[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO48823.1

[Show Plain Result]


## Summary of Sequence Search
    1::396
    4::324     3e-82  51%  336 aa  PF00202 Aminotran_3 "Aminotransferase class-III"
   46::272     2e-04  32%  359 aa  PF00266 Aminotran_5 "Aminotransferase class-V"
    1::396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT
PF00202         --------------------------RAEGAYLWDVDGNRYLDFLSGWGVVNLGHNHPEVVEAIAEQAAR
PF00266         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG
PF00202         LTHVSFGFTHEPAVELAEKLAELTPPDKVFFANSGSEAVEAALKLARK--RGYTGRTK--IIAFEGSYHG
PF00266         ----------EAREKLARLLGADP--DEVVFTSGGTEA----LNLVARGLARPLKPGD-EILVSATEHHS


                         +         .         .         .         .         *         .:210
query           RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVK
PF00202         RTLGALSLTGNSGYRTGFGPLLPGVIHVPYPDLYALERLIGDEIAAVIVEPIQGEGGVIPPPPGFLKALR
PF00266         NLLP---------WRELAERLGAEVTVIPVDDLEDLEAALTPDTALVSLTHVSNETGVIPIAE-----IA


                         .         .         .         +         .         .         .:280
query           QLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHAS
PF00202         ELCDEHGILLIFDEVQTGFGRTGKLFAFEHYGVTPDIVTLAKGLGGGLPLGAVLGRAEIMDAFAPGGHGG
PF00266         ALAHEHGALVVVDAAQAA----------GHVPIDVDLVFSAHKLYGPPGIGALYVRKRLLERLEPADGPS


                         .         *         .         .         .         .         +:350
query           TFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRxxxxxxxxxxxxxxxxx
PF00202         TFGGNPLACAAALAVLDILEEEGLLENAAELGAYLREGLEELAEKYPVVGDVR-----------------
PF00266         RFAGTPVAGIAGLGAALELLEEGGLE--------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00202         ----------------------------------------------
PF00266         ----------------------------------------------