[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for dred0:ABO48876.1

[Show Plain Result]


## Summary of Sequence Search
    1::151
    1::123     7e-08  32%  125 aa  PF00892 EamA "EamA-like transporter family"
    1::151

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxLFWSGAFITGKLAVREFPPFALTFFRFSFALPFVLWEKPLTYLPNATTEGWLAILY
PF00892         --------------LIWALYFVLQKLLLRRLSPLTILAYRFLLAALLLLLLLFLERLLLLTLRQWLALLL


                         .         .         *         .         .         .         .:140
query           MAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSWFKMLSACIIVTGVYLxxxxx
PF00892         LGLLGTALAYGLFFYALKYTPASRASALLALEPVFTALLAALLLGERLSLLQWLGIALIVAGVLL-----


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxx
PF00892         -----------