[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO48556.1

[Show Plain Result]


## Summary of Sequence Search
    1::371
    2::210     1e-06  31%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"
  179::405     5e-04  28%  434 aa  PF00521 DNA_topoisoIV "DNA gyrase/topoisomerase IV, subunit A"
    1::371

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDVTNWESNHTVI
PF02463         --LKRLELEGFKSFADKTILPFPGFTAIVGPNGSGKSNILDAIRFVLSAKSLRGGKLEDLIFAEGRKPVN
PF00521         -----------------EYIPGPDFP--TGGGIIGRSGIREA-YETGRG-SIRVRAKAEIEG--GRETIV


                         .         .         *         .         .         .         .:140
query           NTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTL
PF02463         SAEVELTGRLVSITRRIRSGDSEYYINGKKRLKDIQDLLEDTGIGPENYSIIASKPEERRLILEEAAGV-
PF00521         ITELPYQVNKAKLIEKIAELVKDKKIEGISDVRDESDRDGVRIV----IELKRDADAEVVLNNLYKKTKL


                         +         .         .         .         .         *         .:210
query           SPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFG
PF02463         -SKYKERKKEAEKKLKETQENLERLED---ILEELELQLEELEKQAEKAL--------------------
PF00521         QTSFSALFDGRPKYLSLK-EILKEFLEHRRTEFELEKAEERLHIL--EGLLIALNNIDEVIEIIR-----


                         .         .         .         +         .         .         .:280
query           LTGGTEELQAKYLSSLVLEPGLSEGQIYQVFSSSSKKIRQMELKRCQxxxxxxxxxxxxxxxxxxxxxxx
PF02463         ----------------------------------------------------------------------
PF00521         --GSLDSDEAK---AELMEEGLSEEQAEAILEMRLRRLTKLEIEKLE-----------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02463         ----------------------------------------------------------------------
PF00521         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxx
PF02463         ---------------------
PF00521         ---------------------