------------------------------------------
3dpiA           AVAE------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
3b9xC           ELFSDYLINPDGIKTQEMYVEVDVNSGPCYGRTVCKPANTKVGITID-----------------------
2e89D           KMVKVLRAEREFLEAQKLYKEVKKGNCLDVKKLKEKPLALQRRVIRKFIGEKDYEKVELVRSLLEKGGEV
3dfyA           ----------------------------------------------------------------------
2detA           ----------------------------------------------------------------------
2dyiA           ----------------------------------------------------------------------
1bxrB           ----------------------------------------------------------------------
1c30B           ----------------------------------------------------------------------
1bgbB           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
1bsuB           SE----DEFLDYWRNY------------------------------------------------------
1cs0B           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
1ee1B           HKRQVASMFDDWWK--------------------------------------------------------
1a9xB           ----------------------------------------------------------------------
2e21B           KMVKVLRAERE-----------------------------------------------------------
2abwB           ----------------------------------------------------------------------
3bl5A           ----------------------------------------------------------------------
2e21A           KMVKVLRAERE-----------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
1b97A           SEDEFLDYWRN-YERTSQLRNDKYNNISEYRNWIYR----------------------------------
3cl6A           ----------------------------------------------------------------------
3efbC           ----------------------------------------------------------------------
1az0A           SE--------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
3bgyB           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
2d13A           -IIKRAHLE-------------------------------------------------------------
3efeA           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3dkyE           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
1cf9A           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
1ct9B           PTSKEAYLYREIFEELFPLPSAAE----------------------------------------------
2ab0A           ----------------------------------------------------------------------
3efbA           ----------------------------------------------------------------------
1ct9D           PTSKEAYLYREIFEELFPLPSAAE----------------------------------------------


                         *         .         .         .         .         +         .:560
query           EVAEINRVVYDITSKPPGTIEWE
3dlaB           GGALSPRGDWRAPSDMSARIWLD
2dplA           EIPEVGRVLYDITNKPPATIEFE
3dlaC           GGALSPRGDWRAPSDMSARIW--
3a4iA           EIPEVGRVLYDITNKPPATIEFE
2c5sA           -----------------------
2dplB           EIPEVGRVLYDITNKPPATIEFE
3dlaA           ALPNGPKVSHGGALSP-------
3dlaD           ALPNGPKVSHGGALSPMSARIW-
2derA           WVDREPFTTRYRQTDIPCTVKA-
2deuA           IPCTVKALDDD------------
3b9xA           TI---------------------
2a9vB           -----------------------
1bsuA           -----------------------
2d7jA           -----------------------
2a9vD           -----------------------
2a9vC           -----------------------
2e18A           -----------------------
3b9xD           -----------------------
2derB           -----------------------
3dpiA           -----------------------
2a9vA           -----------------------
3b9xC           -----------------------
2e89D           NLGKGKVLKR-------------
3dfyA           -----------------------
2detA           -----------------------
2dyiA           -----------------------
1bxrB           -----------------------
1c30B           -----------------------
1bgbB           -----------------------
3bl5E           -----------------------
1bsuB           -----------------------
1cs0B           -----------------------
2d13B           -----------------------
1ee1B           -----------------------
1a9xB           -----------------------
2e21B           -----------------------
2abwB           -----------------------
3bl5A           -----------------------
2e21A           -----------------------
3dpiB           -----------------------
1b97A           -----------------------
3cl6A           -----------------------
3efbC           -----------------------
1az0A           -----------------------
2abwA           -----------------------
3efeD           -----------------------
3efeB           -----------------------
3bgyB           -----------------------
3d54D           -----------------------
2an1C           -----------------------
2d13A           -----------------------
3efeA           -----------------------
3cy6A           -----------------------
3cz9A           -----------------------
3dkyE           -----------------------
3efeC           -----------------------
3czaA           -----------------------
1aa7A           -----------------------
1aa7B           -----------------------
3b38A           -----------------------
3efeF           -----------------------
3b36A           -----------------------
3b3aA           -----------------------
3bweD           -----------------------
2an1D           -----------------------
1cf9A           -----------------------
3bweE           -----------------------
2d13C           -----------------------
1c4fA           -----------------------
2an1B           -----------------------
1ct9B           -----------------------
2ab0A           -----------------------
3efbA           -----------------------
1ct9D           -----------------------