[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO50894.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1af7A.bssp"
#ERROR : Can't open dsspfile "1bc5A.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3e38A.bssp"
#ERROR : Can't open dsspfile "2e58D.bssp"
#ERROR : Can't open dsspfile "2e58B.bssp"
#ERROR : Can't open dsspfile "2e58A.bssp"
#ERROR : Can't open dsspfile "1e50Q.bssp"
#ERROR : Can't open dsspfile "3c6mA.bssp"
#ERROR : Can't open dsspfile "1eanA.bssp"
#ERROR : Can't open dsspfile "1e50A.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "1co1A.bssp"

## Summary of PDB Search
:256
    1e-36  33%  1af7A  [x.x.x] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE CHER
    2e-33  33%  1bc5A  [a.58.1 - c.66.1] CHEMOTAXIS RECEPTOR METHYLTRANSFERASE
    1e-22   5%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    1e-11  12%  3e38A  [x.x.x] TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE
    5e-10   8%  2e58D  [x.x.x] MNMC2
    1e-09   9%  2e58B  [x.x.x] MNMC2
    3e-08   8%  2e58A  [x.x.x] MNMC2
    5e-05  14%  1e50Q  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    2e-04  10%  3c6mA  [x.x.x] SPERMINE SYNTHASE
    3e-04  11%  1eanA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    6e-04  12%  1e50A  [b.2.5] CORE-BINDING FACTOR ALPHA SUBUNIT
    7e-04  10%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    8e-04  14%  1co1A  [b.2.5] CORE BINDING FACTOR ALPHA
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSE
1af7A           --HFRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSWQAFINALTTNLTA
1bc5A           --HFRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSWQAFINALTTNLTA
3b55A           IKGLIPVTKDNTFESLTKEEKEKYVLDAKTISALLEENKSYLNGKSKEFAWIKQNAFTTLATPPDKPADF
3e38A           ----------------------------------------------------------------------
2e58D           EEYLKNYLESYLRKKEVSLTEEEFNVILREFLRFAYNPEE-SGQEIADTADGSKTLIHKTYGEPYHSQTA
2e58B           EEYLKNYLESYLRKKEVSLTEEEFNVILREFLRFAYNPE-ESGQEIADTADGSKTLIHKTYGEPYHSQTA
2e58A           -----NYLESYLRKKEVSLTEEEFNVILREFLRFAYNPEES-GQEIADTADGSKTLIHKTYGEPYHSQTA
1e50Q           ----------------------------------------------------------------------
3c6mA           ----------------------------------------------------------------------
1eanA           ----------------------------------------------------------------------
1e50A           ----------------------------------------------------------------------
2an3B           -----------------------------------DSAPGQAAVASAYQRFEPRAYLRNNYAP---PRGD
1co1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAA
1af7A           FFREAHHFPIL----AEHARRRHGEYRVWSAAASTGEEPYSIAITLADALGMARWKVFASDIDTEVLEKA
1bc5A           FFREAHHFPIL----AEHARRRHGEYRVWSAAASTGEEPYSIAITLADALAPGRWKVFASDIDTEVLEKA
3b55A           YLKHDIAYENA-----KWTEEHLGKTIVWGHNGHVSKTNLSFIYPKVAGQHLAEYIGTSVYEGQYNVKNS
3e38A           ----------------------------------------------------------------------
2e58D           GAIRESLYKFVRPSRILEKAKERKVIRILDVGFGLGY--NLAVALKHLWEVNPKLRVEIISFEKELLKEF
2e58B           GAIRESLYKFVRPSRILEKAKERKVIRILDVGFGLGY--NLAVALKHLWEVNPKLRVEIISFEKELLKEF
2e58A           GAIRESLYKFVRPSRILEKAKERKVIRILDVGFGLGY--NLAVALKHLWEVNPKLRVEIISFEKELLKEF
1e50Q           ----------------------------------------------------------------------
3c6mA           --------------------------------------------------------------DGGILCEI
1eanA           ----------------------------------------------------------------------
1e50A           ----------------------------------------------------------------------
2an3B           LCNPNGVPWKLRCLAQTFATGEVSGRTLIDIGSGPT-------VYQLLSACSHFEDITMTDFLEVNRQEL
1co1A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTRE
1af7A           RSGIYRLSELKTLSPQQLQRYFMPHEGLVRVRQELANYVEFSSVNLLEKQYNVPFDAIFCRNVMIYFDKT
1bc5A           RSGIYRLSELKTLSPQQLQRYFMRGTGPHEGLVRVRNYVEFSSVNLLEKQYNVPFDAIFCRNVMIYFDKT
3b55A           DGEFGPYGTLKSDDPNSYNYIFGQVKKDQFQHPIFAGITTEGPDIPKTVDIS----LGKAFDILVQIQKV
3e38A           -------------------------------------------EEVSRNEQGVTLSITNVTDLVLKLKKT
2e58D           PILPEPYREIHEFLLERVPEYEGERLSLKVLLGDARKRIKEVEN-------FKADAVFHDAFSPYKNPEL
2e58B           P---------ILPEPYREIHEFLLERVPEYEGERLSLKVLLGDARKRIKEVENFDAVFHDAFSPYKNPEL
2e58A           PILPEPYREIHEFLLERVPEYEGERLSLKVL-------LGDARKRIKEVENFKADAVFHDAFSPYKNPEL
1e50Q           ------------------------------------------------------PNFLCSVLPTHWRCNK
3c6mA           VKLKPKMVTMVEIDQMVICKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKGREFDYVINDLTAVPISTT
1eanA           -----------------------------------------------GELVRTDPNFLSSVLPTHWRSNK
1e50A           -----------------------------------------------GELVRTDPNFLCSVLPTHWRCNK
2an3B           GR-WLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHPLPADALVSAFCLEAVSPD
1co1A           ------------------------------------------------------PNFLCSVLPTHWRCNK


                         .         .         .         +         .         .         .:280
query           AQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVSPCFYRKx
1af7A           TQEDILRRFVPLLKPDGLLFAGHSENFSNLVR-EFSLRGQTVYAL-
1bc5A           TQEDILRRFVPLLKPDGLLFAGHSENFSNLVR-EFSLRGQTVYAL-
3b55A           SPSQV-----------------------------------------
3e38A           AHDTLLVYFRDTLKPHTRYTVRGFKQGIKGGDVNFEVTNF------
2e58D           WTLDFLSLIKERIDEKGYWV--------------------------
2e58B           WTLDFLSLIKERIDEKGYWV--------------------------
2e58A           WTLDFLSLIKERIDEKGYW---------------------------
1e50Q           TLPIAFKVVALGDVPDGTLVT-------------------------
3c6mA           WEFLILDLSMKVLKQDGKYFT-------------------------
1eanA           TLPIAFKVVALGDVPDGTLVT-------------------------
1e50A           TLPIAFKVVALGDVPDGTLV--------------------------
2an3B           LASFQRAHITTLLRPGGHLLL-------------------------
1co1A           TLPIAFKVVALGDVPDGTLVT-------------------------