[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for dred0:ABO51003.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2egvA.bssp"
#ERROR : Can't open dsspfile "2cx8B.bssp"

## Summary of PDB Search
:247
    1e-50  26%  2egvA  [x.x.x] UPF0088 PROTEIN AQ_165
    4e-32  36%  2cx8B  [x.x.x] METHYL TRANSFERASE
:247

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEVHCRILEQQEA
2egvA           MHVFYS--EERRGNLLILREGEVKHF-RVRRIEKDEEFGVIHE-GKIYVCKVRREDKREISCEIVEELET
2cx8B           --------------------------------------------------------------RVLEERRP


                         .         .         *         .         .         .         .:140
query           TSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAKKAAERVQRWQRVAVEAAKQC
2egvA           K-LPPKDITLYQSVTVDLKMDTIVRQATELGVLTFVPIISERSFQKEE--AILKKTEKWKRIVIEAMKQS
2cx8B           EREVGVEVVLYVALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEGEGK----LRRLRAVALEAAKQS


                         +         .         .         .         .         *         .:210
query           RRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLREVLQTRPMAPGQVYIFIGPXXXXXXXXXXX
2egvA           RRPIPMEIKKPVRLSDLIPESEENIILDNFYEGVKPKDVNL-------EAKTYSVVVGPEGGFSKRESQI
2cx8B           GRVVVPEVLPPIP----LKAVPQVAQGLVAHVGA-TARVREVLD----PEKPLALAVGPEGGFAEEEVAL


                         .         .         .         +         .         .         .:280
query           XXXXXXYPVTLGSRILRTETAGPAALTMVLYQFGxxx
2egvA           LREKGFKSVLLEPYTLRTETAVVSIVS----------
2cx8B           LEARGFTPVSLGRRILRAETAALALLALCTAGEG---