[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO48707.1

[Show Plain Result]


## Summary of Sequence Search
    1::472
    2::105     6e-08  39%  123 aa  PF01743 PolyA_pol "Poly A polymerase head domain"
   28::78      8e-05  47%  117 aa  PF01966 HD "HD domain"
    1::472

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTLDDQREMLRVV
PF01743         ---------------YLVGGAVRDLLLGRPPKDIDIATLAKLFRRARKIVGRRFGTVVLGGETIEVATFR
PF01966         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TNSWHLDFSPLRDEILEKDLFARDFTLNAMALPVSMGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         TEGYDGDRNPFVEEFLEEDAYRRDFTINALAYDLQTG---------------------------------
PF01966         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         ----------------------------------------------------------------------
PF01966         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVL
PF01743         ----------------------------------------------------------------------
PF01966         --------------------------------------------------------------------LL


                         .         *         .         .         .         .         +:350
query           KLAALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         ----------------------------------------------------------------------
PF01966         ELAALLHDIGKPEKALGLLDEEFGFEGHAELGAEILRKLLKRL---------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         ----------------------------------------------------------------------
PF01966         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01743         ----------------------------------------------------
PF01966         ----------------------------------------------------