[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO48569.1

[Show Plain Result]


## Summary of Sequence Search
    1::151
    6::99      4e-19  48%  100 aa  PF00383 dCMP_cyt_deam_1 "Cytidine and deoxycytidylate deaminase
    1::151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRESLCDASAHAEILAMRKAAKHLGDWRL
PF00383         -----FMRLALEAAERAYPCGNFPVGAVLVDDGEIIATGYNGENAGGGPTVHAEMNAILNAARK-GGWRL


                         .         .         *         .         .         .         .:140
query           NDATLYVTVEPCAMCAGAIVQFRINRLVYGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00383         TGYTLYVTLEPCGMCAMALVHSRIKRVVFG----------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxx
PF00383         -----------